-
I don't know is there any topic like this, but i created this :D So show your funny vids here to us to see ;)
My favorite: Jeff Dunham - Achmed the Dead Terrorist
[youtube]http://www.youtube.com/watch?v=1uwOL4rB-go[/youtube]
Same achmed : Jeff Dunham Achmed's "Jingle Bombs" :D
[youtube]http://uk.youtube.com/watch?v=wskT6YfVB6E[/youtube]
Enjoy ! ;)
-
Like we haven't seen this already...
but good to post anyway :P
-
[youtube=500,293]http://uk.youtube.com/watch?v=6Z55OLcOVQA[/youtube]
[youtube=500,293]http://uk.youtube.com/watch?v=i7dB0LvTxOI[/youtube]
-
Top Gear - The most ridiculous challenge vs Germans! :D
1st challenge
[youtube]http://uk.youtube.com/watch?v=gSbC-rsb0yg&feature=related[/youtube]
2nd challenge
[youtube]http://uk.youtube.com/watch?v=D7MiVMq7NQg[/youtube]
3rd challenge
[youtube]http://uk.youtube.com/watch?v=_qxHkkSGIcs&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?v=vIatLyAdtAM[/youtube]
-
[youtube]http://www.youtube.com/watch?v=ehEXQi3meBM&feature=channel_page[/youtube]
[youtube]http://www.youtube.com/watch?v=jT7NQk5N0qY&feature=channel_page[/youtube]
[youtube]http://www.youtube.com/watch?v=su25Kz2TyPI&feature=channel_page[/youtube]
[youtube]http://www.youtube.com/watch?v=DJ2Cpvv2atQ&feature=channel_page[/youtube]
[youtube]http://www.youtube.com/watch?v=26WvlP2HxbY&feature=channel_page[/youtube]
enjoy ;D
-
[youtube]http://www.youtube.com/watch?v=7RMLt28n0-M&NR=1[/youtube]
[youtube]http://www.youtube.com/watch?v=GoCqvnJFUUA&feature=related[/youtube]
(5:43 the best)
[youtube]http://www.youtube.com/watch?v=5wfVDutW2Lw[/youtube]
[youtube]http://www.youtube.com/watch?v=zxEi3h5vqAY&feature=related[/youtube]
-
hahahaha ive seen that first video before - never gets old
-
Isn't it the well known knutico ? rofl xD
http://www.wrzuta.pl/film/y7Coi01Dgx
Snikeris check my avatar ;D
-
Snik,ur video with Achmed is cool lol ;D
-
Isn't it the well known knutico ? rofl xD
http://www.wrzuta.pl/film/y7Coi01Dgx
Snikeris check my avatar ;D
Loooool nice avatar man ;D ;D
But video is insane !!! ;D
Ah old times i remember this song when it was in every mobilephone. It was so popular :'( ;D
-
crazy.... :D
[youtube]http://www.youtube.com/watch?v=EaOMdRm3q4I&feature=channel[/youtube] [youtube]http://www.youtube.com/watch?v=hYJIAHpDRMs&feature=channel[/youtube] [youtube]http://www.youtube.com/watch?v=D5DlGcY5ASM&feature=channel[/youtube] [youtube]http://www.youtube.com/watch?v=8CihCIWgQGA&feature=channel[/youtube] [youtube]http://www.youtube.com/watch?v=lRefZf3gj74&feature=channel[/youtube]
-
lol at the chicken :L
-
http://www.youtube.com/watch?v=v5MWBKLclgs&feature=related
These fat chineses in elevator are the best
-
just put Worst Video Games Ever on youtube and u'll see something like this xDDDDDD
[youtube]http://www.youtube.com/watch?v=dKwA066rNn0[/youtube]
-
LOL :O
-
Speaking of video games...
[youtube]http://au.youtube.com/watch?v=UoxN8AEgSWc[/youtube]
[youtube]http://au.youtube.com/watch?v=SYRLTF71Sow[/youtube]
-
[youtube][/youtube]
-
lol thx
-
lol_haha_lol_haha:D:D:D
-
ABUAAHUAHAUAHAUAHUHAUAAHU XDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
rofl xDDD
-
Ah omg ! rofl rofl ! Ups slap and hahaha ! xDDDD ;D ;D
-
Here are three vid's of mine favourite list xD
[youtube]http://www.youtube.com/watch?v=l64Wk6KdROQ&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=8sd_HUZc794[/youtube]
[youtube]http://www.youtube.com/watch?v=TZFOo--18nw[/youtube]
-
loooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooool_haha
-
http://www.youtube.com/watch?v=ZInaKg47k3w
love that one xD
-
lol this song is cool
-
You know its gonna be a bad flight when you look out your window and see this shit… yep, what happened to the engine cover?
(http://files.uploadffs.com/d/06a4d295_planecrash5.jpg)
(http://files.uploadffs.com/3/a27834a7_sistercarcharias.jpg)
(http://files.uploadffs.com/b/0962b97f_1.gif)
(http://files.uploadffs.com/d/dcd4d42c_13.gif)
(http://files.uploadffs.com/8/43568b45_6.gif)
(http://files.uploadffs.com/a/b9a1a9b9_joehitme3.jpg)
xD
-
Lool yep M4! worse with that then Bermuda's triangle xD
-
those aren't videos! :O
-
LOL!
http://uk.youtube.com/watch?v=k-eNpvyJNuo
-
omg you record it? loool
-
You know its gonna be a bad flight when you look out your window and see this shit… yep, what happened to the engine cover?
(http://files.uploadffs.com/d/06a4d295_planecrash5.jpg)
:o
-
OMG IS THIS TURKISH AIR AGAIN XD ?
-
http://www.albinoblacksheep.com/flash/witchdoctor (http://www.albinoblacksheep.com/flash/witchdoctor) only for NUTZZZZ
http://youtube.com/watch?v=fJuNgBkloFE - I have no more question xD
-
[youtube]http://www.youtube.com/watch?v=vIatLyAdtAM[/youtube]
the guy is talking portuguese..
-
http://youtube.com/watch?v=fJuNgBkloFE - I have no more question xD
LMAO!! ''How many sides does a trianlge have?'' - ''Damn,four''; ''There's no sides.....One?'' xDDDDDDDDDDD :D :D :D
-
[youtube]http://pl.youtube.com/watch?v=N2QXGL8zesk[/youtube]
lool
-
Ali G & the NBA xDDD
[youtube]http://www.youtube.com/watch?v=ZPQVew0L0Vg&feature=PlayList&p=6BC876BB7B659435&playnext=1&index=7[/youtube]
-
The sick one... Maybe all know this :L
boom headshot
[youtube]http://www.youtube.com/watch?v=olm7xC-gBMY[/youtube]
-
[youtube]http://www.youtube.com/watch?v=AZETcd25-tU[/youtube]
-
It's in Xifre page :)
http://www.xfire.com/video/62726/
-
[youtube]http://www.youtube.com/watch?v=AZETcd25-tU[/youtube]
ROFLMAO that's classic ! xDDDDD
;D ;D ;D ;D :D :D :D :D :D
-
[youtube]http://www.youtube.com/watch?v=riTNLO2rCpo&feature=PlayList&p=FBCCD2159A2B9701&playnext=1&index=16[/youtube] parody of many songs :D
-
lol awesome
-
Can't stop laughing :L
[youtube]http://www.youtube.com/watch?v=x0OdYKc5Fuo&feature=related[/youtube]
-
lool
[youtube]http://www.youtube.com/watch?v=c2CnEu_KcxU[/youtube]
-
ROFL !! they look like 'monkeyfuckers' ;_; is it marmi and trampek ? :L :L
-
tampon and marmite :L
-
red-trampek
black-marmi
;_;
-
that´s why giving drugs to kids is a bad idea
-
check this friends xDDDDDDDDDDDDDDDDDD Disco in Packistan :D:D
http://www.maxior.pl/film/121683/Dyskoteka_w_Pakistanie
click on "Odtwarzaj" xD
-
actually this one is not a funny video, but Im too lazy to make another topic just for a video.
Here u go
http://www.metacafe.com/watch/811500/electric_meter_hack_how_to_cut_your_electricity_bill_in_half/
-
[youtube]http://www.youtube.com/watch?v=2a1CzNGNdrs[/youtube]
-
loool, a banana :L
-
Hahha yo guys,one day i was bored,rain outside...blah,and i go on youtube try look for to fast to fourios 4 trailers.And i saw this enjoy!(don't cut movies and turn on speakers xD) [youtube]http://www.youtube.com/watch?v=fp9ZZ3PSwPA&feature=related[/youtube]
-
looool Steben!! hahha good disco LETS PARTY!! roof on the fire! ;D
-
looool Steben!! hahha good disco LETS PARTY!! roof on the fire! ;D
lol what ? XD
-
hahah to fast to fourios cool video
(http://files.uploadffs.com/1/5b0a18a0/drzewo_cipa.jpg)
-
lool :L
-
hahah to fast to fourios cool video
(http://files.uploadffs.com/1/5b0a18a0/drzewo_cipa.jpg)
LoL happy pussy xD it looks like it smiles xD
-
http://www.youtube.com/watch?v=FW4qKwxX6Fo
(http://files.uploadffs.com/b/3528b90d/adrenalinex.bmp)
http://www.youtube.com/watch?v=FW4qKwxX6Fo
-
lol funny vid, love the TMA map, nice custom vehicles M4 ;D
-
haha funny ;D nice dumper :L
-
Yeah nice videos and that TMA track -.- :L :L
-
haha lol nice vid :D
-
rofl
-
(http://files.uploadffs.com/8/1fe78e3d/ushhour.PNG)
-
that's perfection :L
-
lmao ush hour ;D :L
-
hahahaha xDDD ;D
-
Now I wanna see 28 Ush weeks later :L
-
(http://files.uploadffs.com/5/2bca57c2/12345.jpg)
(http://files.uploadffs.com/7/4da67233/funny_sign_04.jpg)
(http://files.uploadffs.com/5/e1c85fd8/poorgasmilage.jpg)
(http://files.uploadffs.com/5/57675e14/StupidSign.jpg)
(http://files.uploadffs.com/7/2803745e/images.jpg)
-
ahhahah nice pictures m4 :L
-
nice pics m4 ;D
(http://i44.tinypic.com/fz7u2q.jpg)
-
(http://img264.imageshack.us/img264/2844/1dedykacjadladevil66653.jpg) (http://img264.imageshack.us/my.php?image=1dedykacjadladevil66653.jpg)
(http://img5.imageshack.us/img5/3494/devil666.jpg) (http://img5.imageshack.us/my.php?image=devil666.jpg)
-
(http://www.wayodd.com/funny-pictures2/funny-pictures-baywatch-nightmare-SoA.jpg)
-
LOL
-
(http://icanhascheezburger.files.wordpress.com/2007/12/funny-pictures-lol-squid.jpg)
(http://republika.pl/blog_xc_3794271/4827011/sz/lol-46383.jpg)
(http://icanhascheezburger.files.wordpress.com/2008/02/funny-pictures-black-l-cat-lol.jpg)
(http://icanhascheezburger.files.wordpress.com/2008/06/funny-pictures-kittens-lol-tetris.jpg)
(http://www.popular-pics.com/ppimages/OMG-WFT-BBQ.jpg)
(http://img2.moonbuggy.org/imgstore/omg-it-spins.jpg)
(http://img409.imageshack.us/img409/8258/pwned111za6.jpg)
(http://www.verso.pl/lu/w0_haha.jpg)
-
http://www.youtube.com/watch?v=RgriTO8UHvs
-
http://www.youtube.com/watch?v=PJupNDIKkEk xDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
-
rofl, arabians are crazy :L
-
[youtube]http://www.youtube.com/watch?v=_Fe17mCBzAk [/youtube]
-
http://www.youtube.com/watch?v=PJupNDIKkEk xDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
Lol ! And they just having fun with that :L :L :L
-
(http://files.uploadffs.com/1/e6961c9b/DSC01306.JPG)
-
haha emfour :L
-
(http://files.uploadffs.com/1/e6961c9b/DSC01306.JPG)
:))drugs? xD marijuana ^^, ghost smoke that shit many times with ours friends, i only smoke 2 times xD and it was in partys :L
-
crazy arabs :L
I like to participate in their games, sliding on sandals, maybe it could be new modification for AdrenalineX, Crazy Arab driving(=sandal sliding near car :L )
hhahaha ;_; :L :L :L
-
lol
ush always have cool idea :L
-
http://www.youtube.com/watch?v=fMyljwUTgbY
HOLY SHIT :O
-
Just don't know what to say lol. Funny and creapy at the same time :L
-
omg thats really creepy..
-
omfg! :o
-
Some dude from Lithuania making drift during lounch brake xDDD
http://www.juokis.com/2008/07/10/filmuok-driftinsiu/
-
only youtube links for work with [youtube] ;_;
-
Russian kids :L :L :L
http://www.juokis.com/2008/07/17/ivairus-video/
-
roflmao
-
lol what an bike expirience remebering my 1st time driving a bike xD
-
nice vids snik :L
-
[youtube]http://www.youtube.com/watch?v=mhx6RC8omIM[/youtube]
-
lol crazy
-
Today my one friend sent a link to me where was a video with chipmunks :L
If u wanna hear them just type chimpunks with your song name. :D
Like this: Fort minor - remember the name chimpunks
Here this for some lough:
[youtube]http://www.youtube.com/watch?v=k9mAwA3Nk1s[/youtube]
-
LoL haha
-
(http://img6.imageshack.us/img6/6994/fdgdfgd.th.jpg) (http://img6.imageshack.us/my.php?image=fdgdfgd.jpg)
-
I'm almost sure u all will enjoy background instead of foreground lol XD
(http://i44.tinypic.com/3339vtw.jpg)
-
hahah jali XD
-
(http://img23.imageshack.us/img23/1426/vsx127tmp.jpg) (http://img23.imageshack.us/my.php?image=vsx127tmp.jpg)
-
hahah and the dude at the pic is McPoo... i mean McPott ;_;
-
:L
-
"Me and my homie" lol xD
-
http://www.youtube.com/watch?v=mXFm_gzLoSM
-
Kurwa Alba, has no talent in actress :L
-
(http://www.bonappetit.com/images/tips_tools_ingredients/ingredients/ttar_egg_03_v_launch.jpg)
-
[youtube]http://www.youtube.com/watch?v=c7RQNQGPusk&NR=1[/youtube] lol so funny when u compare to polish language ;)
-
translate into english pls 8)
-
^
-
[youtube]http://www.youtube.com/watch?v=c7RQNQGPusk&NR=1[/youtube] lol so funny when u compare to polish language ;)
who the fuck translated those words lol, almost none of them are right :L
-
??? ??? ???
-
??? ??? ???
same
-
[youtube]http://www.youtube.com/watch?v=Y-6krPDviDA[/youtube]
-
hahahahahhaahahaha you had to didnt you :L :L :L :L :L :L :L :L :L :L :L :L :L
-
http://www.fotosik.pl/pokaz_obrazek/7506a7316af79a09.html
-
you have right you are n00b
-
[FSR]michalFake jest mniejszym noobem niz [FSR]michal hih
-
[FSR]michalFake jest mniejszym noobem niz [FSR]michal hih
chcia?by? lol
he said Michal is bigger noob than MichalFake xD
-
While i was looking for cars xDDDD
(http://i42.tinypic.com/eqci9v.jpg)
-
Looool, I love Remi Gaillard's video xD
-
(http://i13.tinypic.com/61v2uev.jpg)
-
NIGGERS?
-
[youtube]http://www.youtube.com/watch?v=ADY8UMeleWc[/youtube] xD
-
[youtube]http://www.youtube.com/watch?v=qOGNDoDPCnU[/youtube]
;D :D ;) :)
-
:L
-
Haddaway ftw
EDIT!!!
Especially for FireFox xDDD
http://www.joemonster.org/filmy/7879/What-is-Love-w-18-wersjach
-
roflmao :D :D :D :D :D :D :D :D :D :D :D :D :D :D
http://www.youtube.com/watch?v=l6NJqGPVd-A&feature=channel
-
LOOL! HAHA
-
(http://images48.fotosik.pl/92/c249ae9e3a2729c4m.jpg) (http://www.fotosik.pl/showFullSize.php?id=c249ae9e3a2729c4) that's was a Hitler "Wunderwaffe"
(http://images45.fotosik.pl/92/9c0b1b036f747480m.jpg) (http://www.fotosik.pl/showFullSize.php?id=9c0b1b036f747480) Wicked sick
(http://images36.fotosik.pl/88/4832a1d618a45b2am.jpg) (http://www.fotosik.pl/showFullSize.php?id=4832a1d618a45b2a) Spiderman duck Hero
(http://images45.fotosik.pl/92/342765b226ea5d3cm.jpg) (http://www.fotosik.pl/showFullSize.php?id=342765b226ea5d3c) Mr. Ericsson and Mrs. Nokia
(http://images45.fotosik.pl/92/6342be873c2e9a19m.jpg) (http://www.fotosik.pl/showFullSize.php?id=6342be873c2e9a19) Brainiac
(http://images41.fotosik.pl/88/2398e6be3ea3bb9fm.jpg) (http://www.fotosik.pl/showFullSize.php?id=2398e6be3ea3bb9f) Devil666 MTB racing xD
(http://images39.fotosik.pl/88/1111750a889c8e42m.jpg) (http://www.fotosik.pl/showFullSize.php?id=1111750a889c8e42) Batman and Dumbo
(http://images36.fotosik.pl/88/a695077f7c9680b7m.jpg) (http://www.fotosik.pl/showFullSize.php?id=a695077f7c9680b7) Last Unicorn xD
(http://images43.fotosik.pl/92/c2246e13835673e5m.jpg) (http://www.fotosik.pl/showFullSize.php?id=c2246e13835673e5) NRG 125
(http://images45.fotosik.pl/92/40f15beb5fc1e7f7m.jpg) (http://www.fotosik.pl/showFullSize.php?id=40f15beb5fc1e7f7) Africa Party
(http://images49.fotosik.pl/92/d930e2a8c0f00555m.jpg) (http://www.fotosik.pl/showFullSize.php?id=d930e2a8c0f00555) Day the Earth Stood Still
(http://images37.fotosik.pl/88/b9cfefaa2f79a5e8m.jpg) (http://www.fotosik.pl/showFullSize.php?id=b9cfefaa2f79a5e8) IN-Vitro in Japan
(http://images45.fotosik.pl/92/94370303d0294c48m.jpg) (http://www.fotosik.pl/showFullSize.php?id=94370303d0294c48) Deathmach
(http://images43.fotosik.pl/92/0425798d1c199c11m.jpg) (http://www.fotosik.pl/showFullSize.php?id=0425798d1c199c11) WTF Emo/Joker ? xD
(http://images50.fotosik.pl/92/b5ba0f6b0e2dd7b0m.jpg) (http://www.fotosik.pl/showFullSize.php?id=b5ba0f6b0e2dd7b0) Granny and alcohol..
(http://images41.fotosik.pl/88/00833d1bf17b22eem.jpg) (http://www.fotosik.pl/showFullSize.php?id=00833d1bf17b22ee) He isn't sick
(http://images46.fotosik.pl/92/3c4b771bf12c7dabm.jpg) (http://www.fotosik.pl/showFullSize.php?id=3c4b771bf12c7dab) Rambo Bambo cookies
(http://images50.fotosik.pl/92/0cdaa8e4674f6d9bm.jpg) (http://www.fotosik.pl/showFullSize.php?id=0cdaa8e4674f6d9b) "Dad .... am I rly Ugly?"
(http://images43.fotosik.pl/92/ec1eaab04c5ab4b4m.jpg) (http://www.fotosik.pl/showFullSize.php?id=ec1eaab04c5ab4b4) WTF stay there? :D
(http://images36.fotosik.pl/88/ec8204e4f1e15f6am.jpg) (http://www.fotosik.pl/showFullSize.php?id=ec8204e4f1e15f6a) Stunt vs wires
(http://images37.fotosik.pl/88/59de077388e2e528m.jpg) (http://www.fotosik.pl/showFullSize.php?id=59de077388e2e528) Doritos ... food for Aliens ?:D
(http://images43.fotosik.pl/92/113f264d2f8cad9em.jpg) (http://www.fotosik.pl/showFullSize.php?id=113f264d2f8cad9e) "Overhaulin'"
-
lmao!
-
nhahah nice michal =D
-
hahahahaha 8)
-
michal more pic like this! ;D
-
[youtube]http://www.youtube.com/watch?v=Fubs7wE4vTk[/youtube]
-
[youtube]http://www.youtube.com/watch?v=UZLYBGPU_c0[/youtube]
-
haha my 1st vid :D (i made it quickly so didn't do anything for better music =D
[youtube]http://www.youtube.com/watch?v=-oa6Tguf8cQ[/youtube]
-
hahaha nice one :L
btw that piss command is /a piss xD
-
pwnt lol when i saw this :L :L :L :L :L
here is the link :L
http://www.youtube.com/watch?v=pwdC2Ge4a5Q&feature=rec-HM-r2&flip=1
(http://i41.tinypic.com/35d9r2t.jpg)
-
lol new language :O
-
CSI: NY speaks lithuanian. I only understand half of what he said :L
[youtube]http://www.youtube.com/watch?v=hG6IIW7lEKQ[/youtube]
-
Snik, this is disgusting xD
[youtube]http://www.youtube.com/watch?v=bNF_P281Uu4[/youtube]
what a lucker :-\
-
lol that's crazy :L
-
what a lucker :-\
Lol Steven I told you about this movie and project over 4 moths ago :D
-
what a lucker :-\
Lol Steven I told you about this movie and project over 4 moths ago :D
It was u ? xDDDDDDDDDDDDDDDDDD
-
yes that was me :D (http://alejahandlowa.pl/obr/fabryka/431_d.jpg) <-- Stev u need that if u have problem with
memories XD
end off topic : (http://failblog.files.wordpress.com/2009/03/fail-owned-drunk-drown-fail.jpg?w=500&h=374), (http://failblog.files.wordpress.com/2008/12/fail-owned-announcement-fail.jpg),(http://failblog.files.wordpress.com/2009/03/fail-owned-surrender-fail.jpg?w=392&h=500),(http://failblog.files.wordpress.com/2009/03/fail-owned-car-window-fail.jpg?w=500&h=375)
-
lol "judgment" :L
-
Ush playing Far Cry 2 SP :D
I killed a goat xD xD
(http://img9.imageshack.us/img9/6217/farcry22009040201292881.jpg)
-
poor goat :(
-
RIP goat :'(
-
How to get the man wash his hands ???
(http://94.100.114.33/534250001-534300000/534251101-534251200/534251180_5_Oqyu.jpeg)
-
lol where it is?
-
somewhere... I dunno :L
-
Look what i found today xD on "car exhange" (http://images45.fotosik.pl/98/0959626b489a658am.jpg) (http://www.fotosik.pl/showFullSize.php?id=0959626b489a658a)
-
hello george :D
-
:L O :L ETE
-
Look what i found today xD on "car exhange" (http://images45.fotosik.pl/98/0959626b489a658am.jpg) (http://www.fotosik.pl/showFullSize.php?id=0959626b489a658a)
sup green freak xD
-
zielone prózni
-
CLICK ON ME -->(http://images40.fotosik.pl/95/7077f9dbaf3f64acm.jpg) (http://www.fotosik.pl/showFullSize.php?id=7077f9dbaf3f64ac)
-
hahah its me bitches :D
-
[youtube]http://www.youtube.com/watch?v=t-zxi_Y4Xu8[/youtube]
[youtube]http://www.youtube.com/watch?v=4qf1w2e2ju8&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=4bekQU9l8hk&NR=1[/youtube]
-
Poland have it too but in polish version :L but not funny like this
-
(http://www.casafree.com/modules/xcgal/albums/userpics/21848/normal_mr%20nike%20-%20extremely%20funny%20pictures.jpg)
-
and?
-
(http://img9.imageshack.us/img9/7637/getsomenuts.jpg)
-
snickers xD
-
(http://i42.tinypic.com/34p10ep.jpg)
-
;D
-
:L
-
wow I would love to get a sportsmotor one day... :D
(http://allsupersport.com/afbeeldingen/fotos/sportmotor10.jpg)
-
:L
-
[youtube]http://www.youtube.com/watch?v=jgU_4M7xr1U[/youtube]
:L
-
[youtube]http://www.youtube.com/watch?v=9DzS7squiSw[/youtube]
Also check part 8
-
^i always enjoyed movies with this actor :D :D
[youtube]http://www.youtube.com/watch?v=E3y6OmTVa4w[/youtube]
-
lol funny man :D
-
I would give him another euro for another beer for that performance :D :D
(http://www.filestreamer.net/elephant_s.jpg)
-
con las motos no se corre :D http://img4.imageshack.us/img4/841/ktmnehoda3k.jpg
-
Slide phail :D
[youtube]http://www.youtube.com/watch?v=bOXnxmlEkY0&feature=channel[/youtube]
-
:L ^ andy's favourite video
-
[youtube]http://www.youtube.com/watch?v=dnNTjnfw3fM[/youtube]
-
lol @ the dog :L :L :L
-
(http://i391.photobucket.com/albums/oo357/foylyndstrom/stormtroopersiggy.jpg)
lol @ the dog :L :L :L
:L
-
(http://files.uploadffs.com/7/15147a0d/thor.gif)
-
looool :L :L :L :L
-
:L
-
nice :) you got a weed grinder, still gotta buy one :L im grinding the weed with my hands everytime :P
-
MadMax check 1,52 xD
(http://i41.tinypic.com/2v9x0ti.jpg)
:D
btw its here
http://www.youtube.com/watch?v=sOyBiyjdB1g
-
(http://img27.imageshack.us/img27/6333/126667originalx2z6v.th.jpg) (http://img27.imageshack.us/my.php?image=126667originalx2z6v.jpg) (http://img201.imageshack.us/img201/8712/126666originalz5efq.th.jpg) (http://img201.imageshack.us/my.php?image=126666originalz5efq.jpg) (http://img201.imageshack.us/img201/6281/126664original0ld96.th.jpg) (http://img201.imageshack.us/my.php?image=126664original0ld96.jpg) (http://img201.imageshack.us/img201/5025/126271originale4m5f.th.jpg) (http://img201.imageshack.us/my.php?image=126271originale4m5f.jpg) (http://img201.imageshack.us/img201/6480/126266originalln0hr.th.jpg) (http://img201.imageshack.us/my.php?image=126266originalln0hr.jpg) (http://img201.imageshack.us/img201/7140/126259originalghnzi.th.jpg) (http://img201.imageshack.us/my.php?image=126259originalghnzi.jpg) (http://img201.imageshack.us/img201/967/126258original1pte3.th.jpg) (http://img201.imageshack.us/my.php?image=126258original1pte3.jpg) (http://img201.imageshack.us/img201/7641/126253original3e2r0.th.jpg) (http://img201.imageshack.us/my.php?image=126253original3e2r0.jpg) (http://img201.imageshack.us/img201/3729/127197originaliecbh.th.jpg) (http://img201.imageshack.us/my.php?image=127197originaliecbh.jpg)
-
nice stev, i arleady know that car, i don't like that tribal paint on doors, it looks like fuckin japan tuning (nissan, honda, toyota, mazda, or more of that 'Electric Shit' with tons os bass and neons :
i DON'T like this:
(http://www.wrzuta.pl/img/middle/g0OTaOe8o2/nissan_350z_modified_tuning_auto_carros_cars_800_x_559)
i LIKE this:
(http://anythingonwheels.files.wordpress.com/2009/04/1970-dodge-charger-rt.jpg)
-
Ah Max you are wrong also Americans could make "fuckin tuning" with cars.Anyway Japanese making very good cars at this moment.Nissan and Mazda are very popular brands in Europe.Also Americans were first who liked that "electric shits" ;)
-
i like some japan cas, i don't like that 'tehno-style' of some of them, i mean body kit, neons , bass etc...
i like easy construction without electric gadgets,
i like 'Rat Rods':
(http://www.enginebuildermag.com/Content/Site302/Basics/hcrat1jpg_00000005975.jpg)
and of course this... Ford Falcon 'The Last V8' Intreceptor from classical australian post-apocaliptic movie 'Mad Max'
(http://farm4.static.flickr.com/3007/2934143473_9e7df7b59c.jpg?v=0)
-
fuck off with that signature man...
-
ok...it seems to be 2 BIG
-
and not a little to big :o :o
-
muscle cars ftw
-
i know knu :D
-
[UK] AdrenalineX Racing - Forums > General > Off-Topic > Post reply ( Re: Funny Videos/Pictures )
-
(http://damien.webmedia.ee/lol.gif)
-
lol :L
-
rofl mankini ftw
-
(http://img23.imageshack.us/img23/6268/4005539.jpg)
(http://img26.imageshack.us/img26/9272/3489379.jpg)
(http://img142.imageshack.us/img142/8373/116866229.jpg)
(http://img26.imageshack.us/img26/8757/7012927.jpg)
(http://img26.imageshack.us/img26/6008/111126195.jpg)
-
lol best grandma ever :P
http://video.google.com/googleplayer.swf?docid=3009268562868196073&hl=en&fs=true
-
[youtube]http://www.youtube.com/watch?v=nllyMCF3Jyo&feature=related[/youtube] Metal Idol :D he has qualified
-
lol...in Romanian the show it's called MegaStar...and participants are more stupid then this
http://www.youtube.com/watch?v=SyITt55_aaM&feature=related
-
[youtube]http://www.youtube.com/watch?v=0hNXPvm5-YM[/youtube]
:L
Worms Armageddon ftw!
[youtube]http://www.youtube.com/watch?v=2KaiXeteNtQ[/youtube]
:L
-
(http://files.uploadffs.com/5/81e659cd/jesus20lol203ru0.jpg) (http://i43.tinypic.com/dp7qqg.jpg)
-
(http://i43.tinypic.com/dp7qqg.jpg)
LOL :L
-
Remi Gilliard (awesome French comedian ) watch his other movies
[youtube]http://www.youtube.com/watch?v=pIrvpn3k9A4&feature=channel_page[/youtube]
[youtube]http://www.youtube.com/watch?v=MytfhzcSF-Y&feature=channel_page[/youtube]
[youtube]http://www.youtube.com/watch?v=hYJIAHpDRMs&feature=channel_page[/youtube] My Fav ;) so many emotions R.I.P
[youtube]http://www.youtube.com/watch?v=gHCxdlZ7G18[/youtube]
http://www.youtube.com/watch?v=S4ZO2FD4pNA <---Decathlon on the streets :D
[youtube]http://www.youtube.com/watch?v=hqOBR_Xbw2I[/youtube]
[youtube]http://www.youtube.com/watch?v=81szj1vpEu8&feature=channel_page[/youtube]
[youtube]http://www.youtube.com/watch?v=RGy6txj8FQ0&feature=channel_page[/youtube]
[youtube]http://www.youtube.com/watch?v=eUUoWuC61yc&feature=channel_page[/youtube]
[youtube]http://www.youtube.com/watch?v=lRefZf3gj74&feature=channel_page[/youtube]
[youtube]http://www.youtube.com/watch?v=ScpArF2H3wM&feature=channel_page[/youtube]
[youtube]http://www.youtube.com/watch?v=Nc9yr4urskA&feature=channel_page[/youtube]
[youtube]http://www.youtube.com/watch?v=4LZ0ZXBQABo&feature=channel_page[/youtube]
[youtube]http://www.youtube.com/watch?v=EaOMdRm3q4I&feature=channel_page[/youtube]
[youtube]http://www.youtube.com/watch?v=dM-5jEAfonc&feature=channel_page[/youtube]
[youtube]http://www.youtube.com/watch?v=V6JU-v2nqRI&feature=channel_page[/youtube]
[youtube]http://www.youtube.com/watch?v=7SDec1UCzJ4&feature=channel_page[/youtube]
-
(http://i43.tinypic.com/dp7qqg.jpg)
LOL :L
Sick lol. :L
-
This with Jesus is hard lol :|
REMI Owns :L :L :L
youtube.com/nqtv ! :D
-
[youtube]http://www.youtube.com/watch?v=mlJWwuV9eBw[/youtube]
:D xD
-
fuck hamilton >:(
-
fuck hamilton >:(
:L
-
Alonso FTW
-
new heineken commercial, the walking fridge :L
[youtube]http://www.youtube.com/watch?v=K0d8sdGVVQc[/youtube]
-
looool, i think everyone would love it at home :L
-
yes i wanna order one :L
-
[youtube]http://www.youtube.com/watch?v=ed4CHkN-Dkw[/youtube]
-
wow magnificent
-
[youtube]http://www.youtube.com/watch?v=x_z1Icyu5gI[/youtube]
-
chinese girls look like man and have no tits :L
-
wtf :L :L :L :L :L :L :L :L :L
-
that was disturbing
-
[youtube]http://www.youtube.com/watch?v=L8CWPPRPhIw[/youtube]
I LIKE POLSKI GIRLS!! :D :D :D
-
ugly shoes
-
I LIKE POLSKI GIRLS!! :D :D :D
*Polish
-
lol only czech song i know
-
why can't girls act normal ffs, it's such a turn off when they act silly, just suck my cock and stfu!
-
girls havin fun ftw :P
-
there's normal then there's stupid ;_;
-
[youtube]http://www.youtube.com/watch?v=EXwpsaHueUk[/youtube]
lol finnish on foot, not in car
-
why can't girls act normal ffs, it's such a turn off when they act silly, just suck my cock and stfu!
^ init :D
-
fuck hamilton >:(
http://www.youtube.com/watch?v=RpUQY-zoFnE
lol
-
hamilton is such a dick
-
(http://i44.tinypic.com/a9sd3k.jpg)
:L
(http://i40.tinypic.com/106aezm.jpg)
:L
-
:L :L :L
-
:L :L :L
:L :L :L
-
(http://i39.tinypic.com/65dg85.jpg)
-
rofl nice cycling path
-
I fucking love Killerbunnies sig lol
-
Init, but girl could be with strings ;D
-
LOL @ racer XD
-
who dont xD
-
Disturbed xD
-
I like her too, love her tattoo near the ass
-
Nice observation Disturbed, I didn't even notice her tattoo.
I just love her boucing boobs lol
-
Disturbed xD
ROFLMAO!!! XD
_________________________
[youtube]http://www.youtube.com/watch?v=VWORQkiFXuE[/youtube]
-
Nice commercial :L :L
[youtube]http://www.youtube.com/watch?v=Ij2Xbu-XhCI[/youtube]
-
orginal version is in french language :L
-
LMAO :L :L :L
-
[youtube]http://www.youtube.com/watch?v=5blbv4WFriM[/youtube]
[youtube]http://www.youtube.com/watch?v=3eZBevXohCI&feature=PlayList&p=5A560D48F7CADEA6&playnext=1&playnext_from=PL&index=11[/youtube]
[youtube]http://www.youtube.com/watch?v=UQqx5EsbSfY&feature=PlayList&p=5A560D48F7CADEA6&index=12&playnext=2&playnext_from=PL[/youtube]
-
lol
-
[youtube]http://www.youtube.com/watch?v=4dvxEXOCV7I[/youtube]
[youtube]http://www.youtube.com/watch?v=c0186hRd-tY[/youtube]
-
this is from czech O2 advertisement
(http://img217.imageshack.us/img217/2205/35200901559.png)
-
m4lysz :o
-
thats a fat cock ;D
-
(http://images43.fotosik.pl/118/39454c53df5c6a98m.jpg) (http://www.fotosik.pl/showFullSize.php?id=39454c53df5c6a98) Devil can you explain Us what this plate mean ?:D. It hangs over WC on my job lmao
-
ROFLMAO!!
in english : ''Love means helping each other.''
