Author Topic: Funny Videos/Pictures  (Read 4163040 times)

0 Members and 18 Guests are viewing this topic.

Offline [MAF]Jur1z

Re: Funny Videos/Pictures
« Reply #2310 on: June 05, 2010, 02:11:49 pm »

Offline [MAF]Snoopy

  • Posts: 14,538
    • View Profile
Re: Funny Videos/Pictures
« Reply #2311 on: June 05, 2010, 06:24:58 pm »

Offline [2F2F]SNiKeRiS

  • Admin
  • Posts: 3,892
    • View Profile
    • 2F2F website
Re: Funny Videos/Pictures
« Reply #2312 on: June 05, 2010, 09:53:02 pm »
:L

[youtube]http://www.youtube.com/watch?v=_Qe904nt1DQ[/youtube]

Offline [MAF]Snoopy

  • Posts: 14,538
    • View Profile
Re: Funny Videos/Pictures
« Reply #2313 on: June 05, 2010, 10:02:56 pm »
lol entertaining :P

Offline [MAF]Cthulhu

Re: Funny Videos/Pictures
« Reply #2314 on: June 06, 2010, 07:44:37 am »
Awesome :L

Offline b00tsyou

  • Admin
  • Posts: 1,044
    • View Profile
Re: Funny Videos/Pictures
« Reply #2315 on: June 06, 2010, 10:06:02 am »
[Youtube]http://www.youtube.com/watch?v=jwMHD4mteMs&feature=related[/youtube]
 :D :D :D

Offline [MAF]Cthulhu

Re: Funny Videos/Pictures
« Reply #2316 on: June 06, 2010, 06:38:12 pm »
lol, this is supposed to be a robotic dog

[youtube]http://www.youtube.com/watch?v=nUQsRPJ1dYw[/youtube]

Offline ivanduk

  • Posts: 1,144
    • View Profile
Re: Funny Videos/Pictures
« Reply #2317 on: June 06, 2010, 06:50:50 pm »
[youtube]http://www.youtube.com/watch?v=K4-vIccfBtw&feature=player_embedded[/youtube]



[SFX]Dr.Hulka [4]: talking about gay give it to id 17
piggernenis [17]: haha
piggernenis [17]: hulka put me on ignore because he thinks im gay
[SFX]Dr.Hulka [4]: id 17 have aids

Offline ﱡ קּﻰﺢ Love

  • Admin
  • Posts: 1,936
  • Elements of life: Air, Water, Oil, Fuel
    • View Profile
    • LSR Forum
Re: Funny Videos/Pictures
« Reply #2318 on: June 06, 2010, 10:02:00 pm »
Sign-A-True

Offline MadMax

  • Lazyass, still hanging around AX from time to time
  • Admin
  • Posts: 4,359
  • I'm the road warrior...
    • View Profile
  • In-game name: MadMax[MAF]

PLEASE, IGNORE ALL MY SPELLING MISTAKES AND OTHER TYPOS True racing fans enjoy horsepower in ANY form

Offline [MAF]Epoxi

Re: Funny Videos/Pictures
« Reply #2320 on: June 07, 2010, 11:28:32 am »
Quote
And finally, sadly even the 67 character allowance for a .com domain name is still insufficient for the town of Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu
in New Zealand with a staggering 92 characters however even this seems positively tiny compared to the town of

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit

in Thailand which is a whopping 163 characters long so long that it doesn't even fit on one line! However whilst the New Zealand place name is recognised by the Guiness Book of Record, the Thailand name is not.


Offline [MAF]Sighmoan

  • Admin
  • Posts: 1,599
    • View Profile
Re: Funny Videos/Pictures
« Reply #2321 on: June 07, 2010, 11:56:38 am »
[youtube]qbqi0j7y_H8[/youtube]

Offline Tommmmmmm

  • Posts: 1,450
  • SnoopyFTW
    • View Profile
Re: Funny Videos/Pictures
« Reply #2322 on: June 07, 2010, 01:17:02 pm »
[youtube]qbqi0j7y_H8[/youtube]

WTF :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
HELLO THERE

Offline MadMax

  • Lazyass, still hanging around AX from time to time
  • Admin
  • Posts: 4,359
  • I'm the road warrior...
    • View Profile
  • In-game name: MadMax[MAF]
Re: Funny Videos/Pictures
« Reply #2323 on: June 07, 2010, 01:56:02 pm »

PLEASE, IGNORE ALL MY SPELLING MISTAKES AND OTHER TYPOS True racing fans enjoy horsepower in ANY form

Offline ivanduk

  • Posts: 1,144
    • View Profile
Re: Funny Videos/Pictures
« Reply #2324 on: June 07, 2010, 01:56:47 pm »
:L



[SFX]Dr.Hulka [4]: talking about gay give it to id 17
piggernenis [17]: haha
piggernenis [17]: hulka put me on ignore because he thinks im gay
[SFX]Dr.Hulka [4]: id 17 have aids