« previous next »
Pages: 1 ... 145 146 147 148 149 150 151 152 153 154 [155] 156 157 158 159 160 161 162 163 164 165 ... 663   Go Down

Author Topic: Funny Videos/Pictures  (Read 2302622 times)

0 Members and 5 Guests are viewing this topic.

Offline [AK47]M4lysz

  • Admin
  • Posts: 2,247
    • View Profile
    • [AK47]Forum
Re: Funny Videos/Pictures
« Reply #2310 on: June 05, 2010, 04:56:45 am »
Logged

Offline [MAF]Jur1z

Re: Funny Videos/Pictures
« Reply #2311 on: June 05, 2010, 02:11:49 pm »
Logged

Offline [MAF]Snoopy

  • Posts: 14,540
    • View Profile
Re: Funny Videos/Pictures
« Reply #2312 on: June 05, 2010, 06:24:58 pm »
Logged

Offline [2F2F]SNiKeRiS

  • Admin
  • Posts: 3,892
    • View Profile
    • 2F2F website
Re: Funny Videos/Pictures
« Reply #2313 on: June 05, 2010, 09:53:02 pm »
:L

[youtube]http://www.youtube.com/watch?v=_Qe904nt1DQ[/youtube]
Logged

Offline [MAF]Snoopy

  • Posts: 14,540
    • View Profile
Re: Funny Videos/Pictures
« Reply #2314 on: June 05, 2010, 10:02:56 pm »
lol entertaining :P
Logged

Offline [MAF]Cthulhu

  • Admin
  • Posts: 6,331
  • Trance, Progressive, Techno <3
    • View Profile
  • In-game name: [MAF]Phobos
Re: Funny Videos/Pictures
« Reply #2315 on: June 06, 2010, 07:44:37 am »
Awesome :L
Logged

Offline b00tsyou

  • Admin
  • Posts: 1,044
    • View Profile
Re: Funny Videos/Pictures
« Reply #2316 on: June 06, 2010, 10:06:02 am »
[Youtube]http://www.youtube.com/watch?v=jwMHD4mteMs&feature=related[/youtube]
 :D :D :D
Logged

Offline Gen

  • Admin
  • Posts: 512
  • I LIKE SPORTS
    • View Profile
Re: Funny Videos/Pictures
« Reply #2317 on: June 06, 2010, 10:30:25 am »
[youtube]http://www.youtube.com/watch?v=0o9u2W_iGNY[/youtube]


oops wrong topic. oh well
« Last Edit: June 06, 2010, 10:33:56 am by Gen »
Logged

Offline [MAF]Cthulhu

  • Admin
  • Posts: 6,331
  • Trance, Progressive, Techno <3
    • View Profile
  • In-game name: [MAF]Phobos
Re: Funny Videos/Pictures
« Reply #2318 on: June 06, 2010, 06:38:12 pm »
lol, this is supposed to be a robotic dog

[youtube]http://www.youtube.com/watch?v=nUQsRPJ1dYw[/youtube]
Logged

Offline ivanduk

  • Posts: 1,144
    • View Profile
Re: Funny Videos/Pictures
« Reply #2319 on: June 06, 2010, 06:50:50 pm »
[youtube]http://www.youtube.com/watch?v=K4-vIccfBtw&feature=player_embedded[/youtube]
Logged



[SFX]Dr.Hulka [4]: talking about gay give it to id 17
piggernenis [17]: haha
piggernenis [17]: hulka put me on ignore because he thinks im gay
[SFX]Dr.Hulka [4]: id 17 have aids

Offline ﱡ קּﻰﺢ Love

  • Admin
  • Posts: 1,936
  • Elements of life: Air, Water, Oil, Fuel
    • View Profile
    • LSR Forum
Re: Funny Videos/Pictures
« Reply #2320 on: June 06, 2010, 10:02:00 pm »
Logged
Sign-A-True

Offline MadMax

  • Lazyass, still hanging around AX from time to time
  • Admin
  • Posts: 4,359
  • I'm the road warrior...
    • View Profile
  • In-game name: MadMax[MAF]
Re: Funny Videos/Pictures
« Reply #2321 on: June 06, 2010, 10:25:51 pm »
Logged

PLEASE, IGNORE ALL MY SPELLING MISTAKES AND OTHER TYPOS True racing fans enjoy horsepower in ANY form

Offline [MAF]Epoxi

Re: Funny Videos/Pictures
« Reply #2322 on: June 07, 2010, 11:28:32 am »
Quote
And finally, sadly even the 67 character allowance for a .com domain name is still insufficient for the town of Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu
in New Zealand with a staggering 92 characters however even this seems positively tiny compared to the town of

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit

in Thailand which is a whopping 163 characters long so long that it doesn't even fit on one line! However whilst the New Zealand place name is recognised by the Guiness Book of Record, the Thailand name is not.

Logged

Offline [MAF]Sighmoan

  • Admin
  • Posts: 1,599
    • View Profile
Re: Funny Videos/Pictures
« Reply #2323 on: June 07, 2010, 11:56:38 am »
[youtube]qbqi0j7y_H8[/youtube]
Logged

Offline Tommmmmmm

  • Posts: 1,450
  • SnoopyFTW
    • View Profile
Re: Funny Videos/Pictures
« Reply #2324 on: June 07, 2010, 01:17:02 pm »
Quote from: [UK]Sigh on June 07, 2010, 11:56:38 am
[youtube]qbqi0j7y_H8[/youtube]

WTF :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
Logged
HELLO THERE
Pages: 1 ... 145 146 147 148 149 150 151 152 153 154 [155] 156 157 158 159 160 161 162 163 164 165 ... 663   Go Up
« previous next »