:L :L
-
Laska - mean "love"? nice but it in polish mean-" nice ,pretty, sexy, girl or woman", or walkingstick for old peoples xD :D
-
Laska - mean "love"? nice but it in polish mean-" nice ,pretty, sexy, girl or woman", or walkingstick for old peoples xD :D
lol :L
-
(http://listverse.com/wp-content/uploads/2009/01/marijuana-tm.jpg)
-
^ ;D
(http://images5.cafepress.com/product/264467515v11_350x350_Front_Color-Red.jpg)
-
lool :L
-
(http://i254.photobucket.com/albums/hh106/oi_vean/Mota.jpg?t=1241548745)
-
haha ;D
-
(http://www.mundohamster.info/funnylol.jpg)
-
(http://images50.fotosik.pl/119/b5c08f571fc3816bm.jpg) (http://www.fotosik.pl/showFullSize.php?id=b5c08f571fc3816b) my result :D in GRID. 10 laps on racing track in Nissan Silvia
-
michals avatar is great :D
-
(http://i129.photobucket.com/albums/p238/one_me21/Mickey_Mouse_On_Pot.jpg?t=1241650250)
(http://www.authorstream.com/Content/Octavio-11464-Funny-images-music-Entertainment-ppt-powerpoint-118_88.jpg)
(http://i713.photobucket.com/albums/ww140/vavral2/funny/450-lavickaprohubene.jpg?t=1241650717)
-
LOOL at that bench, i didn't read what was written beneath it and was thinking "haha against fat people" and then i read it and LOL it is against fat people xD
-
[youtube]http://www.youtube.com/watch?v=fkFOVjFmZo0[/youtube]
-
(http://img503.imageshack.us/img503/7192/666g.jpg) (http://img503.imageshack.us/my.php?image=666g.jpg)
-
5 AM LOL
:L
-
nice number ;_;
-
http://www.youtube.com/user/D4nielleq (http://www.youtube.com/user/D4nielleq)
-
(http://4.bp.blogspot.com/_Nd_IfLPxU0E/SRz5xrm75XI/AAAAAAAAAAg/k-34vSL6XfM/S1600-R/shutupandy_logo.JPG)
It even has its own website: www.shutupandy.com (http://www.shutupandy.com) :L
-
lol
-
you will need to feed andy to make him happy again ;_;
-
[youtube]http://www.youtube.com/watch?v=1b7DKQx5SCw[/youtube]
-
roflmao
-
[youtube]http://www.youtube.com/watch?v=HT9_O3X9Llc[/youtube]
-
Embedding disabled by request
haha k bunnies got pwned
-
Embedding disabled by request
haha k bunnies got pwned
yeah :-[ :L
-
argh fucking youtube >:(
-
i want the youtube from back in the days again :(
-
[youtube]http://www.youtube.com/watch?v=FJ5iQKLIr3g[/youtube]
-
[youtube]http://www.youtube.com/watch?v=Lrk6vsb77xk[/youtube]
[youtube]http://www.youtube.com/watch?v=0Uc4Ksz3nHM[/youtube]
[youtube]http://www.youtube.com/watch?v=YfZDtC9kjVk[/youtube]
-
(http://i43.tinypic.com/2mg5beq.jpg)
(http://i44.tinypic.com/14c5lb6.jpg)
(http://i41.tinypic.com/308a5wy.jpg)
-
looooooooool :D
-
rofl at the emo lemon
-
hollywood lol ;D
-
[youtube]http://www.youtube.com/watch?v=1b7DKQx5SCw[/youtube]
-
Snoopy where did u find it :D ( too many free time ?:D) It's crazy man " la laa la laaaa" :D
-
(http://files.uploadffs.com/b/99dbb997/sprzet.JPG)
-
nice :D
-
Snoopy where did u find it :D ( too many free time ?:D) It's crazy man " la laa la laaaa" :D
he found it at http://forum.adrenalinex.co.uk/index.php/topic,362.msg12636.html#msg12636 ;_;
-
[youtube]http://www.youtube.com/watch?v=1b7DKQx5SCw[/youtube]
cool man ;D
-
Snoopy where did u find it :D ( too many free time ?:D) It's crazy man " la laa la laaaa" :D
he found it at http://forum.adrenalinex.co.uk/index.php/topic,362.msg12636.html#msg12636 ;_;
well it was so nice, it had to be posted twice ;_;
[youtube]http://www.youtube.com/watch?v=UwjplOzC4d8&feature=channel[/youtube]
-
crazy cat!!
-
LOL @ the cat !
-
He's sais: What are you looking at ? Huh ? Wanna get a punch ? :L :L
-
nice cat :L
-
(http://files.uploadffs.com/b/99dbb997/sprzet.JPG)
(http://i34.tinypic.com/9xnb.gif)
-
Lol, check this out http://www.take40.com/artists/photo-galleries/16224/rihanna-nude-photo-scandal!--/
-
ohhh shit i'd like to stick my dick into here :D
-
what dick ??? ??? ??? ??? ???
-
lol :D
-
what dick ??? ??? ??? ??? ???
(http://www.barringtonstoke.co.uk/images/partnumber/enlarged/%7B7C3542B9-F37A-4BD6-ADEE-7CEC67A78D50%7D_Dick%20Turpin.JPG)
-
legends and lies haha :L
-
:L
-
(http://i42.tinypic.com/2cxjllw.jpg)
-
lool
btw Hledá se pes means Looking for the dog
:L
-
(http://i43.tinypic.com/24wh89s.jpg)
:L
-
Haha i can see same thing everyday :L :L
-
ahaha drunk sleeping ftw
-
special for ush xD
(http://i41.tinypic.com/2mpamns.jpg)
(http://i42.tinypic.com/29ogxa1.jpg)
(http://i44.tinypic.com/nbr7o0.jpg)
:L
-
yeah me2, ordinary view in Poland :L
-
check this http://piv.pivpiv.dk/ (http://piv.pivpiv.dk/)
-
[youtube]http://www.youtube.com/watch?v=N0uddWzK61c[/youtube]
hahah this looks like failed mafia liquidation:
[youtube]http://www.youtube.com/watch?v=N150KoCr2pM[/youtube]
-
haha, that guy in the first video speaks czech :L
-
it was devil on the road practising for SAMP but he lag rammed dumper :L
-
lol that car is very similiar to my old teacher's one, she was stupid cow so this is probably her lag :L
-
last for today :L
(http://i44.tinypic.com/2woxich.jpg)
(http://i44.tinypic.com/2ro58ue.jpg)
-
LOLETE :D
ok link doesnt wanna work so click it: http://www.dumpert.nl/mediabase/497951/14a269ec/kodak_momentje.html
-
hahaha :L :L :L :L :L
-
devil see this: http://www.dumpert.nl/mediabase/497761/1ab4b458/pfff._even_bijkomen.html
-
lol
(http://i40.tinypic.com/34hxgfq.jpg)
-
LoL Ush i know place in video with drunk (or something) guy :D
-
devil see this: http://www.dumpert.nl/mediabase/497761/1ab4b458/pfff._even_bijkomen.html
Is that you Ush on video? ;D
-
(http://i41.tinypic.com/352hpja.jpg)
lool
-
devil see this: http://www.dumpert.nl/mediabase/497761/1ab4b458/pfff._even_bijkomen.html
Is that you Ush on video? ;D
ahaha noo luckely not :D
-
[youtube]http://www.youtube.com/watch?v=nQmm6IGN8ds[/youtube]
lol funny bug xD
-
(http://i39.tinypic.com/2v98560.jpg)
(http://i44.tinypic.com/2vi347k.jpg)
(http://i42.tinypic.com/23wmzao.jpg)
-
(http://failblog.files.wordpress.com/2009/02/fail-owned-my-first-fail.jpg?w=500&h=375)
(http://failblog.files.wordpress.com/2009/04/fail-owned-playground-area-fail.jpg?w=500&h=423)
-
nice playground :L
(http://tinypic.com/view.php?pic=2wfjupc&s=5)
-
it's so popular. i heard people are dying to get in ;_;
-
nice playground :L
emo playground
-
(http://i2.photobucket.com/albums/y3/MetalThrashingMad/l_0903b629be24cecf35fb1675a451b37c.jpg)
(http://i2.photobucket.com/albums/y3/MetalThrashingMad/toomanyhappymealsthumbki3.jpg)
(http://i2.photobucket.com/albums/y3/MetalThrashingMad/sandiskxdhr.jpg)
(http://i2.photobucket.com/albums/y3/MetalThrashingMad/l_f6531edf34a74cf9204a168266194297.jpg)
(http://i2.photobucket.com/albums/y3/MetalThrashingMad/CarRedundancy.jpg)
(http://i2.photobucket.com/albums/y3/MetalThrashingMad/image024.jpg)
(http://i2.photobucket.com/albums/y3/MetalThrashingMad/loool.jpg)
Knutico :D
(http://i2.photobucket.com/albums/y3/MetalThrashingMad/fatkid.jpg)
(http://i2.photobucket.com/albums/y3/MetalThrashingMad/LOL-1.jpg)
(http://i2.photobucket.com/albums/y3/MetalThrashingMad/some-old-guy.jpg)
Only metal heads would get this one:
(http://i2.photobucket.com/albums/y3/MetalThrashingMad/kvlt1.jpg)
-
Knutico :D
(http://i2.photobucket.com/albums/y3/MetalThrashingMad/fatkid.jpg)
HAHAHAHHAHAHAHAHHAHAHAHHAHAHAHAHHA :L :L :L
-
loooooool
-
(http://i39.tinypic.com/32ztglc.jpg)
-
thx cysio i really gotta poo, but why 3 hours of walking for it :(
-
(http://files.uploadffs.com/b/1750b4e4/funny_images_318.gif)
(http://files.uploadffs.com/9/cab59ba6/stupid_pictures120.gif)
(http://files.uploadffs.com/3/189232d9/stupid_pictures124.jpg)
(http://files.uploadffs.com/d/fac3dc75/stupid_pictures145.jpg)
(http://files.uploadffs.com/6/c5de6715/stupid_pictures207.jpg)
(http://files.uploadffs.com/a/53a2a081/stupid_pictures225.jpg)
(http://files.uploadffs.com/e/c884e643/stupid_pictures235.gif)
(http://files.uploadffs.com/6/bca464db/stupid_pictures237.jpg)
(http://files.uploadffs.com/d/342ddfc8/stupid_pictures239.jpg)
(http://files.uploadffs.com/d/0e3dd82c/stupid_pictures242.jpg)
(http://files.uploadffs.com/8/dfce8674/stupid_pictures313.gif)
(http://files.uploadffs.com/5/6ddd5e3b/stupid_pictures321.gif)
(http://files.uploadffs.com/0/33de0317/stupid_pictures322.jpg)
-
lol @ the giant bra :L
-
Mmmmm hot (bull)dogs :L
-
(http://www.demotivateus.com/posters/myspace-next-time-you-try-to-look-hot-flush-the-toilet-demotivational-poster.jpg)
-
looool that is a big fail xD and very disgusting :o
-
omg shes so fu...in ugly xD
-
A shit :o :L
-
omg blah (http://smilies.vidahost.com/otn/blobs/grn_md_wht.gif)
-
;_; (http://smilies.vidahost.com/otn/blobs/grn_md_wht.gif) ;_;
-
(http://smilies.vidahost.com/otn/blobs/orng_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/peach_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/gry_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/gld_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/trq_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/blu_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/grn_md_wht.gif)
-
;_; (http://smilies.vidahost.com/otn/blobs/orng_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/peach_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/gry_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/gld_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/trq_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/blu_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/grn_md_wht.gif) ;_;
-
(http://i40.tinypic.com/282j8za.jpg)
-
haha ;D
:L ;_; (http://smilies.vidahost.com/otn/blobs/orng_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/peach_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/gry_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/gld_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/trq_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/blu_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/grn_md_wht.gif) ;_; :L
-
(http://i40.tinypic.com/282j8za.jpg)
lol those things are huge, she probably wishes they stuck straight out :D
-
hahah penis-tree :D
-
:L
-
(http://www.angelfire.com/ca6/tomswebpage/penisrock.jpg)
(http://www.angelfire.com/ca6/tomswebpage/cactus.jpg)
(http://www.marydiamond.com/photogallery/PenisTree2.jpg)
WTF is this thing :D
(http://www.myconfinedspace.com/wp-content/uploads/2007/06/tree.jpg)
-
hahaha ;D
(http://files.uploadffs.com/1/5b0a18a0/drzewo_cipa.jpg)
(http://sopcloud.com/sopclan/images/photoalbum/funny_tree_penis8022.jpg)
-
hahaha ;D
(http://sopcloud.com/sopclan/images/photoalbum/funny_tree_penis8022.jpg)
lmao ;D
-
(http://sweisthal.com/db3/00265/sweisthal.com/_uimages/PussyTreeN.Y..jpg)
-
trees can be ugly :o
-
(http://s54.photobucket.com/albums/g115/hootie39/gotcomments/userpics/funny/penis-tree.jpg)
-
trees can be ugly :o
yea ugly trees :L
-
(http://i40.tinypic.com/2ut47ip.jpg)
-
lol :L
-
[youtube]http://www.youtube.com/watch?v=XjQo8bW94Gs[/youtube]
-
haha nice :L
-
(http://img31.imageshack.us/img31/9233/129027original8v0lc.jpg)
-
I suppose to laugh ? :L
-
I suppose to laugh ? :L
u just did it ^^
-
(http://i39.tinypic.com/jqns03.jpg)
-
(http://i40.tinypic.com/2czadt0.jpg)
-
haha nice :L
-
:L
(http://i40.tinypic.com/2ymhxm0.jpg)
-
(http://i39.tinypic.com/6rilon.jpg)
-
knutico drawing mike with tits while banned :D
-
OWNED XDDDDDDDDDDDDD
[youtube]http://www.youtube.com/watch?v=kMZu7lpJr6M[/youtube]
-
lol fajny pies
-
hahaha poor dog :P
We all have that once in a period when we dream while getting awake xD
-
(http://i43.tinypic.com/2edbaqp.jpg)
-
lol poor people in that bus ^^
(http://i40.tinypic.com/a9vcdx.jpg)
-
fresh morning :L
(http://i41.tinypic.com/4h9ibl.jpg)
-
:L
(http://i43.tinypic.com/fypoqt.jpg)
-
lol
i dont want know what is normal toilet in that country :L
-
[youtube]http://www.youtube.com/watch?v=PlvtI0WBrHY[/youtube]
-
nice video :D
-
lol
i dont want know what is normal toilet in that country :L
a hole in the ground lol ;_;
-
lol
i dont want know what is normal toilet in that country :L
a hole in the ground lol ;_;
maybe something like this
(http://i42.tinypic.com/xp4sh5.jpg)
-
(http://i43.tinypic.com/2edbaqp.jpg)
super gt bus :L
-
super gt bus :L
YES! LOOOL!!!
btw who is this girl in your avatar? I like the way her left tittie bounces when she picks up her shirt :D
-
(http://i43.tinypic.com/2edbaqp.jpg)
super gt bus :L
Good one, moo !! :L :L
-
super gt bus :L
YES! LOOOL!!!
btw who is this girl in your avatar? I like the way her left tittie bounces when she picks up her shirt :D
dunno :L i call her adrenalinex girl :L
-
mooman's sister :(
-
(http://newmedia.funnyjunk.com/pictures/sexy_man.jpg)
GAY CARTER
(http://newmedia.funnyjunk.com/pictures/womandriver.jpg)
CAR FOR WOMEN
(http://newmedia.funnyjunk.com/pictures/0546.jpg)
DOCTOR ON RACE
(http://newmedia.funnyjunk.com/pictures/baddesign.jpg)
LOL
(http://newmedia.funnyjunk.com/pictures/water_owned.jpg)
(http://newmedia.funnyjunk.com/pictures/dildo_dog.jpg)
-
(http://img41.imageshack.us/img41/4023/newbitmapimagev.jpg) (http://img41.imageshack.us/my.php?image=newbitmapimagev.jpg)
-
lol
Kid playing guitar hero
[youtube]http://www.youtube.com/watch?v=kezrztP9Vg8[/youtube]
-
:L :L :L
(http://forum.adrenalinex.co.uk/index.php?action=dlattach;attach=509;type=avatar)
-
cheese grater slide :L
-
cheese grater slide :L
ouch :L
-
(http://img2.imageshack.us/img2/714/chinesecheesegraterslid.jpg)
-
poor boy :'(
-
he got sliced into little pieces :(
-
(http://i40.tinypic.com/28chbnc.jpg)
(http://i39.tinypic.com/2aetto0.jpg)
-
(http://i40.tinypic.com/28chbnc.jpg)
-
(http://img2.imageshack.us/img2/714/chinesecheesegraterslid.jpg)
Haha, he won't be as he was before sliding here :L
-
Yestarday I saw this situation on my street :D "woman in the car"(http://images38.fotosik.pl/123/63b5a4a9cca27e8bm.jpg) (http://www.fotosik.pl/showFullSize.php?id=63b5a4a9cca27e8b)
-
Haha chinese quality :L
[youtube]http://www.youtube.com/watch?v=g5SRyG6UR2A[/youtube]
-
American quality 8)
[youtube]http://www.youtube.com/watch?v=lG7Yx9hmJ1g[/youtube]
-
Arabian quality ;_;
[youtube]http://www.youtube.com/watch?v=bWax-G1AlvA[/youtube]
-
Haha chinese quality :L
This car is "Chery Amulet" :D based on Seat Toledo 1st generation 1991-99, but chinese used cheap and worst material on the world :D
-
Arabian quality ;_;
http://www.youtube.com/watch?v=bWax-G1AlvA
omg thats insane lol :o
:L
-
sick, videoclip in excel LOL
[youtube]http://www.youtube.com/watch?v=h9_YkXHCkgA[/youtube]
lol
-
[youtube]http://www.youtube.com/watch?v=kwfeHb6UdjM[/youtube]
-
[youtube]http://www.youtube.com/watch?v=kwfeHb6UdjM[/youtube]
hahahahahahaha nice video :L :L :L
3:53 WTF xDDDDD
-
[youtube]http://www.youtube.com/watch?v=YPQ_N4imYVE[/youtube]
-
[youtube]http://www.youtube.com/watch?v=sfkDxF2kn1I[/youtube]
-
:L
-
[youtube]http://www.youtube.com/watch?v=T5nwfPKFGio[/youtube]
-
[youtube]http://www.youtube.com/watch?v=sfkDxF2kn1I[/youtube]
Im left only with... my shitty N64 :L :L :L
-
devil, what this mean ?
(http://obczaj.net/obrazki/58485.jpg)
-
loool it says debil :L
-
devil, what this mean ?
I DRIVE LIKE A DEBIL SINCE 1/7/2006
It's not me who drives, but a person near me that got out of the car and ran away.
-
(http://www.popgadget.net/images/Duck%20Fadar%20leuchtend%20k_tb.jpg)
Duck Vader
-
now we can know how is computer mouse made of ;D
(http://obczaj.net/obrazki/58518.jpg)
Elegant - Buick Roadmasterkiller
(http://obczaj.net/obrazki/58523.jpg)
russia tuning ;D
(http://obczaj.net/obrazki/58528.jpg)
cheap GPS (almost) ;D
(http://obczaj.net/obrazki/58509.jpg)
-
Oh deer :(
-
that car doesnt look like elegant
-
that car doesnt look like elegant
What happend max, got owned ? Haha >:(
-
That's not a real deed..
-
that car doesnt look like elegant
it is dev, look
Buick Roadmaster
(http://www.autocarparts.com/images/products/buick/roadmaster.jpg)
(http://ruckerautosales.com/auto/images/1/471878.jpg)
(http://www.carcollectorclassifieds.com/ccselect/uploads/internetpics/Fas0907107001-1-005.jpg)
(http://cokupic.pl/i/om_big6906927.jpg)
(http://www.analogstereo.com/images/om/buick_roadmaster.jpg)
Elegant
(http://www.gtagaming.com/images/sanandreas/cars/Elegant%20copy.jpg)
(http://www.gtagaming.com/images/sanandreas/cars/Elegant%20(rear)%20copy.jpg)
Yeah, I'm cars freak...
have i right (left, top, bottom, middle, side,etc... :D) ?
-
Funny Videos/Pictures
;_;
-
yea It is funny, /me is car freak...
^this is funny^
-
Ruick Roadmaster
ruick? rick? isnt it supposed to be buick? :L
-
Rick Roadmaster :(
-
now is correct, thanks for 'catch' this mistake
-
[youtube]http://www.youtube.com/watch?v=_CQ152n3MIs&feature=channel_page[/youtube]
-
Not funny :o
-
i heard that guy got really injured. mustve really hurt :(
-
excuse me while i laugh :L :L :L :-X
-
excuse me while i laugh :L :L :L :-X
lol
[youtube]http://www.youtube.com/watch?v=KXN9Z4Whksk&feature=related[/youtube]
-
I bet everyone have already seen it, but never mind :L
120,108,429 views !
[youtube]http://www.youtube.com/watch?v=dMH0bHeiRNg[/youtube]
-
awesome XD
-
(http://img22.imageshack.us/img22/5854/pic11hl.jpg)
-
(http://img37.imageshack.us/img37/5091/n81563694012720047783.jpg)
(http://img37.imageshack.us/img37/1926/fbxbxfbcfb.jpg)
(http://img37.imageshack.us/img37/7518/hahahahahah.jpg)
-
(http://img35.imageshack.us/img35/3590/71522581.jpg) (http://img35.imageshack.us/my.php?image=71522581.jpg)
(http://img196.imageshack.us/img196/2294/1021534.jpg) (http://img196.imageshack.us/my.php?image=1021534.jpg)
-
hahaha!! Where is this bathroom? I like the girl with the tape measure :D
-
chris price - stop the bus
(http://img29.imageshack.us/img29/540/stopthatbusiwantsomebee.jpg)
-
(http://img22.imageshack.us/img22/5854/pic11hl.jpg)
Guy sucking to other guy ? :L :L
-
(http://files.uploadffs.com/9/f33792fe/1241379902821.gif)
(http://files.uploadffs.com/6/b98b60a5/todaywasagoodday.jpg) (http://files.uploadffs.com/6/b98b60a5/todaywasagoodday.jpg)
(http://files.uploadffs.com/0/7ea00cc5/mindcontrol.gif)
(http://files.uploadffs.com/a/3fd7a5ee/toiletseat.jpg)
(http://files.uploadffs.com/1/ceed1705/1237851795461.jpg)
(http://files.uploadffs.com/a/5c1aa0a4/1237750420495.jpg)
(http://files.uploadffs.com/3/60b93d5c/1237749301864.gif)
(http://files.uploadffs.com/c/b661c434/1237631647521.jpg)
(http://files.uploadffs.com/3/912f3802/1237521206156.jpg)
(http://files.uploadffs.com/0/3b550d5e/1235709313525.jpg) (http://files.uploadffs.com/0/3b550d5e/1235709313525.jpg)
(http://files.uploadffs.com/6/39a069e6/sittingbear.jpg)
(http://files.uploadffs.com/2/940c2d92/featherbottom.gif)
-
Ouch !! ;D
[youtube]http://www.youtube.com/watch?v=LbOTffTBQPk[/youtube]
-
your pictures are the best moo ;D ;D
''The story of Oedipus'' HAHAHAHA :L :L
-
??? Yoooo,How do you post the video right on here? Thanks.
-
ctrl v
-
Stone and drunk :D Please watch the whole video http://www.youtube.com/watch?v=hr8VEcbSw48 I forgot to add this video too. Too Live Or Not To Live: That Is The Question. http://www.youtube.com/watch?v=g26cIojkwug :-\
-
poor elvis, he was actually crying :(
-
The Ice Cube chart was nice moo :D
-
it's not very funny but oh well :L gta2 ftw
(http://img35.imageshack.us/img35/1222/lolkfk.jpg)
-
it's not very funny but oh well :L gta2 ftw
Haha very cool :D
-
That's cool :D
-
I love this :L :L :L
[youtube]http://www.youtube.com/watch?v=R4l8epXHneI&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?v=_AJ0SkbPxAk&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=EuAVgWJ28Hw&feature=related[/youtube]
-
Haha great ones :L :L
-Mornin
-Good day to you ser.
-Hey, wait a minute, what a hell ! :L
-
KTM Biggest motorcycle :o (http://img11.imageshack.us/img11/7274/biggestmotorcyclex.jpg) (http://img11.imageshack.us/my.php?image=biggestmotorcyclex.jpg) and this-2009 AERO EV 1,000 HP FASTEST ELECTRIC EVER (http://img527.imageshack.us/img527/1859/2009ultimateaero.jpg) (http://img527.imageshack.us/my.php?image=2009ultimateaero.jpg)
-
I went to the annual Gloucester Cheese Rolling thing yesterday and it was top fun. The video's i got were shit, but there are loads on youtube:
http://www.youtube.com/results?search_type=&search_query=cheese+rolling&aq=f
It is even more mental in real life, the hill is stupidly steep!!
-
crazy :L :L
-
(http://www.shuandjoe.com/blogpics/Dave_tuzki.jpg)
[youtube]http://www.youtube.com/watch?v=Pi_tH7bMBzs[/youtube]
-
its my KTM pony !!! xDDD
(http://www.uncrate.com/men/images/2007/05/ktm-x-bow.jpg)
(http://allworldcars.com/wordpress/wp-content/uploads/2007/05/ktm-x-bow.jpg)
(http://www.automotivetraveler.com/images/stories/easygallery/resized/131/1228497804_KTM_Orange-Black_Car.jpg)
its mini car :D
but my motobike is this ------->
(http://www.jdk.com.au/Photos/Ebay07/KTM125SX98.jpg)
xDDD
-
but my motobike is this ------->
(http://www.jdk.com.au/Photos/Ebay07/KTM125SX98.jpg)
(http://www.freesmileys.org/smileys/big/big-smiley-003.gif) (http://www.freesmileys.org)
-
(http://files.uploadffs.com/6/27d36fda/LSD.bmp)
-
lol where you get it ?
from gta3.IMG ?
-
ye
-
but my motobike is this ------->
(http://www.jdk.com.au/Photos/Ebay07/KTM125SX98.jpg)
(http://www.freesmileys.org/smileys/big/big-smiley-003.gif) (http://www.freesmileys.org)
what ? :DDD
-
(http://fsb.zedge.net/content/7/7/2/6/1-1229972-7726-t.jpg)
:L
-
lol :L
cool pic
-
LOL LMAO ROFL OMG WTF
[youtube]http://www.youtube.com/watch?v=OO6H8NFdYQ8[/youtube]
-
I wouldn't use caps and bold text for my comment on that video, it ain't that funny. Just a kid who fails :L
-
[youtube]http://www.youtube.com/watch?v=DzMfnq_M97Q[/youtube]
Ding-a-ling-ling-ling-ling-ling-ling-ling!
Boo-ba-doo-ba-doop!
Boo-ba-doo-ba-doop!
Ring ring ring ring ring ring ring banana phone
Ring ring ring ring ring ring ring banana phone
I've got this feeling, so appealing,
for us to get together and sing. Sing!
Ring ring ring ring ring ring ring banana phone
Ding dong ding dong ding dong ding donana phone
It grows in bunches, I've got my hunches,
It's the best! Beats the rest!
Cellular, Modular, Interactivodular!
Ring ring ring ring ring ring ring banana phone
Boop-boo-ba-doo-ba-doop!
Ping pong ping pong ping pong ping panana phone
It's no baloney, it ain't a p(h)ony
My cellular bananular phone!
Don't need quarters, don't need dimes,
to call a friend of mine!
Don't need computer or TV,
[ Find more Lyrics on www.mp3lyrics.org/ES ]
to have a real good time!
I'll call for pizza. I'll call my cat.
I'll call the white house, have a chat!
I'll place a call around the world, operator get me Beijing
-jing-jing-jing!
(Soprano Sax Solo)
Yeah!
Play that thing!
(Piano Solo)
Whooo Hooo!
Ring ring ring ring ring ring ring banana phone
Boop-boo-ba-doo-ba-doop
Yin yang yin yang yin yang ying yonana phone
It's a real live mama and papa phone,
a brother and sister and a dogaphone,
a grandpa phone and a grammophone too! Oh Yeah!
My cellular, bananular phone!
Banana phone, ring ring ring!
(It's a phone with a peel!)
Banana phone, ring ring ring!
(Now you can have your phone and eat it too!)
Banana phone, ring ring ring!
(This song drives me, Bananas!)
Banana phone, ring ring ring!
-
Epic :L
-
[youtube]http://www.youtube.com/watch?v=HbPDKHXWlLQ[/youtube]
-
Ring ring ring ring ring ring ring banana phone!
(http://files.uploadffs.com/a/589ca78a/gmix_banana_phone.jpg)
HAHAHAH :D
-
[youtube]http://www.youtube.com/watch?v=LDyXdAf3LR0&feature=related[/youtube]
The monkey goes "My cock" !!! :L :L :L
-
^ i love family guy :D
-
some ppl don't like Sabre
[youtube]http://www.youtube.com/watch?v=YlZ03B1fpVE[/youtube]
-
some ppl don't like Sabre
[youtube]http://www.youtube.com/watch?v=YlZ03B1fpVE[/youtube]
Who wouldn't like Sabre, all like it xD
-
cysio doesnt like it :(
-
Here it is, UK server. Is it R's house in this street ? :L
(http://img194.imageshack.us/img194/103/yoojpg.png)
-
watch this [youtube]http://www.youtube.com/watch?v=rrO8AFGi_rc[/youtube]
and this [youtube]http://www.youtube.com/watch?v=G5WLrvRJCIw[/youtube]
-
Here it is, UK server. Is it R's house in this street ? :L
(http://img194.imageshack.us/img194/103/yoojpg.png)
that map isnt accurate. server is here: http://maps.google.co.uk/maps?f=q&source=s_q&hl=en&geocode=&q=SL6+2HP&sll=53.956086,-4.042969&sspn=24.476729,67.5&ie=UTF8&ll=51.499693,-0.709305&spn=0.006285,0.016479&t=h&z=17&iwloc=A
-
watch this [youtube]http://www.youtube.com/watch?v=rrO8AFGi_rc[/youtube]
and this [youtube]http://www.youtube.com/watch?v=G5WLrvRJCIw[/youtube]
(http://forum.adrenalinex.co.uk/Smileys/default/tRDvJjVtKsqb6zdWUBdiJt7emmc.gif)
You can watch the cow actually get owned in this one
[youtube]http://www.youtube.com/watch?v=nieK4GHov-Y&NR=1[/youtube]
-
hahah yeh suicidal cows :D
-
poor cows :(
-
(http://obczaj.net/obrazki/61714.jpg)
(http://obczaj.net/obrazki/61677.jpg)
(http://obczaj.net/obrazki/61516.jpg)
(http://obczaj.net/obrazki/61505.jpg)
(http://obczaj.net/obrazki/61454.jpg)
(http://obczaj.net/obrazki/61458.jpg)
(http://obczaj.net/obrazki/61354.jpg)
-
loool half price and star wars ;D
and cool car body looks like carmageddon
(http://www.owned.com/Owned_Pictures/Darth_Vader_In_Online_Game_Scenario_Owned.jpg)
-
(http://hairstylequestions.com/wp-content/uploads/hairy-lady.jpg)
-
omg lol
-
O.M.G!
-
blegh (http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)
-
(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)
-
(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)
-
:D
-
She's pretty nice... Shame on you guys.
Haha, JOKE !! :L :L
-
[youtube]http://www.youtube.com/watch?v=HEbkCo5oZJ8[/youtube]
-
(http://www.uglypeople.se/images/pictures/700/700.jpg)
-
(http://www.uglypeople.se/images/pictures/700/700.jpg)
Rita's girlfriend ? :L
-
it is man, girl or both? ??? ???
-
It's a girl stuffed with steroids :L
-
nice moustache :D
-
lol @ transvest
-
Looks like it's addicted to hormone replacement tablets :L+
-
:L :L :L
-
We can't see her/his lower part of body... So it might be surprising :L
-
[youtube]http://www.youtube.com/watch?v=XfEr_S9xtVY[/youtube]
cool and silly :D
-
PUT IT IN YOUR ZAKJE!
Watch this comedy show, it's in english with dutch subtitles ;) Very funny.
[youtube]http://www.youtube.com/watch?v=_t55EIwIaus[/youtube]
-
[youtube]http://www.youtube.com/watch?v=jqLDyXnNkF4[/youtube]
-
lol :L
-
Morning
(http://forum.adrenalinex.co.uk/Smileys/default/tRDvJjVtKsqb6zdWUBdiJt7emmc.gif) "GHER"
(http://files.uploadffs.com/1/261a1aa0/squnk.JPG)
-
lol you need to clean that pipe
-
i smoke just joints.. not with pipe.. but i wanna buy a pipe in the future :P
(http://i40.tinypic.com/282j8za.jpg)
lol those things are huge, she probably wishes they stuck straight out :D
[youtube]http://www.youtube.com/watch?v=X0rVtvcXjIM[/youtube]
hahaha ;D
(http://files.uploadffs.com/1/5b0a18a0/drzewo_cipa.jpg)
(http://sopcloud.com/sopclan/images/photoalbum/funny_tree_penis8022.jpg)
[youtube]http://www.youtube.com/watch?v=eOwKZ-F2xsI[/youtube]
-
saucepan head
-
wtf is this ?
(http://www.moparaction.com/Article/Schnapps/1.jpg)
-
Well... Thats a stupid american, no offence.
-
I wonder if its legal to drive whatever that is
-
notice that car is Mercedes Benz.
-
this car can beat OverHauling :D
-
notice that car is Mercedes Benz.
was* :D
-
Mirror's Edge ;D
-
Well, it reminds me a car from "Ghost Busters" :L
-
(http://i42.tinypic.com/30w4kzr.jpg)
-
lol
-
lol
[youtube]http://www.youtube.com/watch?v=A85soTwdyUY[/youtube]
-
this is a future ;_;
-
https://tv.rockstargames.com/videos/view/id/60AC8344B0911E28 (https://tv.rockstargames.com/videos/view/id/60AC8344B0911E28)
xDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD !!
-
(http://i44.tinypic.com/wtjcir.jpg)
-
:L :L
-
these funny comics are on:
http://pbfcomics.com/
enjoy ;D
-
lol
(http://pbfcomics.com/archive_b/PBF246-Bee.gif)
-
check this:
http://www.joemonster.org/filmy/7879/What-is-Love-w-18-wersjach
:L
-
:L
I like cysio's signature :D
-
bus drifting :L
-
GT bus
-
nah I meant the Heroes sig but I like the bus too :L
-
(http://files.uploadffs.com/b/9791b2a7/DSC01459.JPG)
(http://files.uploadffs.com/8/eb2780ae/DSC01460.JPG)
-
m4lysz magic, is that your real namee?? wtf
[youtube]http://www.youtube.com/watch?v=RLDgFolmQIc[/youtube]
-
:L they send those sims to any name
-
hahaha ok lol
So if I wanna order that sim for Mr Leave Me Outside they will deliver it :D :D
-
[youtube]http://www.youtube.com/watch?v=1n9SYRimpR4[/youtube]
-
http://www.theonion.com/content/video/nascar_coach_reveals_winning
LoL drive fast stratagy :D
-
:L :L :L :L :L :L :L
[youtube]http://www.youtube.com/watch?v=j-IqlnCnKaM&eurl=http%3A%2F[/youtube]
-
I'm not a racist btw :D
(http://whereshouldistart.files.wordpress.com/2008/07/nigger-joes-tar-soap.jpg)
-
:L
[youtube]http://www.youtube.com/watch?v=aVj-A1hVwKU&feature=related[/youtube]
-
:D :D :D :D :D :D :D :D :D
-
Might have already been posted, i can't be arsed to go through every page to check.
[youtube]LHY8NKj3RKs[/youtube]
-
lol ^
-
-That clock gonna keep ticking until it reaches 999 !
-What's gonna happen then ?!
-Nothing, you just suck.
:L :L :L
-
(http://img31.imageshack.us/img31/7912/stars1424816c.jpg)
-
lol i heard on news about her yesterday...he wanted only 3 starts....but now she has 56 :D :D :D
-
so funny :L
-
Dumb bitch lol How can you not feel a difference between 56 stars and 3 lol
Did you see the man who gave her the tattoo? lol
Gotta find a pic of him lol
(http://www.foxnews.com/images/539841/2_62_tattoogirl_6_320.jpg)
-
Ah freak ! :-X
-
lol i heard that she fell asleep at him ;D
-
Who is this girl? xD
-
[youtube]http://www.youtube.com/watch?v=jrYxFEm_NNI[/youtube]
lol gtamissions on sa-mp :L
-
Servers like that are the reason I coded AX lol
-
THIS IS SO FUCKING FUNNY :L
[youtube]http://www.youtube.com/watch?v=cyOUJvDpH_w[/youtube]
-
-God, you're allright ?!
-Fine, why do you ask?
:L :L :L
-
loolll
-
buahahahaha
-
(http://auto.multiplayer.ro/wp-content/uploads/2007/12/beetle_sex.jpg)
(http://bp0.blogger.com/_NmHOPs9j4rc/SDgJO4Vb2lI/AAAAAAAAAN0/vc_VKOIkfx0/s400/boobs_car.jpg)
(http://www.strangevehicles.com/images/content/109980.jpg)
(http://www.spedeworthv8stockcars.com/funny-airliner-crash-bad-flight-pilots-blooper-burned-out-plane.jpg)
(http://www.spedeworthv8stockcars.com/blank%20bins.jpg)
-
bush is a noob :L
-
(http://files.uploadffs.com/3/7da03055/howtoconfuseanidiot.PNG)
-
(http://files.uploadffs.com/3/7da03055/howtoconfuseanidiot.PNG)
HAHAHAHAHAA, u got me ! :L :L
-
nice mooNman :D
-
There's no video ! ;D
-
Keep on clicking :P
-
:L :L this is sick !
(http://img76.imageshack.us/img76/2665/b2ze5.gif)
-
omg :L :L :L
-
that's disgusting :L
-
its brilliant :L
-
^
-
(http://www.visualjokes.com/pics/583_analtv.jpg)
-
lol anal
-
haha I made some pictures of FSR bicycle bags :P
I'll post them monday when I'm at my student room again :D Don't have the wire here.. :/
-
(http://img4.imageshack.us/img4/1323/55j1d2tmp.jpg)
-
hahaha :L :L
so many ezra's :D
-
u shud have used my better picture >:( :L
(http://i44.tinypic.com/2dvk3ex.jpg)
terrorist getting crucified ;)
-
rofl :D
-
lmao :L
-
u shud have used my better picture >:( :L
(http://i44.tinypic.com/2dvk3ex.jpg)
terrorist getting crucified ;)
:L :L :L
-
Ouch :L :L
-
(http://obczaj.net/obrazki/65242.jpg)
(http://obczaj.net/obrazki/62923.jpg)
(http://obczaj.net/obrazki/62742.jpg)
(http://obczaj.net/obrazki/28572.jpg)
(http://obczaj.net/obrazki/28525.jpg)
(http://obczaj.net/obrazki/28477.jpg)
(http://obczaj.net/obrazki/28122.jpg)
[youtube]http://www.youtube.com/watch?v=E_GfL6YH1_o[/youtube]
-
Whats so funny in Titanic picture lol and Napoleon in Moscow... Everyone knows that he got ownd by cold :L
-
Whats so funny in Titanic picture lol and Napoleon in Moscow... Everyone knows that he got ownd by cold :L
Titanic got also owned by cold :L
-
can u translate that polish picture please?:L
-
(http://uvtblog.com/wp-content/uploads/2009/06/oh-sweet-futurama-748701.jpg)
-
can u translate that polish picture please?:L
put the money from the right side of a car (passenger's seat'
dont go on the place where cars are ridin (u know, this caruzel :D where u can drive cars and bump to each other xD)
while u driving with a small child, dont let her/him to crash with a mouth at the wheel (lol mouth is used here with a vulgarization lol) and thats the point of it xD
-
lol
-
(http://i40.tinypic.com/nei2io.jpg)
-
;_;
(http://img23.imageshack.us/img23/6455/q811a2tmp.jpg)
-
:L :L
-
[youtube]http://www.youtube.com/watch?v=-jGnZhYKoCY[/youtube]
-
lool
-
(http://i40.tinypic.com/nei2io.jpg)
That is brilliant.
-
Haha, yes it is :L :L
-
Bicycle Repairman :D
[youtube]http://www.youtube.com/watch?v=U01xasUtlvw[/youtube]
-
(http://obczaj.net/obrazki/66708.jpg)
(http://obczaj.net/obrazki/66679.jpg)
(http://obczaj.net/obrazki/66559.jpg)
(http://obczaj.net/obrazki/66568.jpg)
(http://obczaj.net/obrazki/66196.jpg)
(http://obczaj.net/obrazki/66191.jpg)
(http://obczaj.net/obrazki/29958.jpg)
(http://obczaj.net/obrazki/29898.jpg)
(http://obczaj.net/obrazki/29919.jpg)
(http://obczaj.net/obrazki/29852.jpg)
(http://obczaj.net/obrazki/29358.jpg)
(http://obczaj.net/obrazki/29248.jpg)
(http://obczaj.net/obrazki/29249.jpg)
(http://obczaj.net/obrazki/29250.jpg)
(http://obczaj.net/obrazki/38351.jpg)
(http://obczaj.net/obrazki/38225.jpg)
http://obczaj.net/pl/57424/
-
(http://www.8notes.com/wiki/images/Mj872.jpg)
-
hmmmm how is that supposed to be fun?
-
Bicycle Repairman :D
[youtube]http://www.youtube.com/watch?v=U01xasUtlvw[/youtube]
lmao :D :D
-
hmmmm how is that supposed to be fun?
dunno I was drunk :L
-
[youtube]http://www.youtube.com/watch?v=dAkuxb6-gS8[/youtube]
-
roflmao
-
[youtube]http://www.youtube.com/watch?v=dAkuxb6-gS8[/youtube]
Classic vide ;D.Nice.
hmmmm how is that supposed to be fun?
dunno I was drunk :L
Holy cow man you are going really insane when you are drunk... :)
-
[youtube]http://www.youtube.com/watch?v=lVk9xyJKOeg[/youtube]
-
hmmmm how is that supposed to be fun?
dunno I was drunk :L
Holy cow man you are going really insane when you are drunk... :)
I drink till I can't stand anymore, that's the way it is :L
-
Dunno if someone posted this yet..... BTW:
[youtube]http://www.youtube.com/watch?v=UDTZCgsZGeA&playnext=3&p=6CB5EA5FF2DBA577&index=31&feature=PlayList&playnext_from=PL&ytsession=Ku_qHYAFXbcCDsO65pnn55uypIZhNtAmcn4oCoQgJeu9VdjrEExx189PNPNC_lmZYewBPR3NFMmWuar-B3_35pthmxM1ajZCcL5oVyZ9m30oswX7C5xzAElfC_ueYrW-89wh8uYO49ZrTgNF3EAHY0k5PDngi1qw20HXpWqtvDrWvyB2VjbVct71BXcU71Z9ACUf8TlmrSnMzOI4iZbMGh3W7z5XLbMjkoOy1hrLNpjE29nzy-dchNz3OW9NHiK5xWALBKBkzy0SRMJlTnuBwpnxdrShG2Yrur99x86VKQRO3CkBDRy4KF_L04PGVrBVwMMDLYUCyh7_lGEW8Xp7VmO_hO4dIs1J[/youtube]
Wazaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa! :L :L :L
-
Oooooooold video, but end is awesome :L
-
Could have already been posted as is old, but is totally awsome:
[youtube]hMnk7lh9M3o[/youtube]
-
:L :L :L
[youtube]http://www.youtube.com/watch?v=0ewK0vqf278[/youtube]
-
:L :L :L
[youtube]http://www.youtube.com/watch?v=0ewK0vqf278[/youtube]
bullshit :o :D
-
and why can't the girl be madmax with a white sheet :D
-
cause i not wear white ;_;
-
so your no KKK member :L
-
what it mean?
-
KKK = Ku-Klux-Klan
fucking racists lol
-
Are those guys dressed in white with sharp hats or something and they have cutted eyes in those hats ? :L
-
yep, they look like this
(http://maaadddog.files.wordpress.com/2009/05/ku-klux-klan.jpg)
-
They look nice to me :L :L
-
they are not any nice ;_;
but yea, their costumes look funny :L
-
Bad guys ;)
And wooo 1k posts ;D
-
1028 for me, woo :L
-
1599 !!
-
Over!! :L
[youtube]http://www.youtube.com/watch?v=KJCfUm21BsI&feature=related[/youtube]
-
haha :L :L
-
May have been posted already, but makes me giggle every time:
[youtube]J---aiyznGQ[/youtube]
Any fan of Streetfighter 2 will love these. Make sure you watch them in YouTube as there is about 8 of them which forms the entire series (i can't be bothered to post all the links) This is part 1:
[youtube]kLrWgVPeCzI[/youtube]
-
Rally WRC Jumping compilation :D there are some realy nice jumps
[youtube]http://www.youtube.com/watch?v=w4vxLuwn2zA&feature=fvw[/youtube]
-
Just for Max:
[youtube]LT-fuvH8ww4[/youtube]
-
Just for Max:
[youtube]LT-fuvH8ww4[/youtube]
lol what an idiot, cant even spell it right :L
-
(http://i41.tinypic.com/11gq9g5.jpg)
-
(http://obczaj.net/obrazki/68992.jpg)
(http://obczaj.net/obrazki/69004.jpg)
(http://obczaj.net/obrazki/68883.jpg)
(http://obczaj.net/obrazki/68885.jpg)
(http://obczaj.net/obrazki/68843.jpg)
(http://obczaj.net/obrazki/68783.jpg)
(http://obczaj.net/obrazki/68787.jpg)
(http://obczaj.net/obrazki/68795.jpg)
(http://obczaj.net/obrazki/67967.jpg)
(http://obczaj.net/obrazki/67969.jpg)
(http://obczaj.net/obrazki/67767.jpg)
(http://obczaj.net/obrazki/67084.jpg)
(http://obczaj.net/obrazki/67582.jpg)
is this czeh ?
(http://obczaj.net/obrazki/67521.jpg)
-
is this czeh ?
(http://obczaj.net/obrazki/67521.jpg)
yeh haha, it means Your shit, our pleasure!
:L :L :L
-
WASZE GÓWNO, NASZA RADOSC ?
-
WASZE GÓWNO, NASZA RADOSC ?
yep
-
Radosne Gówno :D
http://englishrussia.com/?p=1434 <- watch this :)
http://englishrussia.com/?p=1373 <- and this
-
Yea russians always does something funny! :-*
-
(http://obczaj.net/obrazki/61032.jpg)
(http://obczaj.net/obrazki/46027.jpg)
-
haha, nice pictures max :L :L
-
(http://youreowned.yo.funpic.de/i/owned2.jpg)
-
(http://obczaj.net/obrazki/69295.jpg)
(http://obczaj.net/obrazki/69241.jpg)
(http://obczaj.net/obrazki/69251.jpg)
(http://obczaj.net/obrazki/69132.jpg)
-
[youtube]http://www.youtube.com/watch?v=FsJH3_txX7s&feature=related[/youtube]
-
(http://obczaj.net/obrazki/69379.jpg)
(http://obczaj.net/obrazki/69385.jpg)
(http://obczaj.net/obrazki/69388.jpg)
(http://obczaj.net/obrazki/69356.jpg)
(http://obczaj.net/obrazki/69725.jpg)
(http://obczaj.net/obrazki/69736.jpg)
(http://obczaj.net/obrazki/69681.jpg)
(http://obczaj.net/obrazki/69662.jpg)
(http://obczaj.net/obrazki/69575.jpg)
(http://obczaj.net/obrazki/56651.jpg)
(http://obczaj.net/obrazki/56625.jpg)
(http://obczaj.net/obrazki/60747.jpg)
(http://obczaj.net/obrazki/60731.jpg)
-
lol riot hacking :L
[youtube]http://www.youtube.com/watch?v=3kzW5PIZEa4[/youtube]
-
:L
-
;_;
-
[youtube]http://www.youtube.com/watch?v=L0dwXvAvT20&feature=related[/youtube]
-
An English comedian about the dutch supermarket "Albert Heijn", very funny :D :D
[youtube]http://www.youtube.com/watch?v=_t55EIwIaus[/youtube]
Tarzan takes a bath:
[youtube]http://www.youtube.com/watch?v=WXTWa16AMSg[/youtube]
Yay:
[youtube]http://www.youtube.com/watch?v=PBtcqK55fQA[/youtube]
-
anybody know who larry king is?
(http://files.uploadffs.com/b/a4bfba74/128848917513894020.jpg)
(http://files.uploadffs.com/0/f6550b56/larrykingtotallylookslikeprofessorfarnsworthfromfuturama.jpg)
-
anybody know who larry king is?
http://en.wikipedia.org/wiki/Larry_King
-
Talk show dude :D
-
he's a douchebag
-
yeah he is >:(
-
(http://www.motika.com.mk/images/stories/07-2009/wtfwtf/Wtf_06.jpg)
-
« Reply #666 on: Today at 18:36:22 »
:L
-
That isn't funny antivirus :D
-
That isn't funny antivirus :D
than why are you laughing? ;_;
btw sth for devil :L ;_;
(http://www.motika.com.mk/images/stories/04-2009/zgradi-vo-666-forma/1239619870_1.jpg)
-
when i saw this i remember Final Destination (3 ?)
(http://obczaj.net/obrazki/70047.jpg)
haha
(http://obczaj.net/obrazki/70070.jpg)
(http://obczaj.net/obrazki/69995.jpg)
for M4
(http://obczaj.net/obrazki/70062.jpg)
-
btw sth for devil :L ;_;
(http://www.motika.com.mk/images/stories/04-2009/zgradi-vo-666-forma/1239619870_1.jpg)
;_;
when i saw this i remember Final Destination (3 ?)
(http://obczaj.net/obrazki/70047.jpg)
yea lol :D
-
for M4
(http://obczaj.net/obrazki/70062.jpg)
not for me ?? >:( :( >:(
-
get your own >:(
-
??? lol
-
not showing.......
-
....................... you taking the piss max?
-
sorry, i didn't noticed it not showing, sorry again
-
kk np ;_;
-
This pic says trues lol :-* :
(http://img35.imageshack.us/img35/5573/snooby.jpg) (http://img35.imageshack.us/i/snooby.jpg/)
-
fucking travian popup at imageshack >:(
-
lol.. a while ago I pwnt the dutch travian servers but I'm hated now :D :D
-
fucking travian popup at imageshack >:(
Lol you got that shit too :L
----
(http://www.iwatchstuff.com/2007/11/28/hoff-knight-rider-mustang.jpg)
Still can't forget that episode where knight rider got that button with letter C which opens roof and makes it coupe :L
-
Controller needed a thorough cleaning :D
(http://i2.photobucket.com/albums/y3/MetalThrashingMad/cont-1.jpg)
-
Ha, best way to clean small spaces is to clean them with earwax cleaners :L
-
(http://i25.tinypic.com/14k8jde.jpg)
(http://i28.tinypic.com/2nuocp5.jpg)
:L
-
Havent seen that one with Chuky before. Good one :L
-
(http://i25.tinypic.com/14k8jde.jpg)
(http://i28.tinypic.com/2nuocp5.jpg)
:L
Stuff i was always in love with. :P
[Youtube]http://www.youtube.com/watch?v=vnRqYMTpXHc[/youtube]
Funny face.Cool song.
-
Omg i cant stop laughing :L :L All live!
[youtube]http://www.youtube.com/watch?v=pKaDfALhoPg[/youtube]
-
haha nice :L
-
OWNED xD
(http://www.fugly.com/media/IMAGES/Funny/Grand_Theft_Auto_Somalia.jpg)
-
already completed that game :D
-
thats a very oooooooooold game :D
-----------------
(http://img403.imageshack.us/img403/2397/planebg.jpg)
(http://img197.imageshack.us/img197/6848/65242.jpg)
(http://img403.imageshack.us/img403/1169/129629original5bnap.jpg)
(http://img196.imageshack.us/img196/9484/132892originalemq0i.jpg)
(http://img525.imageshack.us/img525/8708/133111originalw3gc1.jpg)
(http://img196.imageshack.us/img196/4703/133112originalxyah0.jpg)
(http://img136.imageshack.us/img136/2646/133113originalm7gru.jpg)
(http://img115.imageshack.us/img115/4530/133131originalw9p78.jpg)
(http://img228.imageshack.us/img228/5571/133327originalhikqj.jpg)
(http://img403.imageshack.us/img403/3033/133537originaloaglh.jpg)
(http://img525.imageshack.us/img525/7050/133555original47pyb.jpg)
(http://img228.imageshack.us/img228/4002/133692originald7gk8.jpg)
(http://img522.imageshack.us/img522/7285/129743originalc5j0t.jpg)
(http://img522.imageshack.us/img522/4448/129744originals4k5v.jpg)
(http://img522.imageshack.us/img522/8908/129904originalb7k0y.jpg)
(http://img41.imageshack.us/img41/6804/130546original1jza6.jpg)
(http://img522.imageshack.us/img522/74/130803originalc15jl.jpg)
(http://img403.imageshack.us/img403/9629/130804originalorhmv.jpg)
(http://img228.imageshack.us/img228/3977/132033originaldk26q.jpg)
-
last 2 epic
-
So that "locked tire couple" means if you lock your tire = you are most stupid man of world. :P Leave it without any safety attachment so the person stealing it can use it without any spends on that. ^^
-
OWNED xD
(http://www.fugly.com/media/IMAGES/Funny/Grand_Theft_Auto_Somalia.jpg)
This game is real or just funny pic ? :L
-
it's real i bought it 2 weeks ago it's very funny 8)
-
looool
-
[youtube]http://www.youtube.com/watch?v=zE0NOQG8WXs[/youtube]
-
and why is 2pac on the front at 0.56 with GTA bronx lol :L
-
(http://img41.imageshack.us/img41/7089/18130351.jpg) (http://img41.imageshack.us/i/18130351.jpg/)
-
omg devil :L :L :L :L :L
-
:D
-
Oh jalcino understands russian :D
-
Oh jalcino understands russian :D
no, thats serbian ;_;
-
[youtube=500,293]http://uk.youtube.com/watch?v=6Z55OLcOVQA[/youtube]
[youtube=500,293]http://uk.youtube.com/watch?v=i7dB0LvTxOI[/youtube]
loling :L
-
Hmm its kirilica and i can understand it lol
-
When I was walking through my city I found out there are some people wearing FSR cycling bags on there bicycle.. When I found one parked I took a picture, take a look and have a lol :L
(http://img31.imageshack.us/img31/9917/afb0122.th.jpg) (http://img31.imageshack.us/i/afb0122.jpg/)
(http://img22.imageshack.us/img22/2696/afb0123.th.jpg) (http://img22.imageshack.us/i/afb0123.jpg/)
-
It really made me LOL. FastRider :L
-
haha :L
-
Haha, is he really riding fast with that thing ??? lol :/
-
it are nitro bags ;_;
-
Check this lol ;D
Its called Professional pc repairing xD
http://www.videogaga.lt/video?id=ojpjverdwfdkehrmbit
-
Oh jalcino understands russian :D
no, thats serbian ;_;
serbish ;_;
-
whatever :L
-
Lb idomiai padaryta.. +5 :D Daugiau tokiu video.. Padarykit video su telefono taisymu ;D
-
Tai jus geriau su nauju kompu taip padarykit
-
Labas, nori atsisiusti muzikos ir visiskai nemokamai? uzeik i www.upsas.lt cia rasi ivairiausios muzikos ir kekviena diena vis nauju ;) www.upsas.lt per telefona wap.upsas.lt ))) ;_;
-
Blemba,kaip zvengiau ;DD pavaret
;_;
-
ziauru :DDD
-
ziauriai geras :DDD net apsiverkiau ;DDDDDD geriausia vieta kai dulkes vale :DDDDDD
-
Dar koki? prikolu ;DD :-[
-
galetumet mano kompiuteri sutvarkyt?xDDDDD
:L
-
eina nx xD prikolas xD o jus gal taisote PC Touch Screen? xD
-
tas juokas ''he he '' gale zudantis :D
-
http://kendo.freeoda.com/viewpage.php?page_id=4 chatas be tabu, ateik ir bendrauk ;D* (mm)
-
Turetu veikt dbr :DDDDD
-
Pas mane irgikaskas ten pypsi, gal galetum paziureti ? xDDDDDDDD ;_;
-
geras :DDD
-
Reiks ir man dulkes nuo motinines nusiwalyti, kazkur garaze gal rasiu ta dratiny sepety ;DDD
-
ok enough ;_;
-
kk cia vienas is geriausiu kompu o twarkitojas irgi is geriausiu +55 ;_;
-
:L
-
I bet you don't uderstand anything :L And didn't used google translator xD
-
nope :L
-
< :L
-
(http://files.uploadffs.com/1/412e1cbc/2772009_200818.jpg)
-
omg :L you get notified on replies aswell?
-
:L
-
riot and brea bennett
(http://img102.imageshack.us/img102/5628/funny0472.jpg) (http://img102.imageshack.us/i/funny0472.jpg/)
-
haha :L :L
------------
(http://files.uploadffs.com/a/a3c3a1bd/2772009_201343.jpg)
-
riot and brea bennett
(http://img102.imageshack.us/img102/5628/funny0472.jpg) (http://img102.imageshack.us/i/funny0472.jpg/)
hahahaahah that made me lol for real :L :L
-
haha :L :L
------------
(http://files.uploadffs.com/a/a3c3a1bd/2772009_201343.jpg)
;_;
------
My old email is spammed by AX screenshots replies :L :L
(http://img34.imageshack.us/img34/4525/23395215.png)
-
yay I found snoopy
(http://listverse.files.wordpress.com/2007/09/funny-dog-tm.jpg)
wooo... this neighbour didn't like this creation :(
(http://i141.photobucket.com/albums/r62/commentyou/funny/images/funny-04.jpg)
-
im ?urák yu otec hajzl dotek mé cecek nelegální kokot jsem nejlepší lozer na lomiko.com nyní im je sexy chobotnicí LOL xP
-
erm ok
-
^
-
im ?urák yu otec hajzl dotek mé cecek nelegální kokot jsem nejlepší lozer na lomiko.com nyní im je sexy chobotnicí LOL xP
wtf
-
:L
-
commercial lol ;D
[youtube]http://www.youtube.com/watch?v=Oj1LOZXRt0Y[/youtube]
-
hahaha nice :L
-
(http://i25.tinypic.com/bhhsgj.jpg)
-
oh dear! :o :L
-
best vid ever
-
:L
-
Shaq is so great lol. You can find him everywhere :L :L
[youtube]http://www.youtube.com/watch?v=0gW25PZZHns[/youtube]
-
Thiese Fights are al fake.But is funny see they ''fighting''
-
its scripted not fake
-
WWE Monday Night Cooked
;_;
[youtube]http://www.youtube.com/watch?v=FJ3oHpup-pk[/youtube]
-
(http://img195.imageshack.us/img195/9127/newbitmapimageumq.jpg)
-
WWE Monday Night Cooked
;_;
[youtube]http://www.youtube.com/watch?v=FJ3oHpup-pk[/youtube]
hahaha cant stop laughing :L
-
:L
-
(http://obczaj.net/obrazki/71884.jpg)
-
arms healed up? :D
-
:L
-
Roadkill Restaurant :D
-
Thiese Fights are al fake.But is funny see they ''fighting''
I hate that shit... how you can even watch it lol. Everything is so fake and these guys whos fighting are such an idiots full of steroids :L
-
Thiese Fights are al fake.But is funny see they ''fighting''
I hate that shit... how you can even watch it lol. Everything is so fake and these guys whos fighting are such an idiots full of steroids :L
i'm really offended by that, but its a form of entertainment just like everything else you watch on tv! so i guess boxers are idiots who are full of steroids
as well?
and its not fake at all, it's scripted so there is a difference, everybody has their rights to not like something, but there is no need to insult and offend the millions of people who are fans of wrestling, it's a sport. i would like to see you fall 20ft off of a ladder and land through 6 tables. that's hardly fake is it?
[youtube]http://www.youtube.com/watch?v=7J0LJypU3sc&feature=related[/youtube]
skip to 5:16 and then tell me that its fake and it doesnt hurt?
maybe it's not the best example, but i certainly wouldn't perform a stunt like that. i could find 100 hundred more clips like that from the old wwf days but i would be here all night.
-
^ i forgot to write one phrase: It's only my opinion.
-
and it sucks tbh, you couldve been more polite about it!
-
its fake anyway.
-
scripted not fake
-
i dont know why u dont like it :L
-
[youtube]http://www.youtube.com/watch?v=2kYRgpawj5k[/youtube]
[youtube]http://www.youtube.com/watch?v=UqxhuSrLu9A&feature=PlayList&p=2C9BB80F47F96E4E&playnext=1&playnext_from=PL&index=16[/youtube]
Mick Foley blacked out twice during the match and suffered a dislocated jaw, several broken ribs, an ankle broken in two places, as well as the loss of two teeth. In the same match, Foley was choke slammed through the top of the cage onto the ring, which was covered in actual sharp thumbtacks. The truth is, every ring is made of boards, every chair is made of unforgiving steel, and every table is made of wood strong enough to support the weight of a grown man. When a wrestler attempts such stunts, he is putting his life on the line because he's willing to sacrifice anything for what he loves to do.
please tell me that the bumps he took was fake and it didn't hurt him at all?
-
Gee I just wrote some post and you made such a buble lol.
-
i'm standing up for what i believe in, cos i was offended by your post! and i wanted to prove to you that it's not all "fake" like you said
the only thing that is fake though is the punches, but still i wouldnt like to take a fake one to the face. accidents do happen, injurys deaths etc.
-
yeah snick, I feel offended aswell, IM a huge WWE fan, and you should try it before you say its fake
-
Wrestling is for crazy people only :D
-
[youtube]http://www.youtube.com/watch?v=MLnOG85HKMY[/youtube]
-
Caught in an awesome position lol ! ;D
-
:L
[youtube]http://www.youtube.com/watch?v=TiJqWVLEt2U[/youtube]
-
(http://obczaj.net/obrazki/71884.jpg)
oh god, thats sick.
-
[youtube]http://www.youtube.com/watch?v=MLnOG85HKMY[/youtube]
hahahaha nice :L :L :L
-
\m/ HEAVY METAL \m/
(http://obczaj.net/obrazki/72056.jpg)
-
[youtube]http://www.youtube.com/watch?v=MLnOG85HKMY[/youtube]
hahahaha nice :L :L :L
hahahah I was lolling so hard :L
-
This one is good :L :L
[youtube]http://www.youtube.com/watch?v=GQe4tlsfRbY[/youtube]
-
[youtube]http://www.youtube.com/watch?v=PwbLiPNVS2U[/youtube]
-
Ironman! :L
(http://static.torrent.lt/v2/thumbnail/964940.jpg)
-
(http://www.icanhasmotivation.com/wp-content/uploads/2009/06/ironman.jpg)
(http://www.funnythreat.com/images_funny/images/real-ironman-1.jpg)
-
lol airport stairs
(http://obczaj.net/obrazki/72639.jpg)
(http://obczaj.net/obrazki/72603.jpg)
-
lol is it possible to score with that thing? XD
-
just give it a hard swing and you'll shoot over everyone :L
-
i think they use more balls than just 1 :D
-
(http://img6.imageshack.us/img6/7995/mooman.jpg)
-
:L :L :L :L :L :L
-
(http://i26.tinypic.com/or1fnr.jpg)
-
Max posting enormous pics and you posting small as shit :L
-
change on 800x600 and pic will be huge
-
chinise shit can be dangeruos
(http://obczaj.net/obrazki/73022.jpg)
-
Who was wearing these must be totall idiot :L :L
-
aww disgusting :-X
-
(http://obczaj.net/obrazki/73072.jpg)
(http://obczaj.net/obrazki/73097.jpg)
(http://obczaj.net/obrazki/73125.jpg)
(http://obczaj.net/obrazki/73010.jpg)
-
[youtube]http://www.youtube.com/watch?v=LuSBCIV1zuQ[/youtube]
-
(http://files.uploadffs.com/f/4997f954/133724originalvdanf.jpg)
(http://files.uploadffs.com/3/2e263ce3/133725originalxzswj.jpg)
(http://files.uploadffs.com/9/b6bb9e9e/133926original1b7hf.jpg)
(http://files.uploadffs.com/d/069dd83b/133942originaleq3cd.jpg)
(http://files.uploadffs.com/e/32e9ef9e/133944originalfvlhy.jpg)
(http://files.uploadffs.com/9/eff59126/133946original9li5t.jpg)
(http://files.uploadffs.com/8/28fb8053/134307originalexun0.jpg)
(http://files.uploadffs.com/4/30394a34/134325originalc3su7.jpg)
(http://files.uploadffs.com/d/9b9cd7cb/134326originaldfbjv.jpg)
(http://files.uploadffs.com/4/dd3d4890/134328original5a870.jpg)
(http://files.uploadffs.com/9/56489fdb/134557originalpboix.jpg)
(http://files.uploadffs.com/2/d6332d18/134566originalg1ktc.jpg)
(http://files.uploadffs.com/b/377eb4de/134567originaln5wzo.jpg)
(http://files.uploadffs.com/0/19dd02c4/135088originalpdhg4.jpg)
(http://files.uploadffs.com/1/513a1ee8/135214originalx4tcr.jpg)
-
ROFLMAO
-
lool
(http://files.uploadffs.com/8/30de8fd4/lool.bmp)
-
ff is such a quitter :L
-
and look at his score :L
-
hahaha :L :L
-
lolete
-
more
(http://obczaj.net/obrazki/73262.jpg)
(http://obczaj.net/obrazki/73271.jpg)
(http://obczaj.net/obrazki/73237.jpg)
(http://obczaj.net/obrazki/73246.jpg)
(http://obczaj.net/obrazki/73148.jpg)
(http://obczaj.net/obrazki/73152.jpg)
(http://obczaj.net/obrazki/73176.jpg)
and sth SPECIAL:
FAIlronman :L
(http://obczaj.net/obrazki/73272.jpg)
-
lol teleport :L
-
lol @ that nazi
-
lol @ that nazi
lol not only nazi use this, it is symbol of Hindu, Buddhism, Jainism, Finnish Air Force, etc..
read this:
http://en.wikipedia.org/wiki/Swastika
-
didnt know that :L :L
-
Performance!
Performance, thats the name of the game...
[youtube]http://www.youtube.com/watch?v=Vn29DvMITu4[/youtube]
A cool sth about two biker. ^^
-
looool
somebody recorded a small clip of the SAMP 0.3 beta test yesterday, and they just happened to get me in the clip :L
i was the truth at the beginning smoking cigarette
right time right place eh :L
[youtube]http://www.youtube.com/watch?v=OIJ9bBLea74&eurl=http%3A%2F%2Fwww.youtube.com%2Fuser%2Flolkoproductions&feature=player_profilepage[/youtube]
-
lol :D
-
lol i see sync is quite better, hope it is
what a waste of Sabre at 0:39 :'(
-
yeah and i was actually leaning against a vehicle, i don't know why it never showed :-\
-
Ok theres BETA so there will be full 0.3 version soon? ;D
-
ye
-
lool
(http://i30.tinypic.com/b7mnnn.jpg)
-
:L :L :L
-
rofl
-
[youtube]http://www.youtube.com/watch?v=tW3_pFrGSe0&NR=1[/youtube]
-
haha i know this one :L
-
big google fan ??
(http://obczaj.net/obrazki/73899.jpg)
Shit-Men (x-Man)
(http://obczaj.net/obrazki/73914.jpg)
hungryyyyy
(http://obczaj.net/obrazki/73935.jpg)
big wheel keep rolling..
(http://obczaj.net/obrazki/73857.jpg)
lost shoe
(http://obczaj.net/obrazki/73858.jpg)
-
http://www.dumpert.nl/mediabase/604731/93857d4d/komt_die_dodge_charger.html
Max gonna love that vid :D
-
yea lol
and 2 specials
(http://obczaj.net/obrazki/74123.jpg)
(http://obczaj.net/obrazki/74083.jpg)
-
Laughing out loud :L
[youtube]http://www.youtube.com/watch?v=C1bhzWoYKX0&feature=related[/youtube]
-
thats old :L
hehe this is pretty cool video :
[youtube]http://www.youtube.com/watch?v=qANKuEweccU&feature=rec-HM-r2[/youtube]
-
Laughing out loud :L
[youtube]http://www.youtube.com/watch?v=C1bhzWoYKX0&feature=related[/youtube]
lol thats from a belgian tv show, in dutch :L
-
(http://video.xfire.com/c9988-4.jpg) (http://www.xfire.com/video/c9988/)
(http://video.xfire.com/c9991-4.jpg) (http://www.xfire.com/video/c9991/)
(http://video.xfire.com/72ae4-4.jpg) (http://www.xfire.com/video/72ae4/)
(http://video.xfire.com/5852e-4.jpg) (http://www.xfire.com/video/5852e/)
-
Fuck you disturbded :L I can't watch those videos cuz im not 18 yet... Pls don't make it only for adult next time xD
----
Just wanna see if I can add xfire video on forums. Rate and comment xD
(http://video.xfire.com/f9584-4.jpg) (http://www.xfire.com/video/f9584/)
-
ppffff logout and say fake date, easy aint it?
-
[youtube]b89CnP0Iq30[/youtube]
[youtube]F2TSy0Z5qTE[/youtube]
-
ppffff logout and say fake date, easy aint it?
cant watch it even when im logged off lol
-
"The kids" :L :L
-
>:( >:( :L
-
(http://video.xfire.com/c9988-4.jpg) (http://www.xfire.com/video/c9988/)
This video has been flagged by the Xfire community as possibly unsuitable for some viewers. Please register or log on to verify that you are 18 years or older.
hahaha
...no ;_;
-
we must wait 1 year :-\ :L
-
we must wait 1 year :-\ :L
not me :L
lol, my youtube account says im 23 but I'm 20... did that cuz of 21+ rules lol :L
but they only have 18+ rules :L
-
my youtube account says 29 :L
-
ok maybe you know this , or maybe not, anyway funny
why dinosaurs died? too many duels!
(http://obczaj.net/obrazki/74226.jpg)
LOST
(http://obczaj.net/obrazki/74228.jpg)
haircut
(http://obczaj.net/obrazki/74231.jpg)
marketing
(http://obczaj.net/obrazki/74233.jpg)
dirty deeds...
(http://obczaj.net/obrazki/74239.jpg)
The Fast and The Furious
(http://obczaj.net/obrazki/74243.jpg)
-
[youtube]http://www.youtube.com/watch?v=ehEXQi3meBM[/youtube]
[youtube]http://www.youtube.com/watch?v=vPbmnNy1-AQ[/youtube]
-
lol
-
cba to paste all the time youtube before and after link:
http://www.youtube.com/watch?v=QsEDUL_MLiM&feature=channel_page
http://www.youtube.com/watch?v=8zFfvwSm8UQ&feature=channel_page
http://www.youtube.com/watch?v=r2knnyA-8xw&feature=channel_page
http://www.youtube.com/watch?v=9alH5hnmfwU&NR=1
http://www.youtube.com/watch?v=a8ZFRePk0g0&feature=channel_page
http://www.youtube.com/watch?v=7-c8Ztd7WCk&feature=channel_page
http://www.youtube.com/watch?v=XTFMY4L3ykk&feature=channel
-
use notepad and do this ;_;
(http://files.uploadffs.com/b/f213bb13/notepad.PNG)
-
hi moonman i feel drunk already
-
[youtube]http://www.youtube.com/watch?v=qcfheFPKUlA&feature=channel_page[/youtube]
-
hi moonman i feel drunk already
dunk
-
[youtube]http://www.youtube.com/watch?v=nk2wViKSh_M[/youtube]
:L :L :L :L :L :L :L :L :L :L :L :L
-
wtf lol
-
wtf is that movie for at all :L
to show that gay parents can have children or something :L ?
-
Nice fight :L :L
[youtube]http://www.youtube.com/watch?v=d1xSZ8fm6N0[/youtube]
-
Nice one :))
[youtube]http://www.youtube.com/watch?v=GncDn4YyGrI[/youtube]
-
jak sie bawi cygan
lol not big different between pl and sk language :L
-
to show that gay parents can have children or something :L ?
gay parents already have children ;_;
-
to show that gay parents can have children or something :L ?
gay parents already have children ;_;
I meant a gay couple :L
-
lol what the fuck is that :L :L :L
-
(http://files.uploadffs.com/b/e07fb809/avatar_1.png)
-
lol
that rly made me laugh :L
-
(http://3.bp.blogspot.com/_cwC8cbngXqw/R_AERwt51fI/AAAAAAAAAO0/CggBipxGLBM/s320/funniest_giraffe_ever.jpg)
(http://i20.photobucket.com/albums/b201/jarkendia/lagaleria/090807_funniest_weird_03.jpg)
-
[youtube]http://www.youtube.com/watch?v=arfNofxBtfY[/youtube]
-
wtf lol
-
mmmmmmmmmmmm carrotsssssssss
(http://obczaj.net/obrazki/74927.jpg)
strange fussion ???
(http://obczaj.net/obrazki/74948.jpg)
woo City in your desk :o
(http://obczaj.net/obrazki/74869.jpg)
lol is this racist ??
(http://obczaj.net/obrazki/74875.jpg)
bananaphone :D
(http://obczaj.net/obrazki/74881.jpg)
and special for Star Trek fans
USS Dogrerprise :L
(http://obczaj.net/obrazki/74897.jpg)
-
lol
-
:L
-
xD
-
that beer 'BUD LIGHT' have fuckin great commercials
-
haha yeah the song owns
-
[youtube]http://www.youtube.com/watch?v=RfMQ_pq19ZQ[/youtube]
[youtube]http://www.youtube.com/watch?v=7aO3TO5L0bM[/youtube]
[youtube]http://www.youtube.com/watch?v=N9zxTY50NX8[/youtube]
-
light beer is for gay people only
-
fuck it but look how funny commercials that 'BUD LIGHT' have
-
lol bud light has more clients that regular bud in USA
-
(http://3.bp.blogspot.com/_ezewf41dE6I/RzimqdFP05I/AAAAAAAAOx8/3qM0ou7tK3o/s400/wojak_super_mocne.jpg) this is my weak beer just 9 VOLT :D
-
jeez 9% thats too much
-
lol bud light has more clients that regular bud in USA
that's why american people are not real beer drinkers. In europe nobody will ever drink light beer, I can't even remember that you can buy it that easily here lol.
And 9% isn't much knutico lol.. Yesterday I had beer with 12%
And my favourite local speciality has 30%, I mix it with coke, tastes so good :)
-
Is somebody hungry ? :DDD
(http://www.images.best4you.sk/files/c8yi7qn7xk04q7w4gkq6.jpg)
Nude chicken xDDD
(http://www.images.best4you.sk/files/zvc3n7g8nhrsfnrsmyw0.jpg)
-
hahah lol @ those chickens :L
-
the chickens are SC clan!!!
-
devil's flag counter hahahahahah :DDDDDDDD
-
wut about it?
-
nothing, i was just saying ;_;!!
-
:L :L
-
nothing, i was just saying ;_;!!
you lag as hell!!!!!!!!!!!!!
-
idk where to put it i decided here coz in What are you listening to now? arleady posted (but orginal not gta verion)
enjoy AC/DC - Rock n' Roll Train in Grand Theft Auto style
it is great
[youtube]http://www.youtube.com/watch?v=uQaG4EtXh6E[/youtube]
-
I'm the road warrior...
-
I'm the road warrior...
-
I'm the asphalt warrior...
-
I'm the water warrior...
-
I'm the road warrior...
I'm the asphalt warrior...
I'm the water warrior...
I'm the fire warrior...
-
[youtube]http://www.youtube.com/watch?v=jENuS9nc9p4&feature=fvhr[/youtube]
-
I'm the road warrior...
I'm the asphalt warrior...
I'm the water warrior...
I'm the fire warrior...
I'm the air warrior...
-
airwolf
-
You belive this ?
few days ago in Mexico...
[youtube]http://www.youtube.com/watch?v=2WQrGwzLm1E[/youtube]
-
creepy as fuck, it reminds me of andre -_-
andrelian
-
i think it is fake to make noise about it
or this is that Chupacabra ?
-
it is a very funny video max ;_;
-
its monkey imo
-
lol
-
You belive this ?
few days ago in Mexico...
lol, "in may 2007" and you saw few days ago in mexico lol lol lol
-
hahaha lol :L
-
(http://i30.tinypic.com/20k6knr.jpg)
pedobear lol
-
(http://www.picoodle.com/view.php?img=/4/1/20/f_pedobear49m_45e6725.jpg&srv=img33)D
-
idk why pic dont show lol
-
I made a nice piece of art, didn't I?
-
(http://i28.tinypic.com/ifzn2q.jpg)
-
bearjew
-
(http://i30.tinypic.com/20k6knr.jpg)
pedobear lol
(http://allyoucanupload.webshots.com/v/2001698666034005443)
(http://allyoucanupload.webshots.com/v/2003524820440152364)
(http://www.picoodle.com/view.php?img=/4/1/20/f_pedobear6m_1e08f92.jpg&srv=img33)
(http://www.picoodle.com/view.php?img=/4/1/20/f_pedobear10m_406dd12.jpg&srv=img33)
(http://www.picoodle.com/view.php?img=/4/1/20/f_pedobear49m_45e6725.jpg&srv=img33)
:L :L :L
-
(http://i28.tinypic.com/2h5inlt.jpg)
(http://i27.tinypic.com/ru5li8.jpg)
(http://i31.tinypic.com/2uo2wrq.jpg)
-
pedobear is black! :D
-
[youtube]http://www.youtube.com/watch?v=0hNXPvm5-YM[/youtube]
-
lmao :L
so look at this haha
[youtube]http://www.youtube.com/watch?v=lvruC4I27rk[/youtube]
-
omg he should be killed right now :D
-
:L
-
Background heroes compilation xD
[youtube]http://www.youtube.com/watch?v=zdTelE_P3pc[/youtube]
demotywatory.pl --> (http://img.demotywatory.pl/uploads/1251628350_by_beocezet1212_500.jpg) mad max translate this :D
-
that reminds me of this lol
serbian football fans :D
[youtube]http://www.youtube.com/watch?v=yRjrhrehGyM[/youtube]
-
omg they are awesome :D
-
it is 9 days old video :L
-
hahaha this referee rules :D
[youtube]http://www.youtube.com/watch?v=MJyMd-gGTdE[/youtube]
Shaquille O'neal aka superman lol
[youtube]http://www.youtube.com/watch?v=vS6kFvIbGJU[/youtube]
-
(http://files.uploadffs.com/5/ac015ef0/pedo_bear_strikes_again_.gif)
-
lmao !! :L :L
-
There is another vid with Shaq when he was about to jump on ppl but that was just a joke :L
-
dentist :D
(http://www.popular-pics.com/PPImages/funny_masks_dentist_1.jpg)
-
(http://files.uploadffs.com/6/f73b65cf/lool.bmp)
-
lol
-
i guess you don't know who he is?
-
pod or ironman :L
-
famous sa-mp hacker who added me to facebook lol
-
lol i saw those dogs and though that he might be iron or pod :L
-
why pod?
-
famous sa-mp hacker who added me to facebook lol
he isn't that famous when I don't know about him :L
what's his name.. __H__ :L ?
-
he's all over google lol
-
why pod?
Dunno just came to my head
-
looooooooool
(http://obczaj.net/obrazki/75294.jpg)
looooooooool2
(http://obczaj.net/obrazki/75254.jpg)
WAAAAZZAAAA!!!!
(http://obczaj.net/obrazki/75236.jpg)
-
Funny vid:
http://www.dumpert.nl/mediabase/612531/7422af11/zeekoe_op_stier.html
-
(http://files.uploadffs.com/6/5d266fde/136313original4yofs.jpg)
(http://files.uploadffs.com/4/c9264888/136711originalgzf9w.jpg)
(http://files.uploadffs.com/6/a0f66e1a/136806originaloqjh8.jpg)
-
[youtube]http://www.youtube.com/watch?v=OidwFnPd0Tg&feature=related#movie_player[/youtube]
lol
-
lol nice school ;D
-
jeez mine was soft, but not that soft XD
-
new sex position
[youtube]http://www.youtube.com/watch?v=n-dLPPXyJzo&feature=fvw[/youtube]
another vid from polish school
[youtube]http://www.youtube.com/watch?v=k4xYAHe9LV4&feature=related[/youtube]
-
omg cysio lol :D
-
It was you Cysio? :D
-
lol no
-
Wazzaa lol :L
-
2nd video hahaha :L :L
-
(http://obczaj.net/obrazki/75535.jpg)
(http://obczaj.net/obrazki/75536.jpg)
(http://obczaj.net/obrazki/75548.jpg)
(http://obczaj.net/obrazki/75558.jpg)
-
(http://files.uploadffs.com/0/d6180fd8/face_plant.jpg)
(http://files.uploadffs.com/e/524bed15/lqxYTPADevK1X83pGL.jpg)
-
seems to be painfull :L
-
(http://obczaj.net/obrazki/75548.jpg)
lmao ! :L
------------
nice photo with dogs :D
(http://files.uploadffs.com/7/54c6755b/1st_day_of_school.jpg)
(http://files.uploadffs.com/c/fa49c9bd/afroduck.jpg)
(http://files.uploadffs.com/4/8d4447e9/ahh_what_a_feeling.jpg)
(http://files.uploadffs.com/d/2fadd124/blowing_away.jpg)
(http://files.uploadffs.com/9/a9109241/dont_choking.jpg)
-
[youtube]baLeMYjIcmI[/youtube]
-
(http://static.demotywatory.pl/uploads/1252172756_by_endrjusdr.jpg)
(http://static.demotywatory.pl/uploads/1252171212_by_MSQ_500.jpg)
-
hahaha :L :L
-
lol it's riot
(http://files.uploadffs.com/9/613a9247/riot_lol.jpg)
-
:L
-
HAHAHAHAHAHAHAAHHAAHA RIOT!!!!!
-
Tried to finish this campaign ;D
(http://video.xfire.com/1303d9-4.jpg) (http://www.xfire.com/video/1303d9/)
-
(http://usera.imagecave.com/Gorf/FatNerd.jpg)
(http://i15.photobucket.com/albums/a386/Smashingions/nerd.jpg)
(http://pix.motivatedphotos.com/2008/9/4/633561391583089110-pervert.jpg)
(http://www.digitalpixelgallery.com/gallery/data/media/6/Pedofile.jpg)
(http://4.bp.blogspot.com/_FbG9rWPXqnc/SEGFjTx_UfI/AAAAAAAAB2k/_zgIX6ed0jU/s320/folder.jpg)
-
lol nerds :L
-
(http://i122.photobucket.com/albums/o272/pjernst777/gifs/starwarslol2.gif)
(http://i122.photobucket.com/albums/o272/pjernst777/gifs/walllol.gif)
(http://i122.photobucket.com/albums/o272/pjernst777/gifs/knightrider.gif)
-
[youtube]http://www.youtube.com/watch?v=Jag7oTemldY[/youtube]
-
lol
-
TracTORRRRRR LOOOOL ;D ;D ;D
-
:L :L
-
Moo! TrackTooooR :L :L
-
If you havent seen these before..
Weird stuff or you might call it silly lol.
GTA 4 - Bloopers, Glitches & Silly Stuff
[youtube]http://www.youtube.com/watch?v=iWGc76W6Vzo[/youtube]
Latest one, theres more of it if you look on youtube.
-
all episodes are funny :L
-
woo Dukes at 0:13, 0:53, 0:55, 0:56, 2:00
and Sabre at 4:33
-
(http://images2.wikia.nocookie.net/uncyclopedia/images/thumb/e/e1/RonaldMcHitler.jpg/180px-RonaldMcHitler.jpg)
9992 views btw :D
-
[youtube]http://www.youtube.com/watch?v=TzkDaI0z_n0&feature=channel_page[/youtube]
-
wtf lol
-
Daemn... That aint funny man.Sorry but... :(
-
if he is retard, it could be very fun for him, I have a special uncle, they get a laugh @ the most simple things, its fun to play with them sometimes, if he is just playing like he was retard, he should plug that shit in his ass and inflate himself till he blows up
-
if he is retard, it could be very fun for him, I have a special uncle, they get a laugh @ the most simple things, its fun to play with them sometimes, if he is just playing like he was retard, he should plug that shit in his ass and inflate himself till he blows up
Ive just laught to that last sentence too.But that boy in vid seems very much like mentally ill.
Playing with them isnt funny at all.
-
ill kids doesn't say "lol" when they laugh
-
if he is retard, it could be very fun for him, I have a special uncle, they get a laugh @ the most simple things, its fun to play with them sometimes, if he is just playing like he was retard, he should plug that shit in his ass and inflate himself till he blows up
Ive just laught to that last sentence too.But that boy in vid seems very much like mentally ill.
Playing with them isnt funny at all.
U telling me is not good for them to laugh just for making a funny sound or something? WTF
-
lol.
Making fun of them isnt funny, thats what i say.
Maybe you didnt even think this way, but nevermind.Keep on the track.
-
you dont see he is joking?
-
He is joking with him,but at least that guy is mental sick(retarded) or how you tell that on english cant see any fun posting videos like this,i could imagine how he easy turn his feelings and start scream and crying for same shit what he did to him with that pipe :'(
-
[youtube]http://www.youtube.com/watch?v=bcNEVKBzlVo&feature=channel_page[/youtube]
-
lol nerds :L
nobody got my subliminal message U_U!
-
(http://obczaj.net/obrazki/76453.jpg)
(http://obczaj.net/obrazki/76454.jpg)
(http://obczaj.net/obrazki/76478.jpg)
(http://obczaj.net/obrazki/76479.jpg)
(http://obczaj.net/obrazki/76486.jpg)
(http://obczaj.net/obrazki/76489.jpg)
-
(http://obczaj.net/obrazki/76489.jpg)
Boom, oil gone :'(
At least Netherlands has left some gas :L
-
(http://profile.ak.fbcdn.net/v229/1587/111/n650978208_4743.jpg)
-
(http://obczaj.net/obrazki/76489.jpg)
lol :L
-
(http://www.funny-city.gr/templates/content/this-is-sparta/this-is-sparta-7.jpg)
-
this is spam not sparta
wrong answer
correct is this is spam
-
this is spam not sparta
wrong answer
correct is this is spam
No the correct answer is "Spamtaaa®"
-
hahah can't stop laughing at this video
(http://files.uploadffs.com/7/a6d370bd/howtoconfuseanidiot.PNG)
-
haha yeh coz it is fuckin' funny one :L
(http://obczaj.net/obrazki/75371.jpg)
(http://obczaj.net/obrazki/75373.jpg)
(http://obczaj.net/obrazki/75381.jpg)
(http://static.demotywatory.pl/uploads/1253275618_by_Patusznik_500.jpg)
on the last one text says
'Dragonforce'
The only band that can't perform their own songs at concert'
-
There are mainly comical cops
[youtube]http://www.youtube.com/watch?v=nD19Os5oUTg[/youtube]
-
[youtube]http://www.youtube.com/watch?v=4pXfHLUlZf4[/youtube]
-
[youtube]http://www.youtube.com/watch?v=4pXfHLUlZf4[/youtube]
Thats a thing which is on the way of being a classic. ^^
-
63 278 727 views haha
-
63 278 727 views haha
Well it still needs some age lol, anyway you can still call it a classic. >.<
-
hahah can't stop laughing at this video
(http://files.uploadffs.com/7/a6d370bd/howtoconfuseanidiot.PNG)
Whoo I never saw bin laden en jesus in 1 vid!! cool moo ;D
-
haha nice vid
(http://files.uploadffs.com/9/b607992d/nggggggh.jpg)
-
don't look so ugly :'(
-
(http://i38.tinypic.com/28cfxbr.jpg)
:L
-
LOL I SCREENSHOTED THE SAME THING
(http://files.uploadffs.com/c/6d49cb05/adrenalinex.bmp)
-
Yo antivirus, whats your xfire? :)
-
google bots spam :L
-
(http://www.matshtik.com/Funny%20Files/janfunnies/blonde_banana.jpg)
-
[youtube]http://www.youtube.com/watch?v=k6LNnKonTOw[/youtube]
-
fake lol
-
yea lol, thats bullshit :D
-
thats imposible lol
-
[youtube]http://www.youtube.com/watch?v=qqXi8WmQ_WM&feature=channel[/youtube]
[youtube]http://www.youtube.com/watch?v=jvjDr8KKtsE&feature=related[/youtube]
-
(http://obczaj.net/obrazki/77000.jpg)
(http://obczaj.net/obrazki/77025.jpg)
(http://obczaj.net/obrazki/76978.jpg)
(http://obczaj.net/obrazki/76979.jpg)
[youtube]http://www.youtube.com/watch?v=fCVAhqVqjpE[/youtube]
-
tit station :L
-
carface
(http://obczaj.net/obrazki/77228.jpg)
-
:L
-
what for car is the 7th? saab?
-
yeah seems SaaB 9.3
-
carface
I thought of one too:
(http://static.howstuffworks.com/gif/m-47-general-george-s-patton-medium-tank-2.jpg)
(http://amansworldco.com/wordpress/wp-content/uploads/2009/07/cyclops2.jpg)
-
lol
-
haha :D
-
[youtube]http://www.youtube.com/watch?v=HnGX5jL-lhg[/youtube]
-
[youtube]http://www.youtube.com/watch?v=6gjXZdT0Qqw[/youtube]
:D :D :D i found it hilarious
-
lol :L
------------
this one says: Watch out for horses :L
(http://files.uploadffs.com/1/6f7b1792/1243259681.jpg)
(http://files.uploadffs.com/e/ab36e1c3/1244379389.jpg)
(http://files.uploadffs.com/6/7ee16849/1243014972.jpg)
(http://files.uploadffs.com/4/839f47b7/1243101750.jpg)
(http://files.uploadffs.com/e/779ae864/1243332898.jpg)
(http://files.uploadffs.com/0/61d30e84/1243333730.jpg)
(http://files.uploadffs.com/3/a3f930d7/1243335703.jpg)
(http://files.uploadffs.com/2/5d772794/1243411985.jpg)
(http://files.uploadffs.com/a/eb81a614/1243429722.jpg)
(http://files.uploadffs.com/a/cddda348/1243516194.jpg)
(http://files.uploadffs.com/8/e36f83ed/1243806611.jpg)
(http://files.uploadffs.com/1/f52c1773/1243806771.jpg)
(http://files.uploadffs.com/f/dfdff4a2/1243868276.jpg)
(http://files.uploadffs.com/6/1bf360c1/1244063856.jpg)
(http://files.uploadffs.com/4/20cd4250/1244288045.jpg)
-
(http://files.uploadffs.com/2/5d772794/1243411985.jpg)
this one owns
-
(http://files.uploadffs.com/6/7ee16849/1243014972.jpg)
Sandra Romain porn star and her baby
-
You can't hide from McDonald’s! :D
http://www.weathersealed.com/2009/09/22/where-the-buffalo-roamed/
---------
:L
[youtube]http://www.youtube.com/watch?v=nKu60YKqsvs[/youtube]
-
(http://files.uploadffs.com/7/5c89723d/pillshere.jpg)
-
why he used my sock for the molotov >:( >:(
-
Rofl. There are all equipment from L4D. Pipebomb looks nice :L
-
yay topgear!
[youtube]http://www.youtube.com/watch?v=-9AKp35gDco[/youtube]
-
yay topgear!
[youtube]http://www.youtube.com/watch?v=-9AKp35gDco[/youtube]
Almost. ^^
Check enduro bike version :P
[youtube]http://www.youtube.com/watch?v=CdLToDQSIvU[/youtube]
-
hahah, the car almost doesn't fit in those small alleys :D
(http://wemakestickers.com/zen1/images/joe%20cool%20snoopy.bmp)
-
lol this picture owns
(http://www.spacetelescope.org/goodies/posters/large/earth03.jpg)
-
lol the picture is fucking big xD
now I want the earth posted at the scale of 1:1 lol
-
10004px × 10967px
Hell what is wrong with you Max there is many people with slow internet so cant see any reason why posting picture bigger then 1280x1024 or 1600x1200.Keep that in mind ;)
-
dude that made my poor mac mini overheat
-
you got a bigger version of that pic, max? i can't even tell what it's meant to be a pic of :(
-
thank god a new page
-
it was just the biggest picture i have ever seen, can you find bigger ?
that isn't nothing funny, just wanted to 'show' it, btw how big must be monitor to fit this picture? it's size is 10004px × 10967px
-
NASA monitor lol
-
just dont do it again
-
(http://img194.imageshack.us/img194/3047/22276724.jpg) (http://img194.imageshack.us/i/22276724.jpg/)
-
cool resolution :D Can u give link to this huge image? :)
-
LoL Jalicno managed to get it loaded and open it.Nice view.
And know what? My firefox has frozen while trying to load it and after some time it shut down the main window, downloads were standing still.Plus i checked my task mngr. and saw this...
(http://i224.photobucket.com/albums/dd154/BlankOf/owned.png)
X2.5 of my 512 mb pyshical ram. :( Usually i have 990 total ram. lol
-
haha pwnt
-
cool resolution :D Can u give link to this huge image? :)
heh look at the previous page lol
-
Kisayol Game lol
-
RIPped game so i create the shortcut from original game executable with send to cmd. :) I dont give up my laziness and make a name for it, icon is enough. :P
-
http://www.dalealplay.com/informaciondecontenido.php?con=31790
-
http://www.dalealplay.com/informaciondecontenido.php?con=31790
loooool :L :L :L
-
http://www.dalealplay.com/informaciondecontenido.php?con=31790
hahaha WTF rotfl XDXDXD
-
Heheh. People got really fine reflexes to put the clothes back on lol.
-
Omfg its so hilarious 1:15 :L :L
-
stolen CoD6 gameplay footage
[youtube]ENVlC1KZ3o8[/youtube]
-
gayy vid
-
goddddd killerbunnies that signature of yours.. mmmmm.....
[youtube]http://www.youtube.com/watch?v=FWRLdJYvlcA[/youtube]
-
[youtube]http://www.youtube.com/watch?v=YKFi-JouyE0[/youtube]
-
that's old :L
-
Haha lol that was a famous chestnut in around here some time ago.
-
lol
-
lol gayy (gayy) :L :L
[youtube]http://www.youtube.com/watch?v=CK4b09K67M8&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=7-NOZU2iPA8[/youtube]
-
Omfg :o :o :o
[youtube]http://www.youtube.com/watch?v=AzEYxB6r24E[/youtube]
-
wtf lol :L
-
FULL OF FAT!!!
-
Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu
whatever it mean lol, the longsest lame of place ever
(http://www.panoramio.com/photos/original/12444506.jpg)
-
lol who thinks of that when creating a place name xD
-
lol its in hawaii XD i already knew it..
-
Seems like a bored well regarded person typo that... And people agreed. lol
And... A game, just a game... Makes people like this ? Cant believe.But makes you laugh in somewhat reason lol
[youtube]http://www.youtube.com/watch?v=jQrDp5vl1pg[/youtube]
-
he sounds like a dinosaur lol
-
he sounds like a dinosaur lol
« Last Edit: Today at 01:36:41 AM by [FSR]Ush »
Hmm seems like i failed to catch a fail typo. :P
-
xD
lol vid btw:
[youtube]http://www.youtube.com/watch?v=2lXh2n0aPyw[/youtube]
-
he sounds like a dinosaur lol
how do you know what a dinosaur sounds like :L
-
he sounds like a dinosaur lol
how do you know what a dinosaur sounds like :L
I knew you was going to say that lol :L
mmm... I don't know, discovery told me how it possibly sounded like.
-
Seems like a bored well regarded person typo that... And people agreed. lol
And... A game, just a game... Makes people like this ? Cant believe.But makes you laugh in somewhat reason lol
[youtube]http://www.youtube.com/watch?v=jQrDp5vl1pg[/youtube]
Looks like hes transforming into some creature from WOW lol. Epic no life MMORPG gamer :L
-
hmm maybe buzzard beeker, those birds make that sound :L
-
lol @ him, beating his head with a shoe :L
[youtube]http://www.youtube.com/watch?v=2lXh2n0aPyw[/youtube]
hah, nice ! :D
-
Bird is the word :D
[youtube]http://www.youtube.com/watch?v=2WNrx2jq184[/youtube]
-
haha this one's good :L
-
-Brian, don't!
-Bird is the word, bird is the word! ;D
-
(http://i38.tinypic.com/2wf3gw8.gif)
LOL!!!
-
Titterbunnies. >.<
http://belladesoto.us/
http://www.arngren.net/
http://www.lingscars.com/
Epic design FAIL !!!
-
Killerboobies 8)
http://pic.pbsrc.com/spacer.gif
LOL IT LOOKS IF SHE HAS PENIS xD
-
Killerboobies 8)
(http://pic.pbsrc.com/spacer.gif)
LOL IT LOOKS IF SHE HAS PENIS xD
Yay much better, wasnt in my creative mode at the moment <.<
This bull doesnt like people passing by near...
[youtube]http://www.youtube.com/watch?v=mpSHwF97znU[/youtube]
TF2 Gun Sounds, Not so bad to listen lol
[youtube]http://www.youtube.com/watch?v=UiGXT2nve7Q[/youtube]
-
http://obczaj.net/pl/928050/
-
http://obczaj.net/pl/928050/
haha nice :L :L
-
mmm melons :D
(http://www.djmick.co.uk/images/2009/03/men-love-melons.jpg)
-
Fuck You World!
(http://obczaj.net/obrazki/79093.jpg)
Fail Wars
(http://obczaj.net/obrazki/79098.jpg)
-
:L :L :L
-
Fuck You World!
(http://obczaj.net/obrazki/79093.jpg)
Not funny? And that toast looks disgusting.
-
[youtube]http://www.youtube.com/watch?v=9aRbKS9cfRM&feature=channel_page[/youtube]
-
[youtube]http://www.youtube.com/watch?v=9aRbKS9cfRM&feature=channel_page[/youtube]
This guy have serious talent on making his face hilarious. ;D
-
thy awesomeness
-
woo, my new sig :L
-
whahaha ill use the pod lool :L
-
:L :L :L
-
(http://obczaj.net/obrazki/79143.jpg)
(http://obczaj.net/obrazki/79236.jpg)
(http://obczaj.net/obrazki/79238.jpg)
-
is that Nico?
-
"What, why did i stop?" :L
-
[youtube]http://www.youtube.com/watch?v=mYyDXH1amic[/youtube]
-
(http://s3.faceinhole.com/09/10/16/645e07d9a10172d9109.jpg)
(http://s3.faceinhole.com/09/10/17/709b67d9a110320271.jpg)
-
its not any funny lol
-
its not any funny lol
indeed
-
(http://s3.faceinhole.com/09/10/16/645e07d9a10172d9109.jpg)
bit funny, bit not so much
(http://s3.faceinhole.com/09/10/17/709b67d9a110320271.jpg)
SLASH ?
-
SLASH ?
/
-
butcher
-
This man is drunk, police is gonna measure how much alcohol is in his blood with that thing... but he thinks its something else, have fun!
[youtube]http://www.youtube.com/watch?v=-rj_VZS7LCs[/youtube]
-
amazing movie, amazing graphic
[youtube]http://www.youtube.com/watch?v=_HBJcA7qkCs[/youtube]
-
nice
-
Another urban myth busted:
(http://img18.imageshack.us/img18/5417/urbanmyth.jpg)
-
:L :L
these ppl are idiots lol
-
Hah, indeed. What a style... :-X
-
amazing movie, amazing graphic
[youtube]http://www.youtube.com/watch?v=_HBJcA7qkCs[/youtube]
Voo the reflection+sky+the looks of them inside video makes it really feel like a clear sunny day.
And the car has some real "work" put on it.
-
(http://files.uploadffs.com/f/7663fa93/epic_fail.bmp)
-
for M4
(http://obczaj.net/obrazki/70062.jpg)
Wtf Totalll Bargainnn!!!!!11111!!1!!111!1
-
(http://files.uploadffs.com/f/7663fa93/epic_fail.bmp)
:L
-
(http://files.uploadffs.com/f/7663fa93/epic_fail.bmp)
lmao ! :L :L
i remember its canberk's race heh
-
(http://files.uploadffs.com/f/7663fa93/epic_fail.bmp)
lmao ! :L :L
i remember its canberk's race heh
HAAHAHAH that one is good xD
This one is great too:
[youtube]http://www.youtube.com/watch?v=nBJV56WUDng[/youtube]
-
[youtube]cyAxqI2Z6CU[/youtube]
[youtube]K0it1u_WcBI[/youtube]
[youtube]KhvOMAWIxfk[/youtube]
-
not funny!!
-
+1
-
you had sex with dinner or what you gay female from bronx family ? ???
-
Lithuanian talents. This guy is so gay his voice and hes 28! :L :L
[youtube]http://www.youtube.com/watch?v=xzKBMxuice8[/youtube]
But these guys got some talent :D
[youtube]http://www.youtube.com/watch?v=GBamhVRC6KU[/youtube]
-
Lithuanian talents. This guy is so gay his voice and hes 28! :L :L
[youtube]http://www.youtube.com/watch?v=xzKBMxuice8[/youtube]
haha :L
btw what are they talking about, i wanna laugh too :L
-
One of commission members is asking how old are you :L
And he answers: I'm 28.
Then one of commission members is saying its hard not to lough :L
The guy with yellow T-shirt is saying im gonna juggle balls and buket its like for Lithuania...
After his show the commission member sitting on right saying this must be the worst thing i've ever seen in my life :L
--------
And so on... :L
-
lough :L
(spin)
-
for M4
(http://obczaj.net/obrazki/70062.jpg)
Wtf Totalll Bargainnn!!!!!11111!!1!!111!1
LOL YEY ;D
-
[youtube]http://www.youtube.com/watch?v=dQ8LS_AzgYI&feature=channel[/youtube]
-
not funny!!
lol!! as i will never understand your "european's things"... u will never get to understand latin's things.... lol...
(http://i65.photobucket.com/albums/h209/Kiantsu/ardilla.gif)
-
(http://i65.photobucket.com/albums/h209/Kiantsu/ardilla.gif)
but I love that one :L that thing is cool xD it's such an epic look hahah
[youtube]http://www.youtube.com/watch?v=dQ8LS_AzgYI&feature=channel[/youtube]
lol
-
[youtube]http://www.youtube.com/watch?v=dQ8LS_AzgYI&feature=channel[/youtube]
Rofl :@ 0:09 :L
-
[youtube]http://www.youtube.com/watch?v=dQ8LS_AzgYI&feature=channel[/youtube]
lmao :L :L
-
I know it's old but still its hilarious :L :L
[youtube]http://www.youtube.com/watch?v=glvGfQnx3DI[/youtube]
-
Tiger woods hole in one, omg lol how sick, via the water.
http://www.dumpert.nl/mediabase/679861/6a8253a8/nice_hole_in_one.html
-
(http://files.uploadffs.com/d/68ecda23/hahaaa.jpg)
-
Sorry. :L
-
Pwned.
Whats the difference between posting and sending ? :L
-
You post a reply and send a pm.
-
But it says both for private messages. >.<
-
Then is a reply also defined as personal message, which looks very logic if you ask me.
-
Might do.
Its fine. lol
-
^ lolzor discussion :L
-
Discussion of this. :D
(http://www.icseguess.com/uploads/images/funny-picture-1475818506.jpg)
-
Poor dog :-\
-
(http://bastardlogic.files.wordpress.com/2008/01/dumb-ass.jpg)
-
[youtube]http://www.youtube.com/watch?v=m_kwsollKow[/youtube]
-
Not fun, real sad to see one of my favorite teams loose to a 3 division team
-
Such a shame for Real Madrid. Spending 300 million euro on players and still failing to win... HAHAHAHAH
Okay, Im no Real supporter(never been), but the way they treated my countrymen is fucking harsh..
My favorite clubs in europe are: Arsenal and FC Barcelona.
(And I like two Dutch clubs.. FC Groningen(my city muahahah) and PSV Eindhoven)
-
What about twente fc? There's a costarrican player there, one of the best in NL my favorites in europe are Liverpool, Real Madrid and Inter
-
Ruiz!! Yeah good player! I love the way FC Twente plays at the moment.. they won with 4-0 from FC Groningen this weekend :( (my team isn't doing good at all this season)..
Btw, in the Europe League(EL) Twente lost their first match this season.. they played a bad match against the champion of the moldavian competition.
Nice goal of Ruiz here:
[youtube]http://www.youtube.com/watch?v=G6YIjIOc_A4[/youtube]
-
Ya thats a good one, shame he played for the biggest rival of my team here hehe but ya he is good
-
This is coooooooooool!
[youtube]http://www.youtube.com/watch?v=0XjwoVqM_qE[/youtube]
-
i miss this :'(
(http://files.uploadffs.com/7/d52b738a/gta_sa_20091029_21444039.jpg)
-
Heh i don't. I always tried to change my car colour so i could not have these :L
-
yeah they should've made that able too in 0.3a
-
i miss this :'(
(http://files.uploadffs.com/7/d52b738a/gta_sa_20091029_21444039.jpg)
same, that was great
-
(http://i36.tinypic.com/2zzuk3t.jpg)
-
Hi Ush :L :L
-
I'm the PinkPanter and you're the Octopussy ezra :D :D :D
-
You do it into the head ? Wrong place lol
Grand Theft Auto IV: The Ballad of Gay Tony - First 13 Minutes Gameplay
[youtube]http://www.youtube.com/watch?v=F00qPl4HfyM[/youtube]
-
(gayy)
-
(gayy)
Indeed :D
-
(gayy)
mooman always know where to place the right replies :D
-
Strange cloud in Europe ( UFO ) :L
[youtube]http://www.youtube.com/watch?v=EZiAt35c3Xk[/youtube]
-
Strange cloud in Europe ( UFO ) :L
[youtube]http://www.youtube.com/watch?v=EZiAt35c3Xk[/youtube]
latvia again?
Its probably as much true as that "meteor" lol :L
-
Nah first it was seen in Moscow now in Romania :L And this is real just strange weather anomaly which consisted in very rare weather conditions ;)
-
Nice cloud there!
This is how you get 7 co-pilots. ;D
(http://www.slipperybrick.com/wp-content/uploads/2007/09/ferrari-360-modena-stretched-limo.jpg)
-
Why so serious?
(http://images.paraorkut.com/img/funnypics/images/w/why_so_serious_cat-12947.jpg)
-
This made me so LOL :L
-
[youtube]http://www.youtube.com/watch?v=NQ7f9wb88sY[/youtube]
-
rofl, nice :L :L
some moments looked quite terribly though
-
:L
[youtube]http://www.youtube.com/watch?v=dxg9SJXhjnQ[/youtube]
and here is a funnier harry potter remake
[youtube]http://www.youtube.com/watch?v=qtQIaf47VAE[/youtube]
-
[youtube]http://www.youtube.com/watch?v=NQ7f9wb88sY[/youtube]
EPIC ROFL
Bus overbrake and cop pole-kiss are in best of best pack >.<
-
[youtube]http://www.youtube.com/watch?v=dxg9SJXhjnQ[/youtube]
south park owns the harry potter version :L
-
[youtube]http://www.youtube.com/watch?v=JZQsA7G0hvQ[/youtube]
-
Holy shit he needs serious help about his addiction.
-
I already know that one, is funny lol :L
But I think he had more than only alcohol..
BTW CARTMAN FTW <3:
[youtube]http://www.youtube.com/watch?v=h8CU9UhrNnM[/youtube]
lal:
(http://www.freefoto.com/images/41/01/41_01_52---Elderly-People_web.jpg)
-
(http://i37.tinypic.com/6j0ewg.jpg)
-
cycorder to pc
-
Woo what a game. :)
[youtube]http://www.youtube.com/watch?v=JnEbhoYVIrE[/youtube]
-
where is the fun?
-
:L :L
(http://files.uploadffs.com/4/0d5847cd/1239733077.jpg)
(http://files.uploadffs.com/2/a55824cd/1239733098.jpg)
(http://files.uploadffs.com/2/860625f3/1239733101.jpg)
(http://files.uploadffs.com/5/34915cb3/1239733136.jpg)
(http://files.uploadffs.com/e/45e4ecd8/1239733177.jpg)
(http://files.uploadffs.com/6/9f4c63f3/1239733184.jpg)
(http://files.uploadffs.com/0/4c240c36/1239733194.jpg)
-
Hah ;D
-
hahaha nice devil :D
-
ty :L
-
np ;)
-
Thats just one word "greatness" :L
-
last one is epic, never seen a cow giving so much milk with such pressure XD buahahahaha
thy awesomeness
-
Drunkest Guy Ever Goes Back For More Beer
[youtube]http://www.youtube.com/watch?v=JZQsA7G0hvQ[/youtube]
-
[youtube]http://www.youtube.com/watch?v=JZQsA7G0hvQ[/youtube]
-
yeah repost -1
Whoop, I love borat disco dancing, its a great dance!!
[youtube]http://www.youtube.com/watch?v=UWtIxRps2FM[/youtube]
LOOOOOOOOOOOOOOL
(http://media1.break.com/dnet/media/2008/5/29may29-the-cats-ass.jpg)
-
* Thanks to Ush for fixing up half of todays laugh need. :L
-
lol
(http://1.bp.blogspot.com/_wGr8njEWjtI/SpySMe-xV3I/AAAAAAAAETo/iPuJ7Smmgv0/s400/Caitlin+B+.+ow+.+creature.JPG)
-
lol what is it :D
-
[youtube]http://www.youtube.com/watch?v=rNYBcnQbdqE[/youtube]
-
lol what is it :D
cake :L
-
from what? xD
-
with my well developed intelligence I guess it must be chocolate :L
-
:L
-
This... This.... Hmm...
This is a CREATURE we DONT know. :L :L
And i really love cakes, but i will think about it before i eat it, maybe its a creature looks and tastes like chocolate ?
-
the most agressive football player ever lol
and it's a woman
[youtube]http://www.youtube.com/watch?v=2LPIUI_CY44[/youtube]
-
omfg i've just watched the same video today! :L
-
;D
[youtube]http://www.youtube.com/watch?v=6-z_A2CH3BI[/youtube]
[youtube]http://www.youtube.com/watch?v=plWnm7UpsXk[/youtube]
-
(http://obczaj.net/obrazki/83764.jpg)
(http://obczaj.net/obrazki/83770.jpg)
(http://obczaj.net/obrazki/83784.jpg)
-
(http://i572.photobucket.com/albums/ss168/Razormax8/sith_nazgul.jpg)
poor frodo :(
-
^ but sexy elf will help frodo to survive :P
-
http://www.youtube.com/watch?v=ggB33d0BLcY&feature=channel (ftp://http://www.youtube.com/watch?v=ggB33d0BLcY&feature=channel)
-
Lol Gen its trying to redirect to a FTP server. >.<
Your embed here;
[youtube]http://www.youtube.com/watch?v=ggB33d0BLcY[/youtube]
Ok donkey is laughable, but hes a bit too hard on it. :L
-
lol yea, he is a freak :D
-
OMFG
This is really the funniest thing since ages :L
"Monsieur Bière"
[youtube]http://www.youtube.com/watch?v=lQNtPw_8ES8[/youtube]
-
hah ush lol, thats nice :L
-------------------
old but good :D
[youtube]http://www.youtube.com/watch?v=TGIQr8dqlso&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=dFum24vQvC4&feature=fvw[/youtube]
[youtube]http://www.youtube.com/watch?v=-mAutchzKuQ[/youtube]
-
(http://obczaj.net/obrazki/83917.jpg)
(http://i.demotywatory.pl/uploads/1257948149_by_kamilos19_500.jpg)
-
Parody from Glee -I say a little player
LOL
[youtube]3Lp3s4ygDw0[/youtube]
OM NOM NOM NOM!!
[youtube]CWK-iyC5oPc[/youtube]
-
lol at glee one, we are gonna see that episode this thursday in latin america
-
[youtube]http://www.youtube.com/watch?v=X4Piuuqqs10[/youtube]
-
that girl is a bitch jalicno :L
-
this video is on the previous page already (spin)
-
Do I need to explain more? --> idiot!
[youtube]http://www.youtube.com/watch?v=75IBHZ2BU0c[/youtube]
-
o_0
-
In the Netherlands we have those famous walls with food in it. When I was partying tonight I brought a mandarin with me and we bought a cheeseburger and put that mandarin back in xD
Picture:
(http://img21.imageshack.us/img21/1792/afb0329.jpg)
Hahah I never noticed, but I see that they spelled Cheesburger without the 'e' xD
-
Someone call the spelling police! :(
-
[youtube]kAOQiCXlrhE[/youtube]
[youtube]N6XQADRUHHQ[/youtube]
-
(http://obczaj.net/obrazki/84682.jpg)
(http://obczaj.net/obrazki/84590.jpg)
-
(http://obczaj.net/obrazki/84590.jpg)
dev playing samp :L :L
-
[youtube]http://www.youtube.com/watch?v=HTkA9L2J2gY[/youtube]
-
(http://obczaj.net/obrazki/84590.jpg)
dev playing samp :L :L
i dont have a laptop :D
-
I love this video!! these girls are so sexy...(http://www.muchachapa.com/images/smiley_babas.gif)
[youtube]4yjBMlqPnZE[/youtube]
(http://i266.photobucket.com/albums/ii242/psupaul/smithers_141.gif)
(http://i266.photobucket.com/albums/ii242/psupaul/ralph-egg2.gif)
-
(http://obczaj.net/obrazki/84910.jpg)
-
(http://obczaj.net/obrazki/84996.jpg)
(http://obczaj.net/obrazki/84999.jpg)
-
LOL fail
[youtube]http://www.youtube.com/watch?v=8z3rRl3bBz4[/youtube]
-
(http://sam.zoy.org/porn/big_pussy.jpeg)
Devil's cat
(http://images.meredith.com/bhg/images/08/ss_PetsDevilCat.jpg)
-
:L
-
omg poor cat is starving
-
muscat
-
lol
-
(http://blatherwatch.blogs.com/.a/6a00d8341bf6cb53ef01156f75541c970c-320wi)
-
:L
(http://img121.imageshack.us/img121/4076/15114592.jpg) (http://img121.imageshack.us/i/15114592.jpg/)
-
lol
-
meow meow meow meow meow meow :D
[youtube]http://www.youtube.com/watch?v=LTunhRVyREU[/youtube]
-
(gayy)
[youtube]http://www.youtube.com/watch?v=JlwtsKXm-MM[/youtube]
-
stupid french.
now netherlands isn't in group 1 with the seeding..
-
(http://blstb.msn.com/i/66/7F69EFB53FC356286535E022CD60F7.jpg)
-
haahh the irish soccer union(or whatever the name for that is) makes appeal to replay the match
-
Close your eyes :-X
[youtube]http://www.youtube.com/watch?v=Laz0cAZEhWg[/youtube]
-
French, the cunts. Thierry henry even admitted it! >:( We deserve a rematch!!!!!
-
^ I agree with mr ireland :D
-
[youtube]http://www.youtube.com/watch?v=MEqwwLEDyGY[/youtube] best version of Drunkest GUY adventures :D
-
[youtube]http://www.youtube.com/watch?v=MEqwwLEDyGY[/youtube] best version of Drunkest GUY adventures :D
lol
-
I say jump over pool full of snakes is fake, but over Aston... Dunno ;D
[youtube]http://www.youtube.com/watch?v=_Dcv9qzWrps[/youtube]
-
Only UK people may know of Bear Grylls, but this is funny:
[youtube]http://www.youtube.com/watch?v=p3J4Kq1FzVk[/youtube]
-
Discovery is international channel ;)
-
Discovery is international channel ;)
Ah cool. :) I didn't know he was on Discovery, as he is on Channel 4 here i think.
-
Man vs. Wild (http://dsc.discovery.com/tv-schedules/series.html?paid=1.13899.26004.32074.5)
-
ha ha yeah, he will survive apocalypse and show it on Discovery :L
-
wtf didn't know bear grylls was such a pervert
-
Bear Grylls is an awesome guy on TV ;D
lol funny video :L
-
REAL RALPH (THE SIMPSONS)
(http://www.pendejaditas.com/wp-content/uploads/2009/06/Ni%C3%B1o-Helado-Pendejaditas01.gif)
-
haha :L
-
[youtube]AJt8DmE3JSk[/youtube]
-
(http://img684.imageshack.us/img684/3235/lolsa.jpg) (http://img684.imageshack.us/i/lolsa.jpg/)
-
lol epic fail
-
(http://kuvaton.com/kuvei/skills.gif)
-
[youtube]http://www.youtube.com/watch?v=DaVCfVbucVM[/youtube]
"Jackass team" from my city hehe
[youtube]http://www.youtube.com/watch?v=bSkQ32vzuSY&feature=related[/youtube]
and part 2
[youtube]http://www.youtube.com/watch?v=HPw7dQma7Qk&feature=related[/youtube]
part 3 (most hardcore for me :D )
[youtube]http://www.youtube.com/watch?v=KkKvpsrkDu8&feature=related[/youtube]
-
Two estonian business men talking in english :L :L
http://www.ctv.lt/video/778/GIG-geriausias-i%C5%A1-geriausi%C5%B3-Estai
-
Two estonian business men talking in english :L :L
http://www.ctv.lt/video/778/GIG-geriausias-i%C5%A1-geriausi%C5%B3-Estai
it always asks me something lol
Šiame puslapyje gausu necenzūruoto turinio, todėl jis nerekomenduojamas jaunesniems nei 14 metų asmenims.
Ar tu jau turi 14 metų?
cant watch it :(
-
Eh it always asks if you have 14 years old. Just press green button (Taip) and you will be able to watch it :P
-
hahaha idiots :L
-
Rebus :D :D
(http://img109.imageshack.us/img109/7995/mooman.jpg)
-
mooman! :D
-
(http://www.malibumoofrozengriddle.com/Images/Malibu_Moo_Real_1.jpg)
(http://topjokes.org/images/moo.jpg)
(http://www.kloonigames.com/blog/wp-content/uploads/2007/03/moo_shot_03.jpg)
(http://2.bp.blogspot.com/_ZShMpXfhwPw/RbpiAWJIYTI/AAAAAAAAAA4/SB7B3qpj9yc/s320/vaca%2520loca.jpg)
(http://img211.imageshack.us/img211/4897/vaca0hlgh7.jpg)
(http://www.superbastardo.com/misc/superbastardo/data/images//h/hombre_vaca1178284528.jpg)
(http://static.zooomr.com/images/482615_20c3712b84.jpg)
(http://www.tienda-disfraces.es/dinamic/marca_de_agua.php?src=../img_bd/15225xl.jpg)
(http://farm4.static.flickr.com/3346/3300384613_56b321b315.jpg?v=0)
(http://3.media.tumblr.com/mJnzPrzMbpop1jwuH8q1bxbPo1_500.jpg)
(http://f00.inventorspot.com/images/dolphin%20and%20cow.img_assist_custom.jpg)
-
Too much moo! :o
-
(http://obczaj.net/obrazki/86507.jpg)
(http://obczaj.net/obrazki/86518.jpg)
(http://obczaj.net/obrazki/86519.jpg)
(http://obczaj.net/obrazki/86520.jpg)
(http://obczaj.net/obrazki/86521.jpg)
(http://obczaj.net/obrazki/86522.jpg)
(http://obczaj.net/obrazki/86523.jpg)
(http://obczaj.net/obrazki/86524.jpg)
(http://obczaj.net/obrazki/86525.jpg)
(http://obczaj.net/obrazki/86526.jpg)
(http://obczaj.net/obrazki/86527.jpg)
(http://obczaj.net/obrazki/86528.jpg)
-
:L Insane
-
unbelievable
[youtube]http://www.youtube.com/watch?v=ePfCWVoLVOA&feature=fvhr[/youtube]
-
people who jump in front of trains are cunts. if you're going to kill yourself, stick your head in the oven or something, don't force some poor train driver to kill you :@
-
but it was drunk and it fell :(
-
yeah but i just thought i'd use this opportunity to mention my views on people who do that cos there'll probably never be a better time :L
-
spose so :L
-
i saw that video on news.... she was too high...
a lot of videos like those are in mexico now.... ppl throws down to underground passages and try to suicide... anothers try to jump at next corridor...
[youtube]I1I7KgBWc78[/youtube]
[youtube]ZWZ1HzbuoO8[/youtube]
[youtube]9ZKCbZJ__dM[/youtube]
-
[youtube]9ZKCbZJ__dM[/youtube]
WTF :o :o
-
Coca Cola Ad lol
[youtube]http://www.youtube.com/watch?v=TecLbWk8A3w[/youtube]
-
that's old :D
-
[youtube]http://www.youtube.com/watch?v=0TbQOzHmzH0[/youtube]
-
:L All that run is for nothing, massacre out there lol
-
[youtube]tUEyYuZkjVI[/youtube]
(http://www.blackbeltpoker.com/Images/Players/Profile/snoopy_1.jpg)
-
hahah lool :L
-
(http://files.uploadffs.com/8/6b558b6b/3757.gif)
-
:L
Wipple
-
How good does this game look? lol
[youtube]hOvq3-oG5BM[/youtube]
It's called Sumotori and is under 100k lol
Full info is here:
http://www.fun-motion.com/physics-games/sumotori-dreams/
-
Weird lol
-
lol Im gonna get it asap
-
it is a free game
you can download the attachment if you want
-
stupid game
-
but very fun
-
(http://i33.tinypic.com/t6y23r.jpg)
-
HAHA this owns! :L
http://www.newgrounds.com/portal/view/515897
-
wtf crazy shit devil :L
-
btw, it's infinite :L
-
it's good to be MacGyver
-
I played it like 3 times over again, it was fine. :P
-
fast as fuck ?
[youtube]http://www.youtube.com/watch?v=dkHXtftl2dk[/youtube]
*1/8 mile, not 1/4
-
Why you type 1/8 that small lol
-
coz 1/8 mile drag is shit lol
(http://obczaj.net/obrazki/87535.jpg)
-------------------------------------------------------------------------------------------
facebook additced ?
(http://obczaj.net/obrazki/87709.jpg)
-
lol
horse pop
-
(http://obczaj.net/obrazki/87839.jpg)
-
A ball !! A testicle !!
-
that one is quite fun and disturbing at the same time XD
-
does someone miss a ball ? :P
-
does someone miss a ball ? :P
yes, it's yours :L
hah, this is pretty interesting
[youtube]http://www.youtube.com/watch?v=AfDWdIh8BLU[/youtube]
-
ye... im skateboarder too since i was 16 y.o.
skimboarder since 21 y.o.
[youtube]b2RnazoEkUw[/youtube]
[youtube]sHzeDfKr0MI[/youtube]
[youtube]0bgvOV9Auzw[/youtube]
[youtube]n3INJUUiKaI[/youtube]
[youtube]kQq_9o0Jvi8[/youtube]
[youtube]pSCKlx7Bx0s[/youtube]
-
and where is the damn fun? wrong topic bunnies, or if you think this is fun ITS NOT FUN AT ALL
-
Maybe for someone else ?
-
Rodney Mullen = Legend
-
(http://i4.demotywatory.pl/uploads/1259791148_by_kiku90_500.jpg)
-
(http://files.uploadffs.com/a/5/92f05b09/HAHAHA.jpg)
-
lol
-
young :L :L
-
[youtube]http://www.youtube.com/watch?v=PWNLPl7oIRc[/youtube]
-
Don't breath this! ;D
[youtube]http://www.youtube.com/watch?v=vZhWd6nvcWc[/youtube]
-
[youtube]http://www.youtube.com/watch?v=ldY2s9fxuPs[/youtube]
-
. .
O
-
what the fuck? ??? ???? ??? ???
-
??? ??? :'(
-
(gayy)
-
kinda disturbing
-
meh... that's no fun at all moo.. :(
-
LOOL
(http://photos-d.ak.fbcdn.net/hphotos-ak-snc3/hs120.snc3/16743_101358536554660_100000415435121_36770_4381065_n.jpg)
-
:L
-
kewl :L
-
lól
and farts are nitro
-
Farts...
(http://i47.tinypic.com/11b0njk.png)
-
Ha ha.
[youtube]D9sXhYlIfRY[/youtube]
-
:L
-
[youtube]http://www.youtube.com/watch?v=ldY2s9fxuPs[/youtube]
this kind of video takes me to think over or meditate.... when im down or when i think that everything is a shit, it really isnt... sometimes when i go in street i saw ppl more "fucked" than me, for every thing that u want to think: bumps, more pour, more ugly, deformed ppl, kids with down syndrome, without parents, without health..... it could be anything.
Shit!! I'm completly normal (i meant in my body), i got health, I got my parents still alive, i got my friends, i go to university.... maybe i dont do trips around the world, maybe i dont get a Ferrari.... but videos like this shows me that i must be happy for every things that i got now.... and maybe i must be less moaning...
-
Ha ha.
Thats really extreme lol
this kind of video takes me to think over or meditate.... when im down or when i think that everything is a shit, it really isnt... sometimes when i go in street i saw ppl more "fucked" than me, for every thing that u want to think: bumps, more pour, more ugly, deform, kids with down syndrome, without parents, without health..... it could be anything.
Shit!! I'm completly normal (i meant in my body), i got health, I got my parents still alive, i got my friends, i go to university.... maybe i dont do trips around the world, maybe i dont get a Ferrari.... but videos like this shows me that i must be happy for every things that i got now.... and maybe i must be less moaning...
Thats a thing we should always keep in mind, we sometimes cant.But we see stuff like this to remind us, just take advantage of it, Thank God.
-
it's funny as fuck lol. i'm not deformed so yay :D
-
(http://www.snorgtees.com/images/brb_fullpic_2.jpg)
-
it's funny as fuck lol. i'm not deformed so yay :D
viva snoopy -.-
-
english or else lol
-
you don't know viva :L ?
its same as vive la france
-
i don't care lol, people should talk to/about me in english, i find it very disrespectful :-\
-
I know, I want people to talk to me in Dutch and/or English too :L
Despite I understand a little bit of what people are talking about in France or Spanish I don't to be spoken to in any other language as Dutch or English. And I understand a lot when people are talking German :L
-
(http://18.media.tumblr.com/tumblr_kudj19223Y1qapmybo1_500.jpg)
-
What the fuck, dolphins. There are no dolphins xD
-
It's funny you mention that... my friend sent me this picture, told her exactly the same thing. :L
-
haha, it took me a long time to find the dolphins but i can see them now lol
not nine ones though :-\
-
my mind is incorrupted, but didnt need that to know :L
-
Hmm really interesting, i didnt believe there are dolphins but after reading posts up here, i found them all lol.
-
I'm trying so hard, but I only find 3 of them :(
-
I can only find 1 dolphin, the one with vagina for his tail
-
I'm at 6 dolphins at the moment :L
-
haha same lol, i found 5 more
-
I can only see the vaginal one, meh, Im too disturbed to see good side of something, I just see the best side :P
-
So its a proof of; the best is not always the good lol
BTW there are "10" dolphins not 9
I marked them right here but DONT click if you want to find all 10 yourself, then check out.
Click me if you're not interested (http://i47.tinypic.com/dgpgte.jpg)
Yea my mouse is perfect at drawing... :L
-
That's a great optical illusion :D
-
yeh lovely, i love them xD
I just remembered there is a story i heard about hidden dolphins, but cant remember enough to tell.
But i know this; there was 7 dolphins hidden inside "nothing", yes a mess of colours... :L
-
9 Dolphins hidden in eroticism is better. ;_;
-
...and don't tell me NASCAR is boring, please
[youtube]http://www.youtube.com/watch?v=6UJ5jD6OJiE[/youtube]
-
(http://www.mrtees.com/images/Nascar-Boring.gif) :L
I dont say anything, the picture says something.And nascar is REALLY COOL when you see some touches turning into massacre. :) e.g. @ 2.30
-
(http://img143.imageshack.us/img143/268/bored5iu.jpg)
-
(http://img143.imageshack.us/img143/268/bored5iu.jpg)
:L Instant Reply ®
http://www.facebook.com/video/video.php?v=214206387648&ref=nf
I couldnt find on youtube, its insane! Just same as the real car lol
-
nascar is driving in an oval
-
http://www.nascar.com/races/tracks/
Are you sure ? :-\ Nascar has normal circuit races also.
-
(http://files.uploadffs.com/a/1/732b1a3f/12122009_230458.jpg)
-
lol :D
-
WE ARE POPULAR! 8)
-
some guest wants to apply for the tournament :L
-
guest viewing topic squ4l0
-
hahaha, look at Joe's birthday :L
(http://files.uploadffs.com/a/4/4145429a/kjggkggggg.jpg)
-
(http://i351.photobucket.com/albums/q461/kevlq/402px-Chuck_norris_toilet_paper.png)
-
I hate Chuck Norris, what's so damn funny about the dude?
-
dude I so totally agree with you, most stupid trend ever, even worse than cm punk fans
-
yeah, Rambo pawns Chuck Norris :D
-
1st part best of rambo
-
If you have five dollars and Chuck Norris has five dollars, Chuck Norris has more money than you.
There is no 'ctrl' button on Chuck Norris's computer. Chuck Norris is always in control.
Apple pays Chuck Norris 99 cents every time he listens to a song.
Chuck Norris can sneeze with his eyes open.
Chuck Norris can eat just one Lay's potato chip.
Chuck Norris is suing Myspace for taking the name of what he calls everything around you.
Chuck Norris destroyed the periodic table, because he only recognizes the element of surprise.
Chuck Norris can kill two stones with one bird.
When the Boogeyman goes to sleep every night, he checks his closet for Chuck Norris.
Chuck Norris doesn't read books. He stares them down until he gets the information he wants.
There is no theory of evolution. Just a list of creatures Chuck Norris has allowed to live.
Outer space exists because it's afraid to be on the same planet with Chuck Norris.
Chuck Norris does not sleep. He waits.
Chuck Norris is currently suing NBC, claiming Law and Order are trademarked names for his left and right legs.
Chuck Norris is the reason why Waldo is hiding.
Chuck Norris counted to infinity - twice.
There is no chin behind Chuck Norris’ beard. There is only another fist.
When Chuck Norris does a pushup, he isn’t lifting himself up, he’s pushing the Earth down.
Chuck Norris is so fast, he can run around the world and punch himself in the back of the head.
Chuck Norris’ hand is the only hand that can beat a Royal Flush.
Chuck Norris can lead a horse to water AND make it drink.
Chuck Norris doesn’t wear a watch, HE decides what time it is.
Chuck Norris can slam a revolving door.
Chuck Norris does not get frostbite. Chuck Norris bites frost
Remember the Soviet Union? They decided to quit after watching a DeltaForce marathon on Satellite TV.
Contrary to popular belief, America is not a democracy, it is a Chucktatorship.
----------------------------------------------------------------------------------------------------------------------------------
http://obczaj.net/pl/ <-- CHECK THIS, VERY FUNNY (no porn, no virus, clean)
-
Ehh, no.
Fuck Chick Norris
-
I dont get why is he the person mention in those jokes, no other person ? Whats his speciality ? I like his movies lol
-
http://obczaj.net/pl/ <-- CHECK THIS, VERY FUNNY (no porn, no virus, clean)
hah, racist jokes
but this one is great :L :L
(http://obczaj.net/obrazki/88789.jpg)
-
hahahah I really like that one :L
btw, I found ironmans wifey :L
(http://www.myextralife.com/wp-content/uploads/2007/12/hot-chick-ugly.jpg)
-
hahaha :L
-
(http://img.perezhilton.com/wp-content/uploads/2009/12/original-1__oPt.jpg)
-
those racist jokes are too funny rofl
-
[youtube]http://www.youtube.com/watch?v=h4xZMEqg7jQ[/youtube]
T-mobile commercial :L
-
haha i have seen it on TV already :L
probably because originally it's a czech commercial lol
-
stupid language (gayy)
-
oh dear
-
majidali19 (2 months ago) Show Hide
+7
It reminds me of Grand Theft Auto San-Andreas.
[youtube]http://www.youtube.com/watch?v=1KVn3lajzjs[/youtube]
-
Any news about that jetpack ?
-
It runs on steam, so it can fly in the air for only 40 seconds
-
fail
-
watch out with roadtop... LOL
[youtube]16wXhiYXEaw[/youtube]
-
roflmfao
-
[youtube]http://www.youtube.com/watch?v=ZN5PoW7_kdA[/youtube]
-
i love those :L
-
hahah same
-
me too :D
-
[youtube]lC6dWYkuo7c[/youtube]
[youtube]ydyw5R0vuVM[/youtube]
[youtube]ghqAQ-2oH2Q[/youtube]
-
hmmm wonder where is the fun
here something that Im sure will get at least a smile out
[youtube]http://www.youtube.com/watch?v=jzs7ICVKlRA[/youtube]
-
I'm not going to look 4 minutes to that stupid hamster lol
-
lol @ ush
-
aw u dont like my lovely stupid hamster?
-
I'm not going to look 4 minutes to that stupid hamster lol
^
so... this is funny huh??
i did piss on me -.- [...]
-
you pissed on yourself?
-
ahh groose
-
you pissed on yourself?
when someone laughs a lot, that one can laugh until piss himself
its a common saying
-
I'm not going to look 4 minutes to that stupid hamster lol
^
so... this is funny huh??
i did piss on me -.- [...]
ya, quite funnier than 3 girls playing guitar hero
-
I'm not going to look 4 minutes to that stupid hamster lol
^
so... this is funny huh??
i did piss on me -.- [...]
ya, quite funnier than 3 girls playing guitar hero
the annoying orange I posted on the previous page is way funnier :L
-
the annoying orange I posted on the previous page is way funnier :L
yeee... XD that orange reminds me fernando almeja lol..
-
yeee... XD that orange reminds me fernando almeja lol..
init
-
(http://obczaj.net/obrazki/89482.jpg)
-
why you cant sleep :L
-
Easy to read it but it feels like flashing so bad.
-
probably a repost but i laugh every time :L
[youtube]http://www.youtube.com/watch?v=8DxKG2EW1Hc[/youtube]
-
lol I thought the two of the dragsters were going to fail.
I've watched it twice, laughed both times. Good un'.
EDITl: 3/3 now
-
You want funny fails, check this website out, there is loads on it and a new one posted every day:
www.todaysbigfail.com
Classic: http://www.todaysbigfail.com/view/20080811
-
Holy shit, silly bastards lol That was so close to a fucking total burn out!
-
I must have a black heart, i get proper lols at the bloke when he rolling on the floor screaming.
-
http://www.todaysbigfail.com/view/20080812 hahahaha nguahguahguha oooh ughg ooooh
-
lol, she makes some proper lollage winded sounds.
-
lol
This one is great! Probably why it was number 1.
http://www.todaysbigfail.com/view/20091106
-
and its tunning up the band....1.....2.....3.....4.....5..... Sweet Chin Music
http://www.todaysbigfail.com/view/20080917
-
lol
This one is great! Probably why it was number 1.
http://www.todaysbigfail.com/view/20091106
Holy fail... He got whole warehouse down and sure his job down too! :P
LSD Effect lol
Nice effects
[youtube]http://www.youtube.com/watch?v=h9EpnVAl5JA&NR=1[/youtube]
-
hahaha awesome, I heard you have hard time to recognize yourself in a mirror
-
Yes cause of the dirt in the mirror, im looking hard to find a clear spot.
-
(http://5.media.tumblr.com/tumblr_kuwmneuWUG1qaobyfo1_250.gif)
-
epic :L
-
(http://5.media.tumblr.com/tumblr_kuwmneuWUG1qaobyfo1_250.gif)
:L
-
(http://files.uploadffs.com/b/8/1b56847b/snoteater.gif)
:(
-
Awful :-X
-
(http://www.hetmeisjedatopdinsdaghetbierschenkt.nl/wp-content/uploads/2008/12/poop-shoot.jpg)
(http://files.uploadffs.com/b/8/1b56847b/snoteater.gif)
:(
(http://wiegertjepostma.files.wordpress.com/2009/05/ieuw_phixr.jpg)
:(
-
(http://files.uploadffs.com/b/8/1b56847b/snoteater.gif)
ffs
-
(http://wiegertjepostma.files.wordpress.com/2009/05/ieuw_phixr.jpg)
wtf :L
-
moo is that you in your avatar? :o
-
nah :L
-
Lol moomanovic @ your avatar
-
moo is that you in your avatar? :o
he is on ax forum :L
-
I remember some people here fan of splinter cell, here is a nice coop story gameplay trailer. :)
Splinter Cell Conviction
[youtube]http://www.youtube.com/watch?v=K7wb86fz7Ic[/youtube]
-
humm cool
-
[youtube]http://www.youtube.com/watch?v=A2guQYivZ6w[/youtube]
-
hahaaa :L :L
-
Ooooops Mr.Bird ruins the scene :L
(http://cache.gawker.com/assets/images/jalopnik/2009/11/bird_crap_google.jpg)
-
hahaha LOOOOOOOL love hahaha :L thats so funny :L
-
LMAO!! :L
-
More "The annoying orange"
Part 2.
[youtube]http://www.youtube.com/watch?v=l7F5nIA8xmw[/youtube]
Part 3.
[youtube]http://www.youtube.com/watch?v=xjdBCeUdAmI[/youtube]
And part 4, uploaded yesterday.
[youtube]http://www.youtube.com/watch?v=fOxg8hT30r0[/youtube]
-
What an annoying orange :L
-
Reminds me of my pet orange before he died :'(. Stupid noob got shot by a chicken and died >:(.
Ontopic: Epic fail game names:
[youtube]http://www.youtube.com/watch?v=yQLQ-NCUbtU&feature=fvw#movie_player[/youtube]
-
Do they really exist ? :L
All weirdos & good commentary.
If it moves, shoot it!
If it lives, shoot it again :L
Looooolz at 51
Death by Dying...
-
(http://photos-e.ak.fbcdn.net/hphotos-ak-snc3/hs202.snc3/20931_1313280154239_1297735150_30932329_4963891_n.jpg)
-
(http://photos-e.ak.fbcdn.net/hphotos-ak-snc3/hs202.snc3/20931_1313280154239_1297735150_30932329_4963891_n.jpg)
"hopefull" still gets a tick? :(
-
[youtube]http://www.youtube.com/watch?v=Ujkkuf5T_xY[/youtube]
-
looooooooool
-
Cba to watch whole video. What a tard :-X
-
omg, total idiot
-
he is awesome, he should make more extreme videos
-
ye, love these extreme videos
[youtube]http://www.youtube.com/watch?v=zrSwaA-FAj4[/youtube]
[youtube]http://www.youtube.com/watch?v=S4YbC6OLAlo[/youtube]
and another persons
[youtube]http://www.youtube.com/watch?v=Sf8cM7f6P2I[/youtube]
[youtube]http://www.youtube.com/watch?v=GWptcrms0hc[/youtube]
[youtube]http://www.youtube.com/watch?v=klebaGtX9R8[/youtube]
-
http://mojevideo.cz/view.php?id=4652
http://mojevideo.cz/view.php?id=4562
http://mojevideo.cz/view.php?id=4643
-
(http://obczaj.net/obrazki/91057.jpg)
-
(http://paski.org/paski/kupa.jpg)
NEO kid
-
NEO xDDDDD
-
What a great person he is :L
(http://mmreddy.nomadlife.org/uploaded_images/RickAstley-717066.jpg)
-
(http://photos-g.ak.fbcdn.net/hphotos-ak-snc3/hs058.snc3/14566_209776468748_209774958748_3067376_2442551_n.jpg)
-
(http://media.ebaumsworld.com/picture/capnmorgan2007/UglierGirlfriends.png)
-
What a loop.
There is no dummy coming out of nowhere, check carefully. :L
(http://jahmdesigns.com/images/stick_people_R.gif)
-
haha, the one sitting in the bottom right corner
-
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
-
omg :L
-
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
-
Haha m-ooman(on purpose moo :L) made a trend out of this. :L
Yes.. With all that spam, its still infinite.We dont lose any dummy. :L
NOW we will lose some of them :L
(http://i50.tinypic.com/vxjm0y.png)
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
-
(http://consumerist.com/relativeprices.jpg)
:-\
-
(http://imgur.com/pRmNZ.jpg)
-
:L
-
haha :L
Not funny, but amazing.. this is just madness :L
[youtube]http://www.youtube.com/watch?v=QgutBgcZhFw[/youtube]
-
O.o quick stuff.I think this thing is worse than road races when you make a mistake. ???
-
[youtube]http://www.youtube.com/watch?v=ITHRvEXz2Y0[/youtube]
-
Couldn't understand what he was saying lol. Hmm.. He's been playing MW2 for 17 hours :L and he got obsessed with someting. Jesus, just look at him :L
-
What the ?! At least its not MMO game.
-
give kid camera...
-
Just for moo:
[youtube]f9iIgQN5uZE[/youtube]
-
ooo ouch!
-
:O
-
[youtube]http://www.youtube.com/watch?v=Xv5J5cBwwFc[/youtube]
real ?
-
seems real, I think the distance is safe enough, would be awesome to see that
-
What? Of course it is real lol. Nice speed though
-
Hmm nice view.
-
lol, offensive results :L
(http://files.uploadffs.com/c/f/3852ff92/obamaswife.JPG)
-
LOOOOOOOOOOOL THIS IS FUCKING HILARIOUS :L :L :L
[youtube]http://www.youtube.com/watch?v=NVEVs135mZs[/youtube]
-
100th page :D
-
people are scared of some really strange things :L
-
Really, really and really strange :L
Google has nothing to do but agree with offensive results :L
-
Arachibutyrophobia- Fear of peanut butter sticking to the roof of the mouth.
This is not a video or photo, but still funny.
List of all phobias.
http://www.phobialist.com/
I'm having logizomechanophobia and logophobia, it's so scary to post this that I let someone else type.
But I don't talk with anyone cause I also suffer of laliophobia.
-
I'm having Acrophobia but not the strongest level of that. I just dislike very tall buildings :L
And wooo my first topic with 100 pages ;D
-
lol fear of peaches? wow thats crazy.. only thing i dislike is those "daddy long legs" look like flyin spiders eeeek horrible! they always come flyin near ya D: http://images.wikia.com/uncyclopedia/images/thumb/c/c9/Daddy_Long_Legs.jpg/180px-Daddy_Long_Legs.jpg
-
Some of you will probably laugh at me, but a have a phobia of moths. I don't know why, but I can't stand them :-X
(http://bugs.bio.usyd.edu.au/learning/resources/Entomology/images/Topics/importance/bogongMoth.jpg)
-
laugh?
nothing funny
-
Hmm, beside peach its nothing.
Scaring from flying little creatures are way easy.I scare too when i see some over-grown fly lol.
-
lol fear of peaches? wow thats crazy.. only thing i dislike is those "daddy long legs" look like flyin spiders eeeek horrible! they always come flyin near ya D: http://images.wikia.com/uncyclopedia/images/thumb/c/c9/Daddy_Long_Legs.jpg/180px-Daddy_Long_Legs.jpg
Hah I hate them too, I always get scared when I see it flying around :L
-
moskitoes: squash em when they are standing on a wall, moths: swing a shoe at them, instant kill
-
i don't have a phobia of mosquitos but i really really hate them. they love to bite me and buzz around my head when i'm trying to get to sleep. it'd drive me insane :L
-
Yeah, they're so fucking annoying, last summer I was in a house near a lake, and there it was crawling with mosquitos. Believe me, newspaper is the best object to kill them with :L
-
ye they are very annoying in nigh
-
so you are one of them lol
-
Black African Grilos. I don't have a phobia of them but they look so tough lol
(http://4.bp.blogspot.com/_cKUtdWbDgC0/SMWLwjaGjKI/AAAAAAAABr0/3HDPvROPAr0/s400/grilo_do_campo.jpg)
-
List of all phobias.
http://www.phobialist.com/
LOL Russophobia - Fear of Russians. :L :L
-
they will hack you :-X
-
:D
-
Alliumphobia- Fear of garlic.
vampires!
-
Detective Monk has all these phobias :L
-
easy solution for moskitoes: turn a fan on
-
easy solution for moskitoes: turn a fan on
or start smoking :L
or get a mosquito net :L
-
[youtube]http://www.youtube.com/watch?v=Ci8n8vhrtMg[/youtube]
-
Haha I saw that one today, had a good lol ;D
-
:L this is so funny
-
haha :D
-
:L :L
-
[youtube]http://www.youtube.com/watch?v=_NLXlZivlyA[/youtube]
:L :L
-
he looks like a poof
and Family Guy FTW! :L
-
woo spongebob :D
(http://shinymedia.blogs.com/photos/uncategorized/spongebob.jpg)
-
spongeboobs
-
haha max :L nice one
-
She's got some stickers on her nipples lol
-
:L
-
[youtube]SWXcDZNgOWs[/youtube]
-
fucking nice and funny :L
http://theskunk.org/2009/08/congressman-legalizes-pot-for-himself/
-
lol
-
[youtube]http://www.youtube.com/watch?v=_tb_5Nn7-6w[/youtube]
-
Hmmmm kay
-
(http://i47.tinypic.com/16m90jt.jpg)
-
rofl that guy wanna die or what :L
-
[youtube]http://www.youtube.com/v/cf8a-32bDMo&color1=0xb1b1b1&color2=0xcfcfcf&hl=it_IT&feature=[/youtube]
-
http://www.youtube.com/watch?v=urq1L6a13uQ
-
hilarious
-
[youtube]L1BDM1oBRJ8[/youtube]
-
[youtube]
I think that this oranges got high ;D
rofl that guy wanna die or what :L
Maybe he is smoking unvisible joints ;D
Bobo heh ja na swoje urodziny kuchnie podjaralem :(
[youtube]
:(
-
(http://obczaj.net/obrazki/92656.jpg)
-
O kurwa Madmax very funny :D
Something from me :) Unbore doors :P
(http://img697.imageshack.us/img697/9536/defendius2doorlock.jpg)
-
(http://obczaj.net/obrazki/92464.jpg)
(http://obczaj.net/obrazki/92472.jpg)
-
[youtube]http://www.youtube.com/watch?v=_tb_5Nn7-6w[/youtube]
french style lol ;D
-
(http://obczaj.net/obrazki/92464.jpg)
haha :L
-
rofl
-
:o
[youtube]http://www.youtube.com/watch?v=PGlerZNyvEM[/youtube]
-
wtf
-
[youtube]http://www.youtube.com/watch?v=HbwAunLpYYw&feature=related#movie_player[/youtube]
-
http://www.jaimelegif.com/ (http://www.jaimelegif.com/)
Keep scrolling down :o
-
hm cool, poor chickens though :(
-
Im never coming back on this thread.
-
i didn't wanna see that lol
-
aww removed. :-\
Though it did hurt looking at it :L
-
aww removed. :-\
Though it did hurt looking at it :L
indeed. :o
-
lol I missed it
-
meh 2
-
Want to see it? I can send in pm :L
-
ive seen it thanks, probably Disturbed did see too.
Dont wanna see it again :L how did he let himself be put up like that :/
-
I didnt see it, pm me
-
[youtube]http://www.youtube.com/watch?v=b1aHP_ylxEU[/youtube]
-
I didnt see it, pm me
pm sent, lol
-
buahahahahahaha thats hilarious, stupid asshole XD
and fatal video (I think) not as fun as the pic HAHAHAHAHAHA
-
I knew you would come up with a comment like this :L
Thats sad, only sad.
-
Sent it to me too, i didnt saw it(whatever you were watching :o)
-
u sure? I mean its very fun, but some people might get shocked
-
[youtube]http://www.youtube.com/watch?v=b1aHP_ylxEU[/youtube]
Hooooly shit !!! :o
Epic fail indeed
-
haha nice
(http://media.ebaumsworld.com/2007/11/Hungry_Elephant.jpg)
-
literally smelling his ass
-
(http://obczaj.net/obrazki/93092.jpg)
-
Not it's intended reaction, but this advert always makes me lol
[youtube]K54-kgkPyek[/youtube]
-
[youtube]http://www.youtube.com/watch?v=TJRTg3Wau9M[/youtube]
-
Puta puta!! :L
-
[youtube]NMMFSCMR0Dc[/youtube]
its in spanish, but i think that u will know what hes doing!! LOL
[youtube]kWQVQl_Yz6k[/youtube]
-
haha spongebob is great!
-
[youtube]http://www.youtube.com/watch?v=wPzZRhE0hMI[/youtube]
-
lel
-
Some loops are boring but looolz
its in spanish, but i think that u will know what hes doing!! LOL
Cool porn :L
-
(http://www.macksimpson.com/adverb/images/doritos-japan-lg-x1x.jpg)
-
(http://winniewong.typepad.com/shelby/images/popsicle.jpg)
-
(http://obczaj.net/obrazki/93801.jpg)
-
(http://21.media.tumblr.com/tumblr_kwgvx3fGxc1qzh5gno1_500.jpg)
-
[youtube]http://www.youtube.com/watch?v=-_z8A_0NDfw[/youtube]
-
haha
-
Ballz!
Well lack of topic to post it at;
http://www.jasonepowell.com a different photography idea but blame we cant see whats behind the old picture lol
(http://www.findlove-keeplove.com/images/sign1.jpg)
-
(http://obczaj.net/obrazki/94051.jpg)
and this scene owns lol
'make the pencil disappear'
[youtube]http://www.youtube.com/watch?v=2KX3OriDpgg[/youtube]
-
ew!
-
Nice disappearance... But we dont see it as it is supposed to be not seen.Its magic. :L
Have you seen this ? A cool IV movie related to Fast and Furious series.
[youtube]http://www.youtube.com/watch?v=8kczuX-nXYI[/youtube]
Part 2 is way better in quality and quality (production)
[youtube]http://www.youtube.com/watch?v=JvptBXUvn0U&annotation_id=annotation_244069&feature=iv[/youtube]
-
(http://thelittlecriminal.files.wordpress.com/2009/06/power-rangers_turboranger1.jpg)
-
(http://obczaj.net/obrazki/94511.jpg)
-
|----------|
| looolzzzz!!!!!!!!!!!!!
|----------|
:L
-
i dont like "this is sparta" jokes.
-
I find them funny :L
-
(http://obczaj.net/obrazki/94556.jpg)
-
Nice disappearance... But we dont see it as it is supposed to be not seen.Its magic. :L
Have you seen this ? A cool IV movie related to Fast and Furious series.
[youtube]http://www.youtube.com/watch?v=8kczuX-nXYI[/youtube]
Part 2 is way better in quality and quality (production)
[youtube]http://www.youtube.com/watch?v=JvptBXUvn0U&annotation_id=annotation_244069&feature=iv[/youtube]
i already see that, i love that
with french speak, totally great
-
[youtube]http://www.youtube.com/watch?v=ieK1PTXmopE[/youtube]
-
:L
[youtube]http://www.youtube.com/watch?v=JjUTb6sOncM[/youtube]
-
[youtube]http://www.youtube.com/watch?v=S4ZO2FD4pNA&feature=channel[/youtube]
[youtube]http://www.youtube.com/watch?v=SFsHPFhtEYQ&feature=channel[/youtube]
[youtube]http://www.youtube.com/watch?v=gHCxdlZ7G18&feature=channel[/youtube]
[youtube]http://www.youtube.com/watch?v=lRefZf3gj74&feature=channel[/youtube]
-
:L
[youtube]http://www.youtube.com/watch?v=JjUTb6sOncM[/youtube]
It seems they are stoned lol
-
loooooool xD
ye I think they're stoned too :L
-
(http://obczaj.net/obrazki/94641.jpg)
(http://obczaj.net/obrazki/94659.jpg)
-
haha loool max nice one ;D
-
[youtube]qtmdGMPgU7I[/youtube]
-
(http://obczaj.net/obrazki/94954.jpg)
(http://obczaj.net/obrazki/95018.jpg)
(http://obczaj.net/obrazki/94803.jpg)
(http://obczaj.net/obrazki/94744.jpg)
(http://obczaj.net/obrazki/94773.jpg)
M4 is there lol
(http://obczaj.net/obrazki/94838.jpg)
-
hahaha nice pics max :L
-
Hey Malsyz, grab a bicycle for me!
Yes, windows are real.As you see. :L
-
[youtube]http://www.youtube.com/watch?v=J---aiyznGQ[/youtube] [youtube]http://www.youtube.com/watch?v=WHzhFyQTerc[/youtube]
(http://failblog.files.wordpress.com/2010/01/epic-fail-equality-fail.jpg) (http://failblog.files.wordpress.com/2010/01/epic-fail-music-store-fail.jpg) (http://failblog.files.wordpress.com/2009/12/epic-fail-paternity-fail.jpg)
(http://failblog.files.wordpress.com/2010/01/epic-fail-restaurant-name-fail.jpg) (http://failblog.files.wordpress.com/2010/01/129083784614900617.jpg) (http://failblog.files.wordpress.com/2009/11/129029888861085838.jpg)
(http://failblog.files.wordpress.com/2010/01/129079664876819920.jpg) (http://failblog.files.wordpress.com/2010/01/129075471915707086.jpg) (http://failblog.files.wordpress.com/2009/12/epic-fail-playpen-fail.jpg) (http://failblog.files.wordpress.com/2009/12/epic-fail-toy-missile-launcher-fail.jpg)
-
lmao :L
-
(http://failblog.files.wordpress.com/2010/01/129079664876819920.jpg)
gross lol
-
are u hungry?
[youtube]http://www.youtube.com/watch?v=27NX_MMIkLY[/youtube]
-
old ;D
-
Watch this video to the end pls. ;)
http://www.worktobejudged.com/strippause/peca.html
-
Didnt let me see deeper :L
-
haha asshole :D
-
:@
-
:D :D :D
[youtube]http://www.youtube.com/watch?v=YXrU1GFqYEU&feature=related[/youtube]
-
today morning im going to work open metro (news paper) in underground and i see this on the 1st page!
(http://files.uploadffs.com/d/d/c0c2db08/DSC00015.JPG)
-
hahaha loooool :L
-
Wtf is this thing ? :L
-
its most sad looking fish in the world xD
-
What kind of fish is that :O Maybe it's from Chernobyl :L
-
it's lilrunty haha!
-
http://www.ccll.org.uk/ho/
im a chernobyl child i was born in the middle east poland 46 days before explozion. (BUT IM FINE xDDDDD)
-
LOL the metro, its a good paper sometimes ^^
-
(http://files.uploadffs.com/d/c/2eeac67f/Photo_0300.jpg)
xDDD
-
lol this
-
(http://obczaj.net/obrazki/95668.jpg)
-
OMG! That weird looking thing , Its... A..... BLOBFISH! :o
-
(http://obczaj.net/obrazki/95668.jpg)
hehehe
-
http://www.ccll.org.uk/ho/
im a chernobyl child i was born in the middle east poland 46 days before explozion. (BUT IM FINE xDDDDD)
I think i killed your uncle in S.T.A.L.K.E.R.
Sorry!
-
OMG! That weird looking thing , Its... A..... BLOBFISH! :o
blobfish ftw!
(http://smackamack.files.wordpress.com/2009/03/psyphrthree.jpg)
(http://www.whaletimes.org/Courtesy%20of%20NOAA%20MBARI%202002%20EJB_052202_034.jpg)(http://1.bp.blogspot.com/_u3jJqwb8ieY/SajHv_03xDI/AAAAAAAAAII/xMhVIo4udtw/s1600/2787625749_8407a7a8fd.jpg)
-
lol max the bottom 1 looks like you :o
-
lol i cant eat that
(http://files.uploadffs.com/d/b/27cdb9e3/Untitled2.png)
-
ugly fish lol
-
(http://i49.tinypic.com/153liqo.jpg)
-
loool
(http://files.uploadffs.com/d/2/e71a2f0d/DSC00892.jpg)
-
:D
-
haha :L
-
xD ;D
-
rofl
-
i had to get rid of the damn buttons.
(http://files.uploadffs.com/d/6/15aa600d/DSC00897.JPG)
-
lol m4, you and your wondering fingers :P
-
(http://i48.tinypic.com/rstn36.jpg)
-
This is funny sound! hahahaha WATCH THE WHOLE VIDEO!!! xD ;D
[youtube]p01fm0r2rBc[/youtube]
i love brasilian girls :D they always are horny LOL
-
(http://img99.imageshack.us/img99/4738/zabka.th.jpg) (http://img99.imageshack.us/i/zabka.jpg/) I stick this frog on mirror in T4 of my friend :D
-
How did he react :L
-
just laugh and then romove it :D
-
[youtube]http://www.youtube.com/watch?v=wBDm47kxyik[/youtube]
might be old, lol.
-
hah :L
-
Epic :L
-
[youtube]http://www.youtube.com/watch?v=v1m8a4Jl4ZI&feature=related[/youtube]
-
lmao :D :D
-
;D HAHA PWNED
-
;D
[youtube]http://www.youtube.com/watch?v=OhwhPhss-QE[/youtube]
-
(http://i5.photobucket.com/albums/y194/Barnze/wanker.gif)
-
M-M-M-M-MONSTER POST...
(http://img.moronail.net/img/2/6/2626.jpg)
(http://img.moronail.net/img/0/9/2609.jpg)
(http://img.moronail.net/img/0/8/2608.jpg)
(http://img.moronail.net/img/0/5/2605.jpg)
(http://img.moronail.net/img/0/4/2604.jpg)
(http://img.moronail.net/img/9/5/2595.jpg)
(http://img.moronail.net/img/7/9/2579.jpg)
(http://img.moronail.net/img/6/0/2560.jpg)
(http://img.moronail.net/img/5/9/2559.jpg)
(http://img.moronail.net/img/4/5/2545.jpg)
(http://img.moronail.net/img/3/7/2537.jpg)
(http://img.moronail.net/img/3/3/2533.jpg)
(http://img.moronail.net/img/2/0/2520.jpg)
(http://img.moronail.net/img/0/9/2509.jpg)
(http://img.moronail.net/img/9/7/2497.jpg)
-
Great pics :L
-
Heh yeah, that Polish remover is epic :L
-
Heh yeah, that Polish remover is epic :L
haha loool I was looking at it but didn't notice poland was gone :L :L
-
Same lol.I felt like something was moved and map rotation has changed :L
-
Without Poland Europe would be better. Baltic would rule more :L
-
Europe will not exsist without Poland, it there was no Poland Hitler could get whole Europe and everyone will speak german lol
-
tbh, russian winter stopped german troops and they got killed (sent back to Germany ;D ) :P
-
Europe will not exsist without Poland, it there was no Poland Hitler could get whole Europe and everyone will speak german lol
He got Poland in 1939 already.. I don't see the point in what you're telling. If America/British didn't save us from Hitler Russia would took over whole Europe as far as possible...
Ooohh... Poland thinks that pedobear is a olympic mascot :L
(http://i48.tinypic.com/2cp3nrb.jpg)
-
If that's real, I want to shake the hand of whoever snuck it in there. :D
-
Without Poland Europe would be better. Baltic would rule more :L
your poor cuntry was in ZSRR :L
-
USSR*
-
(http://www.johnserra.com/CCCP.gif)
-
(http://files.uploadffs.com/d/2/3fb521b7/sorrybus.jpg)
(http://files.uploadffs.com/d/6/ac246f6a/hitmanmonkey.jpg)
-
(http://obczaj.net/obrazki/97821.jpg)
-
LOL @ TEH HORSE XD ;D
-
lool :L
-
HORSE = WIN.
(http://i36.tinypic.com/nox9ub.jpg)
-
haha :L
-
(http://gijss.web-log.nl/photos/uncategorized/2008/08/30/l8303027_wesp.jpg)
-
LOL @ the tard!! :L :L
http://mojevideo.cz/view.php?id=4898
-
Same person has one more retarded beatbox.More retarded than this :L
-
(http://files.uploadffs.com/d/8/04098eb5/funnydogpicturesspotdog.jpg)
-
(http://files.uploadffs.com/d/8/04098eb5/funnydogpicturesspotdog.jpg)
wtf :L
-
women do spot my hotdog :D
-
(http://files.uploadffs.com/d/8/04098eb5/funnydogpicturesspotdog.jpg)
lmao :L :L
-
(http://cdn2.knowyourmeme.com/i/1748/original/577px-Pedobear_17.jpg)
-
(http://img194.imageshack.us/img194/2287/freecandyvan1.jpg)
-
OMG REAL LIVE BOOMER :o :o :o
(http://media.ebaumsworld.com/picture/boc1500/FreeCandy.png)
-
BOOMER!
-
^omg lol
(http://pix.motivatedphotos.com/2009/11/23/633945960575635740-freecandy.jpg)
[youtube]http://www.youtube.com/watch?v=5eXsSluPNxY[/youtube]
[youtube]http://www.youtube.com/watch?v=Pdoe-fvrHfc[/youtube]
-
Chicken opera ;D ;D
[youtube]http://www.youtube.com/watch?v=K2EMPi_a59A&feature=related[/youtube]
MooMan
[youtube]http://www.youtube.com/watch?v=-QVmaeh0bUw&feature=related[/youtube]
Can you do thaT?
[youtube]http://www.youtube.com/watch?v=S3oscd_CLTI&feature=related[/youtube]
-
I like to MOO MOO you like to MOOOOOOOO :L
-
(http://obczaj.net/obrazki/98702.jpg)
(http://obczaj.net/obrazki/98705.jpg)
(http://obczaj.net/obrazki/98706.jpg)
(http://obczaj.net/obrazki/98708.jpg)
(http://obczaj.net/obrazki/98709.jpg)
(http://obczaj.net/obrazki/98710.jpg)
(http://obczaj.net/obrazki/98711.jpg)
(http://obczaj.net/obrazki/98712.jpg)
(http://obczaj.net/obrazki/98714.jpg)
-
woooo, hardcore >:(
-
(http://files.uploadffs.com/d/c/c917cdbb/dirtymind.jpg)
(http://files.uploadffs.com/d/1/d2cd109c/1244731503.jpg)
(http://files.uploadffs.com/d/c/5cecc662/1251193930.jpg)
(http://files.uploadffs.com/d/7/427f71f7/1251194007.jpg)
(http://files.uploadffs.com/d/1/5a29130d/htmlcoder.jpg)
(http://files.uploadffs.com/d/5/42f05cca/mommy.jpg)
(http://files.uploadffs.com/d/a/88e9ac68/cows.jpg)
-
funny must be my alter ego :L
-
(http://i48.tinypic.com/sfwm55.jpg)
-
Snoopy's avatar is epic. (http://files.uploadffs.com/d/5/fd755960/timewarpwaterballoon.gif)
-
Snoopy's avatar is epic. (http://files.uploadffs.com/d/5/fd755960/timewarpwaterballoon.gif)
Time warp
-
1 second in 5 seconds with 200fps FTW :L
@Max hmm... Riot! :L
Bus is epic lol
-
Ckicken techno
[YOUTUBE]http://www.youtube.com/watch?v=8VxJV9hKonQ&feature=related[/YOUTUBE]
-
awesome pics max lol
-
mdr ça passe en pub à la télé celle la? (asking to falco if this one is an ad on tv in france)
-
[youtube]http://www.youtube.com/watch?v=H6IeASZZf1c&feature=fvst[/youtube]
enjoy :D
-
hahahahahhah ;D
-
Win. ;)
-
mdr ça passe en pub à la télé celle la? (asking to falco if this one is an ad on tv in france)
pas celle la, mais celle de l'opéra oui
-
:L
Mosque made of weapons.
(http://www.geenstijl.nl/archives/images/moskeewapen.jpg)
-
lol :L
(http://i49.tinypic.com/14xnsb7.jpg)
-
original:
(http://teflon.files.wordpress.com/2009/01/nice_big_cup_of_stfu.jpg)
-
Stupid cat
[youtube]http://www.youtube.com/watch?v=wY6wGOxSRV8[/youtube]
[youtube]http://www.youtube.com/watch?v=kFDKz7WskNU&feature=related[/youtube]
-
1st video ftw.
;D
-
[youtube]4_pS46YRMIQ[/youtube]
It has to be a spoof.....surely?
Edit - Clearly not a spoof. Dear god!! There is more:
[youtube]8NZBxwjcwMc[/youtube]
And one more link:
http://www.watkykjy.co.za/2010/02/die-antwoord-vs-enya-orinoco-ninja-flow-wedding-djs-remix/
This has a 'cover' of Enya - Orinoco Flow by them which has amazingly funny/fucked up lyrics.
-
i love crazy cats
[youtube]http://www.youtube.com/watch?v=rutbA5nmwuc&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=o_O969rkLPg&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=e8F9txsHzQI&feature=related[/youtube]
-
[youtube]1VAV-o3Ld0U[/youtube]
-
@ simon, that dude is fucking freaky :o
-
(http://fitjohnny.files.wordpress.com/2009/06/hater.jpg)
-
(http://files.uploadffs.com/d/f/b825fdbe/jump.jpg)
-
If she did jump, others would jump over again cause of her little earth quake.
-
(http://files.uploadffs.com/d/f/b825fdbe/jump.jpg)
1st picture - 10 girls
2nd picture - only 9
lol
-
ahah indeed, epic fail
-
Hmm not careful enough :( I knew something was strange with zoomed picture :L
-
@Killerbunnies: I can't believe I actually watched that. :D
-
@Epoxi, lol!! i love those british videos XD check the relatives videos on youtube ROFLMAO
[youtube]d2pB3QNvziU[/youtube]
[youtube]g4-8-bldLs4[/youtube]
[youtube]hriTDaIJ4Go[/youtube]
-
@ simon, that dude is fucking freaky :o
Indeed! ha ha
-
@ bunnies, @ first video, @ 1:30 :L
-
[youtube]Phyg_uIPQII[/youtube]
Classic, but totally freaky music video:
[youtube]Pe-XNav5mWU[/youtube]
-
[youtube]http://www.youtube.com/watch?v=-GNnftq744I[/youtube] lol :D
-
Thats just... just... just... epic! :L
-
Haha, agree Love :D
-
(http://28.media.tumblr.com/tumblr_kv14daeRet1qzxds1o1_500.jpg)
(http://i.imgur.com/JPx1G.jpg)
-
Haha nice :L
-
looool :L "i licked the icing of the sofa" :L
-
:L :L
-
L4D'ers check out :L
[youtube]http://www.youtube.com/watch?v=CVRoXPAhpfg[/youtube]
-
(http://s2.postimage.org/R1Dl0-2940cc9c3f73d1a2018b47f324f33f49.jpg)
-
OWNED LOL
(http://www.dailyhaha.com/_pics/facebook-hookup.jpg)
-
Thats a real ownage now... :L
-
hahaha that dude pwnt himself :L
aaaaaaaahhh I love charlie the unicorn
[youtube]http://www.youtube.com/watch?v=DgXy0fquj2g[/youtube]
-
Guess thats not going to create a hot topic in here :L Weird ad lol
-
OWNED LOL
(http://www.dailyhaha.com/_pics/facebook-hookup.jpg)
hahahahahha lololololololol
-
http://www.facebook.com/video/video.php?v=343003335475&ref=nf
This is art... :P
-
now there's a tiger i'd like to get bitten by :L
-
OWNED LOL
(http://www.dailyhaha.com/_pics/facebook-hookup.jpg)
hahahahahahahahahahahahahahahahahaha :L
-
now there's a tiger i'd like to get bitten by :L
rawr
-
[youtube]http://www.youtube.com/watch?v=k4C1lnVq_OE[/youtube]
-
ftw haha
-
http://www.facebook.com/video/video.php?v=343003335475&ref=nf
This is art... :P
what about this art? :P
(http://i45.tinypic.com/1zg6kh3.jpg)
sketch in bottom si mine...top one is my friend
-
Nice sketch. You should put it on a wall. ;)
Took one look at this, I could not stop laughing...
[youtube]UUgCm7HYJwU[/youtube]
And for you VC fans...
(http://img64.imageshack.us/img64/9246/catbus.gif)
-
lol
-
omg that pikachu mod owns :L
-
what about this art? :P
[]http://i45.tinypic.com/1zg6kh3.jpg[
sketch in bottom si mine...top one is my friend
Woop nice work too! I love the pictures look so fulfilled with a life.Wonder if i managed to tell what i wanted. :L
-
cat bus :L
-
http://www.facebook.com/video/video.php?v=343003335475&ref=nf
This is art... :P
what about this art? :P
(http://i45.tinypic.com/1zg6kh3.jpg)
sketch in bottom si mine...top one is my friend
Very cool.
-
(http://obczaj.net/obrazki/100874.jpg)
(http://obczaj.net/obrazki/100900.jpg)
(http://obczaj.net/obrazki/100902.jpg)
-
Guess thats not going to create a hot topic in here :L Weird ad lol
What exactly is Hot Topic? Didn't the kids from South Park burn it down?
-
I dont know anything about that, just a variant from "hottopic.com"
Holyweed lol
-
:o
░█▀▀ ░█▀█ ░█ ░█▀▀ ░░█▀▀ ░█▀█ ░█ ░█
░█▀▀ ░█▀▀ ░█ ░█ ░░░░█▀▀ ░█▀█ ░█ ░█
░▀▀▀ ░▀ ░░░▀ ░▀▀▀ ░░▀ ░░░▀░▀ ░▀ ░▀▀▀
[youtube]http://www.youtube.com/watch?v=V77sHgqzWZk[/youtube]
-
what the.... :o
-
awwww BLAH! that's really disgusting picture
-
holy shit hahaha I would puke if I ever see that in a chicken box
-
Hahah looooool :L :L
[youtube]http://www.youtube.com/watch?v=7ZRMECFe5Ko[/youtube]
-
Don't like the music but the rest is great :L :L
-
Yeah, only germans can start a World War :L
-
Hahhaha epic shit. :L
-
[youtube]http://www.youtube.com/watch?v=9VYLCP0JeIU[/youtube]
-
[youtube]http://www.youtube.com/watch?v=smVE7C6m9NY[/youtube]
-
(http://obczaj.net/obrazki/101610.jpg)
(http://obczaj.net/obrazki/101612.jpg)
(http://obczaj.net/obrazki/101613.jpg)
-
American football in france... ya we still have to learn a bit?
[youtube]http://www.youtube.com/watch?v=7_VTH52TGOQ[/youtube]
And the French.... ROCKY BALBOA !!
[youtube]http://www.youtube.com/watch?v=hqOBR_Xbw2I[/youtube]
-
Can anyone translate this? :L :L :L
[youtube]http://www.youtube.com/watch?v=4_o47Gs6DQ0[/youtube]
-
lol, ask cysio
-
(http://obczaj.net/obrazki/102061.jpg)
-
lool :D
-
why would anyone make such a piece of crap :L
-
[YOUTUBE]http://www.youtube.com/watch?v=9XkfCEtw84s[/YOUTUBE]
-
[YOUTUBE]http://www.youtube.com/watch?v=9XkfCEtw84s[/YOUTUBE]
el chile habanero es picoso, pero hay otros mas picosos que esos, hay unos mas chiquitos como pildoras, son lo doble de picosos....
vengan a mexico y prueben los verdaderos chiles!! XD
-
TRANSLATION PLZ ???
-
Abandoned by humans.. looks creepy
(http://upload.wikimedia.org/wikipedia/commons/b/b3/Streetcar-SRM.jpg)
-
omfg loooooooool hahahahahaha LMAOOOOOO that's fuckin hilarious :oooooooooooooooooooooooooooooo
i cant stop laughin :L :L :L :L :L :L :L :L :L :L
-
this is awful :'(
-
couldn't find a topic for it :L
-
fast shit lol, it is so fucking fast, can't even see it clearly
[youtube]http://www.youtube.com/watch?v=VPmwx6A5sqY[/youtube]
-
lol kewl
-
Pushing up to 3 laps/sec :o
*that fly is annoying me...
-
it is a fake look at the bird speed :P they also accelerate :P:D
-
(http://i39.tinypic.com/1z4liyp.jpg)
-
haha ^ :L
----------
(http://i.imgur.com/GxzeV.jpg)
-
I don't even insert the dvd as pirate :D
-
Joe Lajoie ftw :L
[youtube]http://www.youtube.com/watch?v=AE4zF36dPxE[/youtube]
-
crazy people :L
-
Chorus guy lol
-
I rather pass by and see MC Porn fly :D
-
hahahahaha
-
(http://roflrazzi.files.wordpress.com/2010/01/celebrity-pictures-mel-gibson-braveheart-roasting-marshmallows.jpg)
(http://roflrazzi.files.wordpress.com/2008/09/david-hasselhoff-yes-the-wall.jpg?w=418&h=600)
(http://roflrazzi.files.wordpress.com/2008/09/patrick-stewart-for-the-last-time-geordi.jpg?w=499&h=328)
(http://failblog.files.wordpress.com/2010/01/129079719418109561.jpg)
(http://failblog.files.wordpress.com/2010/01/epic-fail-pet-store-fail.jpg)
(http://failblog.files.wordpress.com/2010/01/129079003197262718.jpg)
(http://thereifixedit.files.wordpress.com/2010/01/129085472022400149.jpg?w=494&h=345)
(http://punditkitchen.files.wordpress.com/2010/01/political-pictures-ron-paul-shoes-fabulous.jpg)
(http://punditkitchen.files.wordpress.com/2010/01/129067186596049056.jpg)
(http://ihasahotdog.files.wordpress.com/2010/01/funny-dog-pictures-satelite-upload.jpg)
(http://icanhascheezburger.files.wordpress.com/2008/01/funny-pictures-emo-wall.jpg)
(http://www.zwani.com/graphics/funny_pictures/images/funny-pictures247.jpg)
(http://www.andromada.net/forum_files/fly.jpg)
-
lol
(http://i40.tinypic.com/2v19ppy.png)
-
lol @ the flies :L
-
Todays lol meal is from Nobody, thanks for the tasty lols.If i knew who posted it... Id hug him, but nobody knows it... :L
-
haha the flies :L
-
Precious = chair
(http://kibeloco.com.br/files/104/2010/03/Precious-Poltrona.jpg)
10 shirts that people should not use :P
(http://kibeloco.com.br/files/104/2010/03/10-camisas.jpg)
curling :D
(http://kibeloco.com.br/files/104/2010/02/curling-Brasil.jpg)
Thief gets stuck in chimney trying to break into restaurant
(http://kibeloco.com.br/files/104/2010/02/bandido-chamine.jpg)
DUCK IN CLUBBING OF STRIP-TEASE
(http://colunas.globoesporte.com/files/89/2010/02/2el84ux.jpg)
-
(http://26.media.tumblr.com/tumblr_kz1bts5ILs1qai2kao1_500.jpg)
-
[youtube]http://www.youtube.com/watch?v=zuVsLR_2GX0[/youtube]
-
(http://26.media.tumblr.com/tumblr_kz1bts5ILs1qai2kao1_500.jpg)
I'd like to have a lil' meal with her ;)
-
lil' Meal ???
YOU'D eat her as the MEAL :L
-
(http://26.media.tumblr.com/tumblr_kz2nffWp2c1qzh5gno1_100.gif)
-
:L
-
haha dirty vertigo
-
(http://motogpworld.net/wp-content/uploads/2009/09/objects.jpg)
-
unless they're doing laps
-
(http://www.netstate.com/states/mottoes/images/ca_eureka.jpg)
-
[youtubeHD]DD5UKQggXTc[/youtubeHD]
-
rrrrrrrrrrrrrrrrrrrrreeeeeeeeeeppooosst!
-
falky you sly little...
(http://img.moronail.net/img/6/4/2864.jpg)
-
I remember that, was flying over Greenland to test out the new set of F-22's flying capabilities under freezing conditions.
-
I remember that, was flying over Greenland to test out the new set of F-22's flying capabilities under freezing conditions.
It always freezes if you go high enough up in the troposhere. In fact, above Greenland the temperature decreases less as above the equator.
-
(http://obczaj.net/obrazki/104589.jpg)
(http://obczaj.net/obrazki/104614.jpg)
-
Ahahah I lolled at both of them :L :L
-
hah :L
-
:) WTF at driving test one. Here in the UK it's other way around.
/failed twice
-
Lies. Skin colour has nothing to do with it.
These people who take off the exam are always grumpy old men.. blegh, I failed first time because he was grumpy.. 2nd try he was in good mood(I had same guy again, coincidence).. and I passed!
-
[youtube]http://www.youtube.com/watch?v=cGXvliz3PJ4[/youtube] anyone can translate what they saying? I think it's serbian or some other slavic language.
[youtube]http://www.youtube.com/watch?v=b67bP9CroZc[/youtube]
-
Bosnia or something..
-
:L
(http://boxothoughts.files.wordpress.com/2008/07/mao-zedong.jpg)
-
(http://img185.imageshack.us/img185/6175/1212g.jpg) (http://img185.imageshack.us/i/1212g.jpg/)
-
lol nice edit
-
Skin colour has nothing to do with it.
Yeah, you're right actually, I was being a penis. To be fair the DSA is probably the most uncorrupted organisation ever. If you threatened to kill their family they'd still probably fail you.
(http://213.186.58.23/wp-content/uploads/2010/03/Paddys-Day_english.jpg)
-
woo today my day St Patrick :-X
-
:) im there!
-
;D
-
(http://27.media.tumblr.com/tumblr_kzb3qs9S2f1qa6hcco1_500.jpg)
-
Hahah I remember that when I still played with LEGO.
-
(http://26.media.tumblr.com/tumblr_kzfl0pElWn1qzxzwwo1_500.jpg)
-
hah haven't seen that one before :L
-
haha @ 1:00 lol
-
Click here to feed me i am starving !
-
nice : D
-
BOOMER!!!!!!
(http://26.media.tumblr.com/tumblr_kzfl0pElWn1qzxzwwo1_500.jpg)
-
Click here to feed me i am starving !
Where
-
[youtube]uCPdI_jSamE[/youtube]
LOL, you have to watch this. Pitbull punches a guy in the face in the middle of the video, and doesn't miss a beat.
-
(http://obczaj.net/obrazki/105956.jpg)
(http://obczaj.net/obrazki/105912.jpg)
(http://obczaj.net/obrazki/105852.jpg)
-
lol @ the first one :L
-
(http://photos-d.ak.fbcdn.net/hphotos-ak-snc3/hs163.snc3/19057_1235236556599_1099750826_30620798_4327779_n.jpg)
(http://citynoise.org/upload/940.jpg)
-
haha;d
-
lol
(http://i44.tinypic.com/vqia07.jpg)
-
(http://i.imgur.com/UvOr8.gif)
-
[youtube]http://www.youtube.com/watch?v=97ejk5NOrR8&feature=related[/youtube]
toot-tone giant size:
(http://www.artofthestate.co.uk/photos/Swiss_Re_tower_vert.jpg)
[youtube]http://www.youtube.com/watch?v=nojWJ6-XmeQ&feature=related[/youtube]
-
[youtube]CG7g-EDR8C8[/youtube]
[youtube]HxNODdxg2iY[/youtube]
-
:L
[youtube]http://www.youtube.com/watch?v=Qq8Uc5BFogE[/youtube]
-------------
This is where I'm going with my class on excursion this April :D
http://www.sovietbunker.com/en/
It's the only bunker like this in whole Europe. Watch the video please :L
-
[youtube]http://www.youtube.com/watch?v=aoRD1wmvwUc[/youtube]
-
[ youtube ] link [ /youtube ]
Old but still funny, shame about the quality but I couldn't find a better link. Probably posted before too, oh well. Worthy of a laugh.
[youtube]http://www.youtube.com/watch?v=9rXq71all4Y[/youtube]
[youtube]http://www.youtube.com/watch?v=9rXq71all4Y[/youtube]
-
lolol
-
what cellphone you got sheep?
-
er one that rings, lol idk its a shitty nokia
-
woo
nokia 6300, yeah that one is old.
-
(http://photos-h.ak.fbcdn.net/hphotos-ak-snc3/hs428.snc3/24666_401884983091_401884418091_4987962_4049910_n.jpg)
-
[ youtube ] link [ /youtube ]
Old but still funny, shame about the quality but I couldn't find a better link. Probably posted before too, oh well. Worthy of a laugh.
[youtube]http://www.youtube.com/watch?v=9rXq71all4Y[/youtube]
lol.Especially Toyola made me laugh :P
-
(http://30.media.tumblr.com/tumblr_kzvrt4wbxZ1qzjbm1o1_400.jpg)
-
[youtube]http://www.youtube.com/watch?v=itYyM4Y9ydE[/youtube]
I laughen everytime
-
wtf lol
-
[youtube]http://www.youtube.com/watch?v=VTO5yiN1b-I[/youtube]
[youtube]http://www.youtube.com/watch?v=7xJC0Z68Eps[/youtube]
-
lmao lol ^
[youtube]http://www.youtube.com/watch?v=TkMh-WaWMJo[/youtube]
[youtube]http://www.youtube.com/watch?v=fkgeK0o7fJc[/youtube]
[youtube]http://www.youtube.com/watch?v=r3F73LWWyLQ[/youtube]
-
rofl, 1st one was best.
-
looooool
[youtube]http://www.youtube.com/watch?v=C3saXCfYv74&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=ciI2AqwWAbY&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=L19HrJmtvXc&feature=related[/youtube]
-
LMFAO
-
[youtube]http://www.youtube.com/watch?v=ZN5PoW7_kdA[/youtube]
-
:L :L :L
-
lol
(http://files.uploadffs.com/a/1/2bb41f9c/t4e6.jpg)
-
online?
-
hahah m4 is driving backwards
-
[youtube]http://www.youtube.com/watch?v=G8nQ4YwF16M[/youtube]
-
(http://img.moronail.net/img/8/0/3380.jpg)
-
That reminds me of this: http://worlds-highest-website.com/
:D
-
(http://files.uploadffs.com/a/3/ff8135b6/25880_105184982849579_100000742343685_101455_1513877_n.jpg)
-
WTF!?!?!?!?! what means debil?????
debil means Weak in spanish...
what means debil in polak or english?? :S im puzzled
-
retard :L
-
(http://www.cowc.org/files/WooBus%20logo1.JPG)
-
(http://files.uploadffs.com/a/8/13e780fb/tumblr_l03v80ZqHI1qae091o1_500.jpg)
-
:o
-
Hahah and everytime he lies his nose gets longer :o
-
Hahah and everytime he lies his nose gets longer :o
Lies down in bed with someone you mean.
-
lolol with some dude
-
@ falky: OH SNAP!
-
[youtube]http://www.youtube.com/watch?v=yc86ZXFsriM[/youtube]
-
What a mouthful!
[youtube] http://www.youtube.com/watch?v=u4Okn36sGoU&feature=related [/youtube]
TheLastAirbender
-
I was thinking 'keep it clean man' before i actually watched the video D: :x
-
(http://27.media.tumblr.com/tumblr_l03x3xVo2v1qaobbko1_400.jpg)
-
http://www.youtube.com/watch?v=O43v4ix6FEQ
-
OMGWTFBBQ
-
Wtf lol
Isn't that from Terminator 2? :L
-
it is
-
wtf I need to watch that movie again, cant remember that part
-
(http://www.buyyourall.com/images/mobilephone/snoopy%20mobile%20phone_1.jpg)
-
:L :L :L :L :L
-
haha :D
-
lol :L
-
[youtube]686paGax_eg[/youtube]
-
parking fail
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc3/hs406.snc3/24606_375260772741_108818807741_3850482_476652_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash1/hs446.ash1/24606_375260767741_108818807741_3850481_6092482_n.jpg)
car fell off parking lot up the hill
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash1/hs444.ash1/24503_404315862958_708217958_5090206_4637062_n.jpg)
-
!!!! :DDD
http://www.noelshack.com/uploads/P0rnsexy038488.swf
-
[youtube]http://www.youtube.com/watch?v=LkYfxw2ZXYg[/youtube]
-
loool wtf, that' crazy :L
-
http://roosterteeth.com/archive/episode.php?id=1199
lol nice
-
http://www.creepygif.com/images/full/922.gif
-
(http://www.creepygif.com/images/full/922.gif)
Can't see it :-X
-
Hm strange, worked before..
http://www.creepygif.com/images/full/922.gif
look there to see Apple fans!
-
It's still the same -___-
-
heh wtf, it was working for me.. and now its not again, argh leave it. Crap site.
lol, it doesn't even work on their own site for me.. lol.
http://www.creepygif.com (its below on the 1st page)
-
they can tell what page you're loading it from. if you load it from here, then it gets blocked. if you load it from there, it loads. buuuuuuuut your browser caches images so it doesn't have to load them again ang again so you can post it here and since your browser already has it loaded from there, it's not blocked but only for you. and if you load it from here and go there, it'll still be blocked until it's deleted from your cache
-
(gayy)
-
(http://obczaj.net/obrazki/109587.jpg)
(http://obczaj.net/obrazki/109438.jpg)
(http://obczaj.net/obrazki/109439.jpg)
(http://obczaj.net/obrazki/109440.jpg)
-
(http://imgur.com/gBjlO.jpg)
-
lmfao
-
lol quality
-
lol @ last one
-
(http://29.media.tumblr.com/tumblr_l0j62iqG5g1qagpgbo1_500.png)
-
haha common problem :L
-
caves was annoying too
-
lolol
-
(http://i.imgur.com/AzoqK.jpg)
-
lmao!
-
lol! xD
-
[youtube]http://www.youtube.com/watch?v=yGeuiZr-u50[/youtube]
-
[youtube]TKfwnXQ6PY4[/youtube]
[youtube]ZmndyXG--UU&NR=1[/youtube]
________________________________________________________
these are not funny but i like it :)
[youtube]9LXknb3GOAU[/youtube]
[youtube]qAsbneT7Dgk[/youtube]
-
Dancin' Hitler
[youtube] http://www.youtube.com/watch?v=1do0JI-JG4M [/youtube]
You are watching state-sponsored North Korean television. It's Kim Jong il Friday. Thank God, it's mandatory. Watch or you will be thrown in the Pokchong River!
[youtube] http://www.youtube.com/watch?v=k_-Ik98poTg [/youtube]
You are watching state-sponsored North Korean television. You can change the channel, but you get the same thing.
[youtube] http://www.youtube.com/watch?v=XIA-kSzd7-8&feature=related [/youtube]
A military parade to honor our Eternal President Kim il-Sung
[youtube] http://www.youtube.com/watch?v=7cPb45tzgdQ&feature=related [/youtube]
Thanksgiving Parade...
[youtube] http://www.youtube.com/watch?v=jbCz-btE7Tk&feature=related [/youtube]
-
That 8-bit video is FREAKING AWESOME.
-
yep
-
:o
-
Where is your God now?
http://www.fail.com.mx/youtube-videos-de-risa-en-espanol/epic-fail-ninos-bailando-reggaeton-perreo-videos-chuscos/
Sorry, I couldn't embed it.
-
wtf :L
-
jesus fuckin christ, we gotta kill all those reggaeton bullshit star wannabe, put a huge electric dildo in their asses and fry them motherfuckers. Fuck reggaeton and everything it stands for
-
"New York Gets Destroyed 8-bit Style VIDEO" awesome
[youtube]cgwxXKsZhAo[/youtube]
[youtube]nxM1cnphLpw[/youtube]
-
jesus fuckin christ, we gotta kill all those reggaeton bullshit star wannabe, put a huge electric dildo in their asses and fry them motherfuckers. Fuck reggaeton and everything it stands for
You'll have to go through me first. RAAAAAAAAAAAAAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGGGGGGGGGGHHHHHHHHHHH.
(http://i.imagehost.org/0256/pol.jpg)
-
This is called daggeren(in dutch but probably also anywhere else).
I don't hate the dance haha, would love if a girl did that with me. But children doing this is gross.
-
Your watching state-sponsored North Korean television. Get it on or die!
[youtube] http://www.youtube.com/watch?v=NtVIUs511to [/youtube]
At the peak of the fearful relationship between North Korea and America, we have found this video.
North Koreans made this video as a protest against America. They made this in South Korea and broadcast it on a TV news show.
[youtube] http://www.youtube.com/watch?v=kZEQRZiGZo0 [/youtube]
FUCK'N USA
Bush evil! Bush evil!
We clearly remember the blood and tears we shed.
And you were the cause of our country's division.
FUCKING USA!
And we won't forget all of the horrible massacres.
You are a country of murderers.
FUCKING USA!
But if America is such a righteous country,
then why can't we say what we want to say?
Have you, you made us into slaves of our own precious land?
So now we are yelling!
WE ARE AGAINST AMERICA!
You stole the Olympic gold medal from us.
You are a dastardly thief.
FUCKING USA!
You have the ability to steal everything and go on a rampage.
You are a monstrous thief.
FUCKING USA!
Did you hear Bush's violent threats?
Such an audacious country!
FUCKING USA!
You threaten war in North Korea and intrude our internal affairs.
You are a country of gangs.
FUCKING USA!
But if America is such a beautiful country,
then why can't we say what we want to say?
And we're worried about what kind of damage we could get from America.
So now we are yelling!
YANKEE GO HOME!
-
who is this fuckin retard?
-
Thelastairbender also known as thelasthomo.I'm sick of his north korean crap :L
-
I thought people were paid to be on that stupid guy side, but I see he is followed by extremely ignorant people, they really need help, hope they notice they are in hell
-
(http://i.imgur.com/Rzz0K.jpg)
-
[youtube]http://www.youtube.com/watch?v=jspubRgyfj4[/youtube]
-
Noob dad ;D
-
Haha :L
-
hahaha that was funny
-
[youtube]http://www.youtube.com/watch?v=_MgARhy18_Q[/youtube]
-
DOODOOCACA's song
[youtube]IJ1D0A3Ns30[/youtube]
if you dont know it, this the original doodoocaca peepee
[youtube]q5NO0_qIunE[/youtube]
-
doodoocaca song, I nearly fell asleep, original video, I almost died laughin
-
[youtube]http://www.youtube.com/watch?v=_MgARhy18_Q[/youtube]
rofl :L
-
Awww, poor guy.
-
[youtube]http://www.youtube.com/watch?v=_MgARhy18_Q[/youtube]
rofl :L
lmfao
-
;D
(http://i42.tinypic.com/24q8rix.jpg)
:P
(http://i43.tinypic.com/k2g39s.jpg)
ouch hard
-
(http://i42.tinypic.com/24q8rix.jpg)
wow ive never seen that one before... LOL!
-
lool then you have much drink
(http://i43.tinypic.com/2dt39ep.jpg)
:o ;D
-
bad, some of them aren't even opened!!
-
(http://i39.tinypic.com/256zgjs.jpg)
(http://i39.tinypic.com/fdhw6w.jpg)
bad, some of them aren't even opened!!
ye xD thats bad 8)
-
(http://i44.tinypic.com/v8n4bb.jpg)
(http://cache.gawkerassets.com/assets/images/12/2010/04/500x_mishitbus.jpg)
(http://i41.tinypic.com/1441ohj.jpg)
-
(http://i44.tinypic.com/2v926nl.jpg)
rock on grandmom XD
(http://i39.tinypic.com/2nbzvpj.jpg)
(http://i39.tinypic.com/2j1moat.jpg)
(http://i44.tinypic.com/2ljlxfk.jpg)
then you need good eyes:
(http://i40.tinypic.com/o85lvo.jpg)
(http://i44.tinypic.com/2vwfy1w.jpg)
(http://i43.tinypic.com/2i8kwfs.jpg)
(http://i42.tinypic.com/2mzk5zs.jpg)
(http://i39.tinypic.com/9t1ksm.jpg)
good luck: ???
(http://i42.tinypic.com/16pffb.jpg)
-
(http://i44.tinypic.com/v8n4bb.jpg)
(http://i42.tinypic.com/16pffb.jpg)
The best ones :L
-
whats so fun about the plates?
-
(http://www.tallrite.com/weblog/blogimages/refs2006/AmericanWorld.gif)
-
(http://www.wordsaboutthings.co.uk/wp-content/uploads/2009/12/berlusconi.jpg)
(http://img.metro.co.uk/i/pix/2009/09/BerlusconiG_450x406.jpg)
(http://www.spadeworker.com/wp-content/uploads/2009/09/real-politics.jpg)
(http://www.internet-news.it/wp-content/uploads/2009/03/berlusconi_cannocchiale.jpg)
(http://driverrob.files.wordpress.com/2009/06/berlusconi.jpg)
(http://1.bp.blogspot.com/_5Udxu_jeDDw/SyZb7ENcNcI/AAAAAAAAAnc/3W3EFGwYrdw/s400/silvio-berlusconi.jpg)
OHHHHHHH YEAAAAAAHH.
-
(http://img22.imageshack.us/img22/354/0462s.jpg)
-
(http://www.wordsaboutthings.co.uk/wp-content/uploads/2009/12/berlusconi.jpg)
(http://img.metro.co.uk/i/pix/2009/09/BerlusconiG_450x406.jpg)
(http://www.spadeworker.com/wp-content/uploads/2009/09/real-politics.jpg)
(http://www.internet-news.it/wp-content/uploads/2009/03/berlusconi_cannocchiale.jpg)
(http://driverrob.files.wordpress.com/2009/06/berlusconi.jpg)
(http://1.bp.blogspot.com/_5Udxu_jeDDw/SyZb7ENcNcI/AAAAAAAAAnc/3W3EFGwYrdw/s400/silvio-berlusconi.jpg)
OHHHHHHH YEAAAAAAHH.
is my premier ;D ;D ;D ;D ;D ;D ;D ;D ;D ;D ;) :D :D :D :D :D :D
-
CYSIO hahahahaa
(http://static.funnyjunk.com/gifs/120px_pedobear2.gif)
(http://i574.photobucket.com/albums/ss186/horchata777/van.gif)
(http://img21.imageshack.us/img21/9482/thumbshumor16.jpg)
-
(http://2.bp.blogspot.com/_5KQbD2fCCxw/SKDicL2vSPI/AAAAAAAABIk/nzKgvDuy-Vs/s400/the-deadliest-catch.jpg)
:D :D :D :D ;D ;D ;D :D :D
-
Seriously, wtf UK :o
[youtube]http://www.youtube.com/watch?v=b8363R9XbGY&feature=related[/youtube]
-
As with most countries, our Eurovision team are the scum of our music industry. Wait, so why isn't Cheryl Cole there?...
(http://www.sharingmachine.com/prodimages/quab-200.gif)
Pronounced (Kwaaaahhb)
1) A quab is a term used to describe the situation where you walk into your room and find you uncle and an octopus under your sheets.
2) Quab is the term used when no other swear could even grasp the complexity of the situation or event.
YOu could be a quab, be a qaubber, be qaubbing, or just doing the act of qaub.
Nephew: Oh my god uncle frank?
Uncle: Oh hello billy, why dont you go out and play some baseball, huh sport?
Nephew: bu but but but....
Uncle: *Pushes out of room* Now run along now.
Boy: Wow Sally is such a Quabber for quabbing that guy
Boy 2: I know right.
boy: Hey sally your a Quab!
-
Eurovision SUXXXXXXXXXXXXXXXXXXXXXXX
-
(http://www.nataliedee.com/100608/BYB-quab.jpg)
-
(http://www.lsw.uni-heidelberg.de/users/sbrinkma/pictures/you_rock_you_rule.jpg)
-
i was bored so i searched for killerbunnies on google images, sorry kb LOL
(http://files.uploadffs.com/a/7/f40e7146/killerbunnies.gif)
-
Oh dear! :-X
:L
-
i was bored so i searched for killerbunnies on google images, sorry kb LOL
(http://files.uploadffs.com/a/7/f40e7146/killerbunnies.gif)
epic liar : )
-
search for it yourself then lol
-
I'm struggling to work out how that picture is even possible.
-
hollyyyy shiiiiitttt
-
w00www ;D
-
disgusting ::)
-
(http://i43.tinypic.com/10sbpyh.jpg)
(http://i41.tinypic.com/16a7703.jpg)
(http://i43.tinypic.com/11u9ijn.jpg)
(http://i42.tinypic.com/dfbxxe.jpg)
;D :D ;) :)
(http://i42.tinypic.com/nq6xkm.jpg)
(http://i43.tinypic.com/5z0ehk.jpg)
haha
(http://i41.tinypic.com/2nvcyg5.jpg)
(http://i39.tinypic.com/2aakgg8.jpg)
(http://i44.tinypic.com/10ye97p.jpg)
(http://i43.tinypic.com/2rctzjo.jpg)
-
(http://i40.tinypic.com/1zprxnq.png)
-
Haha wtf :L
-
lol mod haha
i bet that was an infernus :o
-
:L :L :L :L :L :L :L :L :L :L
(http://i40.tinypic.com/1znlr7t.jpg)
search for it yourself then lol
Lame liar (http://www.anikaos.com/040-onion_msn_smilies/onion_msn_smilies/onion_msn_smilies-05.gif)
-
(http://i41.tinypic.com/2qltqmb.png)
-
photoshoped -.-
pega el link y te creo...
-
[youtube]http://www.youtube.com/watch?v=138346sq8Fk[/youtube]
-
[youtube]vt2i0ts-uck[/youtube]
[youtube]7mP3oGnr0Gw[/youtube]
-
photoshoped -.-
pega el link y te creo...
ah fak off, took the screenshot, Im not gettin a fuckin link just for u to believe
-
lol, :o
-
this shit owns, best 47 seconds of the week
[youtube]http://www.youtube.com/watch?v=ZmXswHuxy98[/youtube]
-
what the... lol
-
lool
-
polish language xD
-
http://www.youtube.com/watch?v=g_FVD0BR2Mc&feature=player_embedded
-
http://forum.adrenalinex.co.uk/index.php/topic,362.0.html
-
duh duh duh duh-deh dah-duh deh-duh
-
Oh ok , sorry
-
Kangoroo FTW !
http://www.youtube.com/watch?v=g_FVD0BR2Mc&feature=player_embedded
-
np
(http://xenophilius.files.wordpress.com/2008/11/kangaroo-treehugger.gif)
-
duh duh duh duh-deh dah-duh deh-duh
that sound like dutch
-
haha goooo kangeroo
-
(http://lh5.ggpht.com/_-a-RBE6tjuw/SiwgIJmY9SI/AAAAAAAAACw/zB6hu0z7Aj4/6+-+Blond+neger.jpg)
-
This is your new haircut? ;D
-
Yep, supercool isn't it!
-
Cool 8)
-
[youtube]http://www.youtube.com/watch?v=TRqYvkjeaF4[/youtube]
-
Hah :L
-
that looks creepy lol
-
lOL
o_O
-
WTF?!
[youtube]http://www.youtube.com/watch?v=0mcxALZrUI8[/youtube]
-
english please ::)
-
use translator
-
cysio is our translator!!
-
use translator
yeah cos im gonna type down everything they're saying then translate it to english lol......................
-
we can't even type it down because it sounds like crap in my ears :L
-
use translator
yeah cos im gonna type down everything they're saying then translate it to english lol......................
lol sounds easy enough
-
:P
-
we can't even type it down because it sounds like crap in my ears :L
same with german here + i laugh while im listening that :L
use translator
yeah cos im gonna type down everything they're saying then translate it to english lol......................
i had to do this when i was young ;)
-
hard life aye :P
-
we can't even type it down because it sounds like crap in my ears :L
same with german here + i laugh while im listening that :L
As you know I don't speak German as native language.
-
My post wasnt made for attack you ;) i just hate that country, language and german peoples.
-
hehe, well.. we(the Netherlands) used to hate them too.. but I think we're pretty okay with the western part since they split up and after 1989 also with the eastern part. nowadays we don't hate them anymore, only with football :D
-
Hate their language, there are like 5 synonyms for each word they've got
-
[youtube]hNpma0auou8[/youtube]
-
typical woman for ya
that scream made me bloody jump though
-
lol!!!
btw shes american, english or from somewhere else... shes not mexican XD
-
(http://obczaj.net/obrazki/110675.jpg)
-
OMG Ush's avatar. :D
(http://i.imgur.com/FVd96.gif)
(http://img682.imageshack.us/img682/7240/1a99600bd4ff558d6a44faa.jpg) (http://img682.imageshack.us/i/1a99600bd4ff558d6a44faa.jpg/)
(http://img.moronail.net/img/9/2/4192.jpg)
(http://img.moronail.net/img/8/7/4187.jpg)
(http://retailrise.com/system/files/images/shoplift.jpg)
(http://img.moronail.net/img/6/9/4169.jpg)
(http://img.moronail.net/img/6/4/4164.jpg)
(http://img.moronail.net/img/2/7/4127.jpg)
-
lol @ the last one :L :L
-
(http://img.moronail.net/img/8/7/4187.jpg)
''its'' :(
-
Probably just didn't have any apostrophes lying around.
-
(http://imgur.com/32tqa.jpg)
-
The horse man - Philiphines got Talent
[youtube]69_eq7nsHB0[/youtube]
-
Fags like those don't have a place in my country imo.
-
Maybe he is TheLastAirBender :L
-
(http://24.media.tumblr.com/tumblr_l1bn10Sux61qzswiwo1_400.jpg)
..
-
jesus fuckin christ
-
wtff :L
-
(http://24.media.tumblr.com/tumblr_l1bn10Sux61qzswiwo1_400.jpg)
..
hahahaha pure class
fairplay to the dude
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc3/hs376.snc3/24094_1355671816792_1381357819_31164217_3220076_n.jpg)
-
That's terrible. :o
-
ahaha tali tubi xD nicee
-
USH
[youtube]jmwB-oKwk5U[/youtube]
-
@ Bunnies: He's so high he can't see through the volcanic ash. :D
(http://img.moronail.net/img/6/2/4262.jpg)
(http://img.moronail.net/img/2/8/4228.jpg)
(http://img.moronail.net/img/5/9/1559.jpg)
(http://4gifs.com/gallery/d/152749-1/Pageant_attack.gif)
Madmax IRL :L :
(http://filesmelt.com/dl/ksvhl.jpg)
-
(http://www.gta-expert.com/index.php/galleria/Images/gtaivnews/poster_wanted_niko.jpg)
FRIENDS OF SNOOPY
(http://trickyrelativity.files.wordpress.com/2009/07/snoopy.jpg)
FOR FALKY :D
(http://thebeautybrains.com/wp-content/uploads/2008/08/flaky.jpg)
FOR KILLERTUBBIES
(http://rookery2.viary.com/storagev12/996000/996162_5798_625x1000.jpg)
-
Maybe some vids have already posted...
Latin school...
[youtube]9Cz_Oq_4i-o[/youtube]
Brazilian school...
[youtube]sESVQlxxNlU[/youtube]
is this french??? wtf! -.- mental sick
[youtube]jJzSj0f2zrk[/youtube]
intolerance teacher... there are another ways
[youtube]KbdWVO8D8uQ[/youtube]
WTF!! shes crazy!!
[youtube]NN06chJ4G_s[/youtube]
Lets kill this faggot
[youtube]iVdbPrwyU54[/youtube]
-
(http://obczaj.net/obrazki/111404.jpg)
(http://obczaj.net/obrazki/111296.jpg)
-
hahahaha (spin) ;_; (spin)
(http://imgur.com/A8LZB.jpg)
-
tell everyone about our secret forum why don't you :(
-
you just did a good job of that yourself :(
-
(http://imgur.com/grfra.jpg)
(http://imgur.com/q69Oh.jpg)
-
Hahaha, the first one got me :L :L
-
:)
-
(http://obczaj.net/obrazki/111438.jpg)
-
(http://i283.photobucket.com/albums/kk316/Undertaker876/crazy-cat.gif)
(http://obczaj.net/obrazki/111438.jpg)
>:(
(http://www.misterseed.com/images/scopion2.jpg)
You like scorpion?
is Madmax?
(http://images.paraorkut.com/img/funnypics/images/c/crazy_dance-12762.gif)
:-* ;)
-
u fail at gif links
-
porno video for cat :D
(http://img96.imageshack.us/img96/3862/26112907.gif)
(http://img96.imageshack.us/img96/3407/84919954.gif)
fixed!!!
-
yet another fail
-
yet another fail
fixed :)
(http://i283.photobucket.com/albums/kk316/Undertaker876/crazy-cat.gif)
>:(
(http://www.misterseed.com/images/scopion2.jpg)
You like scorpion?
is Madmax?
(http://images.paraorkut.com/img/funnypics/images/c/crazy_dance-12762.gif)
:-* ;)
[/quote]
-
(http://imgur.com/3TAm7.jpg)
(http://imgur.com/xnSoS.gif)
(http://imgur.com/tSWdO.gif)
(http://imgur.com/c9ZNa.gif)
(http://imgur.com/p3qd1.gif)
(http://imgur.com/h3DEg.gif)
(http://imgur.com/uJH6Q.gif)
(http://imgur.com/lKprT.gif)
(http://img13.imageshack.us/img13/6743/powerwheelspusheddownhi.gif)
(http://img685.imageshack.us/img685/8229/2mzbqecjpg.gif)
(http://img339.imageshack.us/img339/3198/wtf1q.jpg)
-
(http://imgur.com/3TAm7.jpg)
omfg
-
(http://imgur.com/3TAm7.jpg)
omfg
ohhhh yeaahhhh :P :P :P :P :P :P :P :P :P
-
Im first Italian play driver in ADRENALINEX RACING !
no you aren't! :)
-
(http://obczaj.net/obrazki/111571.jpg)
-
Im first Italian play driver in ADRENALINEX RACING !
no you aren't! :)
is true, but I have a career in the server ;)
-
why because you are djharley? =/
-
i don't know Djharley ,and my nickname was always Scorpion
if I remember correctly my first nickname was Scorpion_ITA
-
(http://imgur.com/h3DEg.gif)
I will try this one at home :D ;D
-
(http://i42.tinypic.com/sc8h2g.jpg)
(http://i42.tinypic.com/f5514z.jpg)
(http://i43.tinypic.com/15rbf61.jpg)
(http://i44.tinypic.com/2ps289z.jpg)
(http://i40.tinypic.com/2czwx2t.jpg)
(http://i40.tinypic.com/vr7cxy.jpg)
(http://i43.tinypic.com/2f0g100.jpg)
(http://i39.tinypic.com/5lnc3l.jpg)
(http://i40.tinypic.com/15ofcck.jpg)
(http://i39.tinypic.com/2eb7gbp.jpg)
(http://i44.tinypic.com/ehxhug.jpg)
(http://i39.tinypic.com/aw3ogp.jpg)
(http://i40.tinypic.com/15qf85u.jpg)
(http://i39.tinypic.com/34t7ubr.jpg)
(http://i39.tinypic.com/160q1jn.jpg)
(http://i42.tinypic.com/1zvecu1.jpg)
(http://i43.tinypic.com/2hwck11.jpg)
(http://i39.tinypic.com/10gdyl4.jpg)
(http://i42.tinypic.com/17p99t.jpg)
(http://i42.tinypic.com/1zohsvk.jpg)
(http://i44.tinypic.com/14jm8mo.jpg)
(http://i39.tinypic.com/2dvtp2u.jpg)
(http://i42.tinypic.com/2znwk1v.jpg)
(http://i41.tinypic.com/sg1oia.jpg)
(http://i44.tinypic.com/slkvvo.jpg)
(http://i43.tinypic.com/x4i1xl.jpg)
(http://i41.tinypic.com/5o737n.jpg)
(http://i44.tinypic.com/e9brlk.jpg)
(http://i41.tinypic.com/f9qebr.jpg)
(http://i39.tinypic.com/2cn8vb6.jpg)
-
Haha nice :L
-
(http://i44.tinypic.com/2vnl56v.jpg)
Lada Limousine
Russian Limousine xD
-
haha @ the russian car, cant say cars cos it seems they only have one type of car xD ((
actually they were all good lol
-
jeez how the hell people gets out that bus?
-
(http://i40.tinypic.com/2yv16v8.gif)
lmao:
(http://img188.imageshack.us/img188/2820/callmeal.gif)
(http://i42.tinypic.com/24o0cv5.jpg)
-
[youtube]SEVU-YLpM8A[/youtube]
-
ye this lol, very true lol
-
(http://29.media.tumblr.com/tumblr_l1kszc5PGo1qzh5gno1_500.jpg)
(http://25.media.tumblr.com/tumblr_l1kst2FZhL1qzh5gno1_400.jpg)
(http://28.media.tumblr.com/tumblr_l1krvuiN8m1qzh5gno1_500.jpg)
(http://30.media.tumblr.com/tumblr_l1kpq5urpx1qb91hto1_400.jpg)
(http://26.media.tumblr.com/tumblr_l1kr7g0QLT1qzh5gno1_250.gif)
-
[youtube]http://www.youtube.com/watch?v=playnmJB_TI&feature=channel[/youtube]
-
hahaha
-
(http://i39.tinypic.com/2ia4lec.jpg)
(http://i43.tinypic.com/117v7dz.jpg)
(http://i43.tinypic.com/4gqgzo.jpg)
(http://i42.tinypic.com/11k8l8l.jpg)
Old skool skateboard:
(http://i43.tinypic.com/2po8ugp.jpg)
(http://i40.tinypic.com/2lxz9xl.jpg)
(http://i41.tinypic.com/105oc47.jpg)
(http://i43.tinypic.com/29kqhj7.jpg)
(http://i44.tinypic.com/jtp63b.jpg)
(http://i39.tinypic.com/142dcua.jpg)
(http://i40.tinypic.com/abjrza.jpg)
(http://i43.tinypic.com/j0zd47.jpg)
(http://i39.tinypic.com/whcodg.jpg)
(http://i43.tinypic.com/311rgae.jpg)
(http://i40.tinypic.com/1z34eqg.jpg)
(http://i41.tinypic.com/bi4fi0.jpg)
(http://i39.tinypic.com/16a455i.jpg)
(http://i43.tinypic.com/als291.jpg)
(http://i39.tinypic.com/10f48sg.jpg)
(http://i44.tinypic.com/144a6mp.jpg)]
(http://i43.tinypic.com/142bv5w.jpg)
(http://i39.tinypic.com/512cub.jpg)
(http://i44.tinypic.com/174s4j.jpg)
(http://i44.tinypic.com/i1h8u9.jpg)
(http://i44.tinypic.com/2w22bma.jpg)
(http://i44.tinypic.com/2h808r7.jpg)
(http://i44.tinypic.com/2csj6mh.jpg)
(http://i39.tinypic.com/fva9es.jpg)
(http://i44.tinypic.com/6hsuav.jpg)
(http://i41.tinypic.com/iqknxw.jpg)
(http://i43.tinypic.com/2gv4emx.jpg)
(http://i40.tinypic.com/2vhwumh.jpg)
(http://i39.tinypic.com/21oubk8.jpg)
(http://i42.tinypic.com/sepyit.jpg)
(http://i40.tinypic.com/4via1f.jpg)
(http://i39.tinypic.com/10ydsmr.jpg)
(http://i39.tinypic.com/2i9m87m.jpg)
(http://i42.tinypic.com/1zgx8ib.jpg)
(http://i43.tinypic.com/f28pqf.jpg)
-
[youtube]http://www.youtube.com/watch?v=playnmJB_TI&feature=channel[/youtube]
hahaha love them
-
(http://i39.tinypic.com/28ciy4g.jpg)
(http://i44.tinypic.com/2aete0n.jpg)
(http://i41.tinypic.com/zwhpv7.jpg)
(http://i41.tinypic.com/wi4xoj.jpg)
(http://i40.tinypic.com/e7gv88.jpg)
(http://i39.tinypic.com/df7sr5.jpg)
(http://i39.tinypic.com/25h0go0.jpg)
So that was it for today.
(http://i41.tinypic.com/642o38.jpg)
-
Great stuff :o
-
jarno finds funny pics :D
-
great pics jarno :)
-
jarnlicno
-
garlicno :D
-
garjalicnobread :D
-
JAROL >:(
-
haha thanks guys ;) this weekend niw pics ;) ;D ;D ;D ;D ;D
-
(http://obczaj.net/obrazki/111925.jpg)
'coz when your weight is 200kg every meter matters'
-
(http://i733.photobucket.com/albums/ww332/Acetony/haha.gif)
see it please
http://www.youtube.com/watch?v=R2OS4QOHGfQ
Scorpion WIn ;D
-
o_O
-
http://www.youtube.com/watch?v=R2OS4QOHGfQ
Scorpion WIn ;D
scorpoin have armour hack, not fair
-
LOL at the tags in the description:
a b c d e f g h i j k l m n o p q r s t u v w x y z
abcdefghijklmnopqrstuvwxyz
Videos:
Evolution of Dance, Pokemon Theme Music Video, SNL - Digital Short - A Special Christmas Box *Uncensored Version, My Chemical Romance - Famous Last Words, guitar, Quick Change Artists on America's Got Talent, shoes, OK Go - Here It Goes Again, Hey clip, Real Life Simpsons Intro, Free Hugs Campaign. (music by Sick Puppies album out April3), Urban Ninja, Hahaha, Ronaldinho: Touch of Gold, lion sleep tonight, muffins, White & Nerdy, Mortal Kombat Theme, beyonce -- irreplaceable, Napoleon Dynamite Dance Scene, GYM CLASS HEROES: Cupid's Chokehold, Lock Bumping and Bump Keys, Scary Movie 4 Trailer, Avril Lavigne -- Girlfriend, Justin Timberlake - My Love, Best card trick in the world
YouTube users:
Lonelygirl15, smosh, miarose, cbs, williamsledd, brookers, baratsandbereta, geriatric1927, thewinkone, gaygod, thehill88, happyslip, boh3m3, lisanova, nbc, brookers, mychemicalromance,mundoreggaeton, tnawrestling, gizmodo, digitalfilmmaker, guitar90, okgo, chrisinscotland, nikesoccer
This video is not mine, I did not make this video. I simply posted it for fun. I am not an "animal abuser", I love animals...
Terms:
Runescape, Bebo, myspace, metacafe, radioblog, wikipedia, video, rebelde, mininova, wiki, Disney, youtube, apple, playstation, xbox, wii, microsoft
Sports:
Nfl, ncaa, baseball, soccer, futbol, football, Nba, basketball, mlb, hockey, nhl, fifa, poker, golf, world cup, nascrar, formula one, snooker, pool, tennis, rugby, boxing, cart, racing, wrestling, wwe
Top women:
Paris Hilton, Tara Reid, Pamela Anderson, Angelina Jolie, Britney Spears, Lindsay Lohan, Jennifer Lopez, Carmen Electra, Brooke Burke, Hilary Duff, Anna Kournikova, Anna Nicole smith, Jessica alba, Cameron diaz, jenna jameson
Top Men:
Clay Aiken,Zac Efron, Nelly, Chris Brown, Howard Stern, Daddy Yankee, Jesse McCartney, Elliot Yamin, Steve Irwin Eminem, Andy Milonakis, 50 Cent, Howard Stern, Tupac Shakur, Michael Jackson, Usher,Bow Wow, Clay Aiken, Brad Pitt, kobe Bryant, Sidney Crosby, david beckham
Top Shows:
American Idol, Lost, South Park, Smallville, Family Guy, CSI, The Simpsons, Scrubs, Survivor, Dancing with the Stars, naruto shippuden, pokemon, dragonball, dragon ball
Top Bands:
Green Day, Pussycat Dolls, Fall Out Boy,Guns N Roses, Rolling Stones, Nickelback, Evanescence, Black-Eyed Peas, All American Rejects, The Fray
Top searched:
lips two girls kissing lesbian hot wild chicks erotic sexy dikes lesbo adult ass butt lesbian lips sex tongues make out adult cute blindfolded chick blonde love lick porn kiss cute boob tit exposed two girls kissing kiss hot wild chicks cute lingerie lips dikes cute panties kissing lesbian wild chiks erotic sex vivthomas dikes tongues make out lezbo striptease nude babe naked sexy girl ass tits lingerie girls hot strip stripping jenna sexyjenna79 ass butt thong booty boobs tits sexy young girl strip tease web cam thongs school dancein underwear funny bra Porn Adult Nude oral anal tits ass breasts naked blowjob blow job cocksucker erotica cum xxx shaved playboy webcam girl sex nude strip teasing web cam sexy hot latina fuck beautiful girls dance webcam hot web cam chicas cute lovely women females britney spears chest tits boobs vagina pussy cunt slut whore drunk club
-
http://www.youtube.com/watch?v=R2OS4QOHGfQ
Scorpion WIn ;D
scorpoin have armour hack, not fair
(http://www.ps3ita.com/forum/images/smilies/ahah.jpg)
-
Heard this on the radio today.
[youtube]SyQ----YaoY[/youtube]
Old but funny. Best are the playground jokes on it :L :
Want some chicken, but are you gonna Nando?
You like kids, but are you gonna paedo?
Drinkin' Fanta, but are you gonna Tango?
Terrorist on a plane, but are you gonna land doe?
Makin' bread, but are you gonna knead doe?
Got 15p, but are you gonna Freddo?
Police at the door so I'm jumpin' out da window.
-
Funny?
[youtube]http://www.youtube.com/watch?v=s2cCOGyVS8w[/youtube]
-
british humour is the fuckin best
-
aghahahahahaha
[youtube]http://www.youtube.com/watch?v=1JO0-WCEOw4[/youtube]
-
Great scenes ! :D
[youtube]http://www.youtube.com/watch?v=Gw-AxiVqihM[/youtube]
[youtube]http://www.youtube.com/watch?v=xCS7CBcHxtA[/youtube]
[youtube]http://www.youtube.com/watch?v=BHMkiLOaBgY[/youtube]
And btw, check this 4-Pack spin out too! :L
[youtube]http://www.youtube.com/watch?v=fc16h-aM89o[/youtube]
-
Hahah that last lap owned!
-
you are it USH ???
(http://www.fugly.com/media/IMAGES/Priceless/partypants.jpg)
:D ;)
Madmax in way
(http://www.fugly.com/media/IMAGES/Dumb/nakedcowboy.jpg)
:D
little fat ;D
(http://www.fugly.com/media/IMAGES/Funny/poorsneakersxza.jpg)
when i play in Adrenalinex Racing :P :D
(http://www.fugly.com/media/IMAGES/Funny/mobilecomputing.jpg)
omg :o
(http://www.fugly.com/media/IMAGES/Funny/indianfood.jpg)
ya good god :D Fuck you
(http://www.fugly.com/media/IMAGES/Funny/jesuslovesme.jpg)
:-* :-* :-* :-*
(http://www.fugly.com/media/IMAGES/Drunk/drunknascarchick.jpg)
MOOMAN :)
(http://www.fugly.com/media/IMAGES/Funny/cow_pies.jpg)
cRASH Joe with airplane similar in Gta Sa :D
(http://www.fugly.com/media/IMAGES/Funny/eyeyeeeeee.jpg)
i love this toilette 8)
(http://www.fugly.com/media/IMAGES/Funny/snowcrapper.jpg)
FUCK RAMMER :D >:(
(http://www.fugly.com/media/IMAGES/Funny/alphamale.jpg)
POD ? :P :-*
(http://www.fugly.com/media/IMAGES/Funny/bigpeckers.jpg)
BIKE WITH TOILETTE
(http://www.fugly.com/media/IMAGES/Funny/GOcart.jpg)
cRAZy horse
(http://www.fugly.com/media/IMAGES/Funny/stagedive.jpg)
Oval of MadMax
(http://www.fugly.com/media/IMAGES/Funny/traction.jpg)
Sotp
(http://www.fugly.com/media/IMAGES/Funny/sotp.jpg)
Elvis return
(http://www.fugly.com/media/IMAGES/Funny/ElvisOnCrack.jpg)
good hair ;)
(http://www.fugly.com/media/IMAGES/Funny/pimpduck.jpg)
::)
(http://www.fugly.com/media/IMAGES/Funny/fuglyclock.jpg)
:o :o
(http://www.fugly.com/media/IMAGES/Funny/056.jpg)
>:( :(
(http://www.fugly.com/media/IMAGES/Funny/20dollarwhore.jpg)
-
hahaha wtf lol
im fucking stoned lol
-
:D ;D
(http://www.fugly.com/media/IMAGES/Funny/bumperstickers.jpg)
IronMan
(http://www.fugly.com/media/IMAGES/Dumb/canaduhhh.jpg)
For Devil666
(http://www.fugly.com/media/IMAGES/Funny/highwaytohell.jpg)
when I make the screen ;D
(http://www.fugly.com/media/IMAGES/Funny/printscreen.jpg)
Argghhh
(http://www.fugly.com/media/IMAGES/Funny/aaaaargh.jpg)
-
hahaahha omg I love your pictures.. hahaha omg IRONMAN LOLOOOOLL!!!
ahhahahaa
ahahahahahaah
LOOOOOL
hahahahahasdsjdasksd
aD::DD::DD:D
DOMG LOLL!
-
lol @ ush :L
but Barbie and Ken owns :D :D
-
Damn keep it up Scorpion, epicness! :L :L
-
The barbie one is lulz
-
(http://www3.imagocentre.com/images/22/gillette_53.jpg)
American noob talent
(http://www4.imagocentre.com/images/22/gif-funny-fail-lmj!l@.png_57.gif)
-
Things turn right around :L
[youtube]http://www.youtube.com/watch?v=XFnYRVdQVgo[/youtube]
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash1/hs498.ash1/27207_1308148302992_1209106551_30790901_240535_n.jpg)
-
hahaha
-
omg,that's epic :L
-
(http://avideditor.files.wordpress.com/2009/06/obama-the-sphinx.jpg)
-
(http://i44.tinypic.com/qpp4yf.png)
(http://i39.tinypic.com/x4ogec.jpg)
-
[youtube]http://www.youtube.com/watch?v=LnpI4djaRTE[/youtube]
-
??? ??? ??? ???~Scorp nice pictures but i am the guy with the picture :P
you'r too really great @ ironman ~lOOOOLLL\
-
wtff?? ;D
(http://www.fugly.com/media/IMAGES/Random/if_you_keep_making_that_face_it_will_stick_that_way.jpg)
mirror
(http://www.fugly.com/media/IMAGES/Random/heres-to-you-bud.jpg)
CarMod :o Ban it
(http://www.fugly.com/media/IMAGES/Random/aerodynmaic-advantage-priceless.jpg)
fail controll ::)
(http://www.fugly.com/media/IMAGES/Random/back-that-thing-up.jpg)
:D
(http://www.fugly.com/media/IMAGES/Random/the_highway_gets_wider_here.jpg)
sex love
(http://www.fugly.com/media/IMAGES/Random/this_man_likes_a_really_big_wet_pussy.jpg)
sexy girl :o
(http://www.fugly.com/media/IMAGES/Random/like_one_of_those_foil_wrapped_hams_you_see_at_christmas.jpg)
ahah
(http://www.fugly.com/media/IMAGES/Random/so_many_uses_for_a_plastic_cup.jpg)
noobs
(http://www.fugly.com/media/IMAGES/Random/two_old_men_screwing.jpg)
pod :P
(http://www.fugly.com/media/IMAGES/Random/sexy_storm_trooper.jpg)
M4
(http://www.fugly.com/media/IMAGES/Random/man_with_a_very_big_cock.jpg)
kill kill
(http://www.fugly.com/media/IMAGES/Random/catching_a_cheating_wife_ha.jpg)
i want this pc :P ;D
(http://www.fugly.com/media/IMAGES/Random/computer_beer_dispenser.jpg)
or this for good coffe ;)
(http://www.fugly.com/media/IMAGES/Random/caffeine_machine_1.jpg)
uhaooooo :o 8)
(http://www.fugly.com/media/IMAGES/Random/chrome-bmw.jpg)
ahhhahahah ;D :D ;D
(http://www.fugly.com/media/IMAGES/Random/penguin-diving-through-ice.jpg)
in the end it :D ;D
[youtube] http://www.youtube.com/watch?v=jSGWKsJCjzY&feature=related[/youtube]
-
I have come to the conclussion that this is pod:
(http://www.speedwaybrewing.com/Stig.jpg)
-
I have come to the conclussion that this is pod:
(http://www.speedwaybrewing.com/Stig.jpg)
:o
-
I have come to the conclussion that this is pod:
(http://www.speedwaybrewing.com/Stig.jpg)
:o
ie? ???
-
Stig FTW as pod is also FTW, suspicious right?
-
very
-
Stig FTW as pod is also FTW, suspicious right?
what?? not understand :-\ , please explain
-
kill kill
(http://www.fugly.com/media/IMAGES/Random/catching_a_cheating_wife_ha.jpg)
right pyro, you spit the guy on the ledge, ill smoke the other guy out of the window... charger go!!!! DAMN YOU MISSED... RAGEEEEEEE
damn boomer where the feck are ye
-
I do not understand what you speak
ahahah ;D :D
-
/me throws boomer bile at [ITA]Scorpion
-
hahahaha :D
/me rage quits. :(
-
google not translates this word boomer bile ??? ???
-
This is a boomer and what he vomits is bile.
So you have boomer bile.
(http://www.secondary-fire.com/wp-content/uploads/2008/11/absolut_boomer.jpg)
-
funny game ;D
Marlboro ;D
(http://www.fugly.com/media/IMAGES/Funny/marlboro.jpg)
Bissss for Devil
(http://www.fugly.com/media/IMAGES/Funny/barbiekd9kw0.jpg)
For JOE ;D :D
(http://www.fugly.com/media/IMAGES/Dumb/birthdaycake.jpg)
:P (rolleyes) :-* For girls of server pod , Vanessa ,Sheepfucka, Anna & etc.
(http://www.fugly.com/media/IMAGES/Babes/drunk_women.jpg)
my face
(http://www.fugly.com/media/IMAGES/WTF/stamp_man.jpg)
yeahhhhhhhhhh ;) Ush like it??
(http://www.fugly.com/media/IMAGES/Drunk/beer-memorial.jpg)
but Ush you not to drink too ;) ;) ;) ;)
(http://www.fugly.com/media/IMAGES/Strange/watermellon.jpg)
wtfff :o
(http://www.fugly.com/media/IMAGES/Scary/hello-kitty-freak.jpg)
crashh :o :'( :'( :'( :'( :'(
(http://www.fugly.com/media/IMAGES/Sad/beer-destruction.jpg)
ahahahahahha for Falky ;) ;)
(http://www.fugly.com/media/IMAGES/Drunk/pass-out-72.jpg)
(rolleyes) 8)
(http://www.fugly.com/media/IMAGES/Funny/marijuana-mcdonalds.jpg)
ahaahhah shitt ;D
(http://www.fugly.com/media/IMAGES/Gross/say-cheese.jpg)
Seriously, Wtf
(http://www.fugly.com/media/IMAGES/Funny/squirrel_soldier.jpg)
slug maze :D
(http://www.fugly.com/media/IMAGES/Funny/slug_maze.jpg)
Super Mario Bross :P :P :P ;D :o 8)
(http://www.fugly.com/media/IMAGES/Funny/mario-cookie.jpg)
:D
(http://www.fugly.com/media/IMAGES/Crazy/offroad-wheelchair.jpg)
:o ??? Japanesi crazy
(http://www.fugly.com/media/IMAGES/TRUE/ant_soccer.jpg)
good agility :o :D
(http://www.fugly.com/media/IMAGES/Gross/flexible_fat_guy.jpg)
in the end photo funny for all Admins ;D ;)
(http://www.fugly.com/media/IMAGES/WTF/Polar_Bear_Tongue.jpg)
-
:P (rolleyes) :-* For girls of server pod , Vanessa ,Sheepfucka, Anna & etc.
(http://www.fugly.com/media/IMAGES/Babes/drunk_women.jpg)
pod's a girl? :o
ahahahahahha for Falky ;) ;)
(http://www.fugly.com/media/IMAGES/Drunk/pass-out-72.jpg)
lol hardcore
-
pod's a girl? :o
i think so. we better ask her to be sure
-
:P (rolleyes) :-* For girls of server pod , Vanessa ,Sheepfucka, Anna & etc.
(http://www.fugly.com/media/IMAGES/Babes/drunk_women.jpg)
pod's a girl? :o
No.
-
pod's a doll.
-
pod isn't a girl ??? ??? :-[ :'(
i think is girl :(
-
haha
-
lol :D
-
(http://forum.adrenalinex.co.uk/Smileys/default/tRDvJjVtKsqb6zdWUBdiJt7emmc.gif)
-
girl scripter/programmer?
(possible but very rare lol)
-
girl scripter/programmer?
Possible :'( :'( :-[
-
(possible but very rare lol)
-
(http://izismile.com/img/img3/20100504/640/daily_picdump_404_640_106.jpg)
(http://izismile.com/img/img3/20100504/640/daily_picdump_404_640_117.jpg)
(http://izismile.com/img/img3/20100504/640/daily_picdump_404_640_118.jpg)
-
Failed again lol
This really is a bubble gum :D
(http://imgur.com/WOV8s.jpg)
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash1/hs470.ash1/25803_122359294444217_100000104421198_325083_8350058_n.jpg)
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash1/hs470.ash1/25803_122359294444217_100000104421198_325083_8350058_n.jpg)
aahahahahah :D ;D
-
Only look at this if you're up for a scare, it's fucking sick!
http://bluewaffle.net/bw.jpg
-
OMFGGGGGG!!!!
Damn R, you shouldn't post such things here :L
-
ewwwwww :L
-
Failed again lol
This really is a bubble gum :D
(http://imgur.com/WOV8s.jpg)
Seriously, WTF?
-
hahaha liquid filled :P
-
Destroyed! :o
-
sweet bob of the camel ;D
-
(http://img.moronail.net/img/5/3/4653.jpg)
(http://img.moronail.net/img/3/3/4633.jpg)
(http://img.moronail.net/img/7/9/4579.jpg)
(http://img.moronail.net/img/3/6/4536.jpg)
(http://img.moronail.net/img/8/7/2787.jpg)
(http://img718.imageshack.us/img718/1633/kgpdweb.jpg)
(http://i43.tinypic.com/25tfaz6.jpg)
(http://i41.tinypic.com/11tohkx.jpg)
(http://i44.tinypic.com/2wcitj4.jpg)
(http://i40.tinypic.com/w82fi8.jpg)
(http://i41.tinypic.com/20i83rl.jpg)
This one's for all the boy racers:
[youtube]BaeNelsAOGo[/youtube]
-
^ love that song, owns.
-
This reminds me of Joe: watch at least the first minute from the start.
[youtube]9SYp0UqhqAo[/youtube]
Some one commented on the video "this is very realistic" :L.
This one just made me roll with laughter.
[youtube]tDqJGukKIVg[/youtube]
-
Some one commented on the video "this is very realistic" :L.
lmao
-
This reminds me of Joe: watch at least the first minute from the start.
[youtube]9SYp0UqhqAo[/youtube]
Some one commented on the video "this is very realistic" :L.
This one just made me roll with laughter.
[youtube]tDqJGukKIVg[/youtube]
hakerr ban it please :D ;D
-
lol
-
Old but great :L
[youtube]http://www.youtube.com/watch?v=qffCXkhodks[/youtube]
[youtube]http://www.youtube.com/watch?v=6Sf_pogZ8jE[/youtube]
[youtube]http://www.youtube.com/watch?v=2D4KTXkbyto[/youtube]
-
(http://ipicture.ru/upload/100508/g0mhipHvT8.jpg)
-
:O great map
(http://ipicture.ru/upload/100508/g0mhipHvT8.jpg)
-
:O great map
(http://ipicture.ru/upload/100508/g0mhipHvT8.jpg)
Wow ye indeed
-
Is it yours ? :o
-
LOL. No.
http://www.gtaforums.com/index.php?showtopic=448181&st=0
-
(http://i42.tinypic.com/dnye4z.png)
-
Omg lol :L :L
http://www.newgrounds.com/portal/view/535461
-
(http://i42.tinypic.com/dnye4z.png)
lol cool
-
Omg lol :L :L
http://www.newgrounds.com/portal/view/535461
:L :L :L :L :L :L :L :L :L
-
(http://i42.tinypic.com/dnye4z.png)
lol cool
bit big for a sig though :/
-
[youtube]http://www.youtube.com/watch?v=dkHJKakHMpo[/youtube]
-
(http://forum.adrenalinex.co.uk/Smileys/default/tRDvJjVtKsqb6zdWUBdiJt7emmc.gif)
-
lol great one
-
:L nice
-
(http://img40.imageshack.us/img40/7373/rita.png)
:o :o :o :o :'( :'( :'( :'( :'( :'( :'( :'( :'( :D :D :D :D 8)
-
loooool now he is angry xD >:( :P :P
-
[youtube]http://www.youtube.com/watch?v=dkHJKakHMpo[/youtube]
xD
-
lol paprika with russian accent ;D
-
Italian.
-
maybe for you, for me its funny russian accent xd
-
Ohh, so this is where your name comes from Gen :D
(http://files.posterous.com/electricant/Kc77vuZxA1i8XXPSyhOXfsop1jF0KUHaUP5Ym62JWNGEpWp7UgablbpvY3NC/3-Gen13-1.jpg?AWSAccessKeyId=1C9REJR1EMRZ83Q7QRG2&Expires=1273687941&Signature=Fy12%2Fonjt%2FgPoxZ3feNJS2kH980%3D)
-
(http://img.moronail.net/img/7/3/4773.jpg)
-
:L
-
(http://i577.photobucket.com/albums/ss219/zimfromBM/125429222806.jpg)
(http://i42.tinypic.com/14mtbr.jpg)
-
[youtube]http://www.youtube.com/watch?v=OKfqjA6mhGo[/youtube]
-
Whoever left that toolbox there should be promoted. ;)
-
Whoah, Euro fags, that's hilarious! :L
-
lol what a noob, elevator was left in hydraulic mode, you always have to make sure to lower it to the safety locks so that kind of accident doesnt happen
-
it's an advertisement for kobalt tools, it's run during nascar races
-
lol found the commercial vid
[youtube]http://www.youtube.com/watch?v=gAIRlVfQX4U[/youtube]
-
lol ;D
-
New Europe map ;D
(http://img693.imageshack.us/img693/1408/nowamapaeuropydb33b278a.gif)
-
LOL, nice one skunk. I think Ireland has the most Polish though. In many villages there are more Polish people than locals. :D
(http://filesmelt.com/dl/dadi_pour.png)
-
[youtube]EFkER6TrQt0&feature=related[/youtube]
-
(http://img41.imageshack.us/img41/8184/186221weedant1.jpg)
(http://img15.imageshack.us/img15/8379/z4714570x.jpg)
(http://img36.imageshack.us/img36/8776/weedmm.jpg)
(http://img208.imageshack.us/img208/6189/rastasurprisebig.jpg)
(http://img8.imageshack.us/img8/4277/246541451096760976cf.jpg)
(http://img97.imageshack.us/img97/8404/20100419nhsenate.jpg)
(http://img641.imageshack.us/img641/9360/weedmd.jpg)
(http://img692.imageshack.us/img692/9416/weedg.jpg)
-
:L nice pics
-
:o
(http://img11.yfrog.com/img11/9226/veryfunny31.jpg)
okok : http://www.abrutis.com/video-mlle+l+infirmiere-14031.html?joueur=misterdream78
-
ROFFFFFFFFFFFL
(http://lolpics.se/pics/1326.jpg)
(http://lolpics.se/pics/1494.jpg)
(http://lolpics.se/pics/484.jpg)
-
I see only some lolpics.se :(
-
yeah, epic fail
-
these were the pics isildur posted
(http://img710.imageshack.us/img710/5696/lol1vv.jpg)
(http://img91.imageshack.us/img91/7183/lol2t.jpg)
(http://img31.imageshack.us/img31/4204/lol3m.jpg)
-
:L :L :L
-
this one is amazing, only 14 seconds, but owns :L
[youtube]http://www.youtube.com/watch?v=iKJvHbTHSxQ[/youtube]
-
lol fake.
-
nah it's real :D
-
hahaha :o 8) ;D
-
(http://24.media.tumblr.com/tumblr_l2j82lPPWB1qa5c6co1_500.jpg)
-
lol
-
http://obczaj.net/obrazki/113627.jpg
-
max thats just sick
-
http://obczaj.net/obrazki/113627.jpg
LMFAO, but gross ^^
-
Hmm what about a pack in my taste? (a sleepy taste :L)
(http://www.funcage.com/photos/06_bussad_31241.jpg)
Fail V
(http://www.funcage.com/photos/Suzuki-Swift-Time-for-a-Swift-Exit.jpg)
(http://www.funcage.com/photos/funcage0033.jpg)
:L
(http://www.funcage.com/photos/capguy.jpg)
(http://www.funcage.com/photos/1158554515_podb43_41.jpg)
Spaggy :L
(http://www.funcage.com/photos/advertise2007-9.jpg)
(http://www.funcage.com/photos/reflective-Legs.jpg)
(http://www.funcage.com/photos/ads9556.jpg)
(http://www.funcage.com/photos/57.jpg)
Bus designs are ftw, sometimes ftl :L
(http://www.funcage.com/photos/19_bussad_23996.jpg)
Google, when there was no internet. :L
(http://www.funcage.com/photos/funcage-google-1960.jpg)
(http://www.funcage.com/photos/1170010800_479.jpg)
(http://www.funcage.com/photos/kiss.jpg)
:L
(http://www.funcage.com/photos/1182584516_husky_rider.jpg)
(http://www.funcage.com/photos/4379.jpg)
(http://www.funcage.com/photos/Brake%20check.jpg)
(http://www.funcage.com/photos/billboard_war.jpg)
(http://www.funcage.com/photos/what-goes-around.jpg)
(http://www.funcage.com/photos/i-haz-an-idea.jpg)
(http://www.eatliver.com/img/temp/561.jpg)
-
lol nice pictures love :L
-
(http://www.funcage.com/photos/capguy.jpg)
Thanks! I've been looking for that one for aaaages.
-
[youtube]http://www.youtube.com/watch?v=m9-kM-guQtk[/youtube]
[youtube]http://www.youtube.com/watch?v=424e6jWv3P0[/youtube]
-
wtf niggas :L
-
[youtube]ZlIe7IS86qc[/youtube]
[youtube]keOochMM3gY[/youtube]
Watch the second one from 2:30. :D
Edit: Looool, whiteboy at 3:49 (on second one).
Mans, this is the best one doe:
[youtube]c1UaKGAow7s[/youtube]
-
wtf who removed my picturs??? ??? ???
-
wtf who removed my picturs??? ??? ???
moge JarnoooOooOOooOOooOOOoo :-*
-
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274277969-540.jpg) (http://www.plaatjesupload.nl/bekijken/2659378.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278010-290.jpg) (http://www.plaatjesupload.nl/bekijken/2659386.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278065-160.jpg) (http://www.plaatjesupload.nl/bekijken/2659390.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278081-250.jpg) (http://www.plaatjesupload.nl/bekijken/2659392.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278210-990.jpg) (http://www.plaatjesupload.nl/bekijken/2659408.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278377-690.jpg) (http://www.plaatjesupload.nl/bekijken/2659423.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278377-691.jpg) (http://www.plaatjesupload.nl/bekijken/2659424.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278377-692.jpg) (http://www.plaatjesupload.nl/bekijken/2659425.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278377-693.jpg) (http://www.plaatjesupload.nl/bekijken/2659426.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278377-74.jpg) (http://www.plaatjesupload.nl/bekijken/2659427.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278481-080.jpg) (http://www.plaatjesupload.nl/bekijken/2659438.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280330-010.gif) (http://www.plaatjesupload.nl/bekijken/2659555.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280330-011.jpg) (http://www.plaatjesupload.nl/bekijken/2659556.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280330-012.jpg) (http://www.plaatjesupload.nl/bekijken/2659557.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280330-013.jpg) (http://www.plaatjesupload.nl/bekijken/2659558.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280330-014.jpg) (http://www.plaatjesupload.nl/bekijken/2659559.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280661-360.jpg) (http://www.plaatjesupload.nl/bekijken/2659575.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280661-361.jpg) (http://www.plaatjesupload.nl/bekijken/2659576.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280661-372.jpg) (http://www.plaatjesupload.nl/bekijken/2659577.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280661-373.jpg) (http://www.plaatjesupload.nl/bekijken/2659578.html)
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280661-374.jpg) (http://www.plaatjesupload.nl/bekijken/2659579.html)
-
(http://s2.noelshack.com/uploads/images/8817512920524_5.jpg)
(http://s2.noelshack.com/uploads/images/7816759835841_2.jpg)
(http://s2.noelshack.com/uploads/images/19431955410120_1274013090722.jpg)
(http://s2.noelshack.com/uploads/images/7962986411721_tumblr_kpowgzkqwa1qzma4ho1_400.jpg)
(http://s2.noelshack.com/uploads/images/20195374670559_3.jpg)
this piece of shit is gonna represent my country on eurovision -.-
[youtube]http://www.youtube.com/watch?v=2aCJPcQznfc&feature=player_embedded#![/youtube]
-
(http://img.moronail.net/img/5/8/4958.jpg)
(http://img.moronail.net/img/4/8/4948.jpg)
(http://img.moronail.net/img/3/2/1132.jpg)
(http://i.imgur.com/gyRvd.jpg)
(http://img37.imageshack.us/img37/1858/image015okq.jpg)
-
http://www.abrutis.com/video-compilation+de+choses+droles+et+insolites-29280.html
-
[youtube]xlEaQD6PJNE[/youtube]
-
(http://static.pyzam.com/img/funnypics/6/pyzamseduction.jpg)
(http://static.pyzam.com/img/funnypics/4/pyzamsosexy.jpg)
(http://static.pyzam.com/img/funnypics/1/pyzampoopattack.jpg)
(http://static.pyzam.com/img/funnypics/7/pyzamexcited.jpg)
(http://static.pyzam.com/img/funnypics/c/pyzamhandhead.jpg)
(http://static.pyzam.com/img/funnypics/2/pyzampolekiller.jpg)
(http://static.pyzam.com/img/funnypics/4/pyzampelicannom.jpg)
(http://static.pyzam.com/img/funnypics/8/pyzamuhoh.jpg)
(http://static.pyzam.com/img/funnypics/b/pyzamlobsterknife.jpg)
(http://static.pyzam.com/img/funnypics/0/pyzam1up.jpg)
(http://static.pyzam.com/img/funnypics/7/pyzamplacement.jpg)
(http://static.pyzam.com/img/funnypics/7/pyzamperfectcake.jpg)
(http://static.pyzam.com/img/funnypics/5/pyzamcaterday.jpg)
(http://static.pyzam.com/img/funnypics/6/pyzamlamplie.jpg)
(http://static.pyzam.com/img/funnypics/9/pyzamhalfandhalf.jpg)
(http://www.pyzam.com/funnypictures/details/6314?cat=all&sort=newest)
(http://static.pyzam.com/img/funnypics/e/pyzamfailhellokitty.jpg)
(http://www.pyzam.com/funnypictures/details/6205?cat=all&sort=newest)
(http://static.pyzam.com/img/funnypics/d/pyzambandface.jpg)
(http://www.pyzam.com/funnypictures/details/3803?cat=all&sort=popular)
(http://www.pyzam.com/funnypictures/details/9314?cat=all&sort=popular)
(http://static.pyzam.com/img/funnypics/d/monat.jpg)
(http://www.pyzam.com/funnypictures/details/10145?cat=all&sort=popular)
(http://www.pyzam.com/funnypictures/details/10497?cat=all&sort=popular)
(http://www.pyzam.com/funnypictures/details/7249?cat=all&sort=popular)
(http://www.pyzam.com/funnypictures/details/4417?cat=all&sort=popular)
(http://static.pyzam.com/img/funnypics/4/pyzamfucked.jpg)
(http://www.pyzam.com/funnypictures/details/3904?cat=all&sort=popular)
(http://static.pyzam.com/img/funnypics/8/pyzamdogchores.jpg)
(http://static.pyzam.com/img/funnypics/1/steep.jpg)
(http://static.pyzam.com/img/funnypics/f/dontdiez.jpg)
(http://static.pyzam.com/img/funnypics/6/pyzamwtf2.jpg)
(http://static.pyzam.com/img/funnypics/c/pyzamjealous.jpg)
(http://www.pyzam.com/funnypictures/details/3760?cat=all&sort=popular)
(http://static.pyzam.com/img/funnypics/0/pyzamOmgWtf.jpg)
(http://static.pyzam.com/img/funnypics/6/pyzamfear.jpg)
(http://static.pyzam.com/img/funnypics/b/pyzamawesomecat.jpg)
(http://static.pyzam.com/img/funnypics/c/savungsfail.jpg)
(http://static.pyzam.com/img/funnypics/7/rollercoaster.jpg)
(http://static.pyzam.com/img/funnypics/c/boomheadshot.jpg)
(http://static.pyzam.com/img/funnypics/2/serioushell.jpg)
(http://static.pyzam.com/img/funnypics/d/beerotter.jpg)
(http://www.pyzam.com/funnypictures/details/9865?cat=all&sort=popular)
(http://static.pyzam.com/img/funnypics/3/9.jpg)
(http://static.pyzam.com/img/funnypics/3/pigfluuu.jpg)
(http://static.pyzam.com/img/funnypics/e/ownedgpas.jpg)
(http://static.pyzam.com/img/funnypics/7/pyzamheaven.jpg)
(http://static.pyzam.com/img/funnypics/4/collegehumor.23b94edec8d8bbeb3357d05b993153b9.jpg)
(http://static.pyzam.com/img/funnypics/d/1372.jpg)
(http://static.pyzam.com/img/funnypics/f/scarylunch.jpg)
(http://static.pyzam.com/img/funnypics/6/happybutt.jpg)
(http://static.pyzam.com/img/funnypics/animals/2rwot1f.jpg)
(http://static.pyzam.com/img/funnypics/animals/bucket.gif)
(http://static.pyzam.com/img/funnypics/5/clarkass.jpg)
(http://static.pyzam.com/img/funnypics/4/7440_4755_thumb.jpg)
(http://static.pyzam.com/img/funnypics/c/failcamera.jpg)
(http://static.pyzam.com/img/funnypics/4/wazupdogg.jpg)
(http://static.pyzam.com/img/funnypics/a/crapplane.jpg)
(http://static.pyzam.com/img/funnypics/5/tanksintheparkinglot.jpg)
(http://static.pyzam.com/img/funnypics/6/pyzamsrslywtf.jpg)
(http://static.pyzam.com/img/funnypics/8/urnext.jpg)
(http://static.pyzam.com/img/funnypics/6/xboxcar.jpg)
-
Nice :L :L
-
This is how 15,980,654,300 $ looks like
(http://4.bp.blogspot.com/_kIJfJnqC_dU/S_R6_ayAiYI/AAAAAAAAAGM/SaZYw67Qjzk/s1600/2008-05-27-100MillionCash.jpg)
-
This is how 15,980,654,300 $ looks like
(http://4.bp.blogspot.com/_kIJfJnqC_dU/S_R6_ayAiYI/AAAAAAAAAGM/SaZYw67Qjzk/s1600/2008-05-27-100MillionCash.jpg)
haha from that fanpage on facebook :D
-
(http://obczaj.net/obrazki/113710.jpg)
(http://obczaj.net/obrazki/113738.jpg)
(http://obczaj.net/obrazki/113658.jpg)
(http://obczaj.net/obrazki/113660.jpg)
(http://obczaj.net/obrazki/113661.jpg)
-
This is how 15,980,654,300 $ looks like
(http://4.bp.blogspot.com/_kIJfJnqC_dU/S_R6_ayAiYI/AAAAAAAAAGM/SaZYw67Qjzk/s1600/2008-05-27-100MillionCash.jpg)
haha from that fanpage on facebook :D
;D
-
This is how 15,980,654,300 $ looks like
(http://4.bp.blogspot.com/_kIJfJnqC_dU/S_R6_ayAiYI/AAAAAAAAAGM/SaZYw67Qjzk/s1600/2008-05-27-100MillionCash.jpg)
haha from that fanpage on facebook :D
LIES!!!
That is 205 millions of dollars, it got recovered by mexican police from a drug trafficker called Zhenli Ye Gon, but he said that he was innocent and Mexican Goverment and a political group called PAN (Partido Acción Nacional) threatened him for get bribely for political stuff.
As he said: "Mexican Goverment wanted my money for the Felipe Calderon's Campaign (actually president of México), it wasnt safe in any bank of Mexico, so i got saved all that money in my house", when mexican police broke-in his house he was in USA, in accordance with him.
Zhenli Ye Gon is on United States atm, hes going to court because Mexican Goverment has not enough proofs for get him in jail.
It was a bomb news, every mass media announced that shit. and in first place goverment said: "we got 205 millions of dollars from a drug trafficker".... 2 weeks after they said: "Sorry, in the transportation from Zhenli Ye Gon´s house to a secure place, we counted 150 millions of dollars, we made a mistake ;D but the good new is that we got the money, and we will invest it for new hospitals, social security, better health care, etc, etc. and we gonna do a good country ;D"
BULLSHIT!! they've stolen rest money, our fucking goverment is a shit, the biggest shit in the entire world.... deputy, senators, governators and president steals a lot of money of mexico each year... when they get out from their "work", they put their money into a swiss bank and go for trip around the world.
Where is that 55 millions of dollar less??? well....Our dear president and his buddies had stolen it aswell >:(
And us, the mexicans have no the fault, even when we choose a "good" president/candidate, another political group kill him... for example: Luis Donaldo Colosio Murrieta who was murdered cuz he wanted to grow up Mexico, and another politicals haters whom only wants more money and power doesnt allow that México gets better.
http://en.wikipedia.org/wiki/Zhenli_Ye_Gon
compare these billss with into the pic.. :)
(http://nuevavisiondevida.files.wordpress.com/2010/01/500_pesos.jpg)
(http://cdn.vivirmexico.com/files/2007/12/1000_pesos.jpg)
-
You're not the only one who uses pesos for your currency ;_;
(http://www.cagayan-de-oro.com/500pesos.jpg)
(http://upload.wikimedia.org/wikipedia/en/e/eb/Php_bill_1000_front.jpg)
-
(http://obczaj.net/obrazki/113710.jpg)
(http://obczaj.net/obrazki/113738.jpg)
(http://obczaj.net/obrazki/113658.jpg)
(http://obczaj.net/obrazki/113660.jpg)
(http://obczaj.net/obrazki/113661.jpg)
:L
-
(http://static.pyzam.com/img/funnypics/6/pyzamlamplie.jpg)
(http://i36.tinypic.com/9lk239.jpg)
(http://a3.ac-images.myspacecdn.com/images01/13/l_2d18705ca73b3ca0fdeacf1785033bd2.jpg)
-
mmm that's one sexy lamp
-
it's from IKEA :)
-
(http://static.pyzam.com/img/funnypics/8/pyzamexplosivepoo.jpg)
(http://static.pyzam.com/img/funnypics/6/bargain.jpg)
-
http://www.youtube.com/watch?v=WlnqF9djPGM&playnext_from=TL&videos=df-4lu_ufaQ
it is in NL but it is so funny ;D
-
http://www.youtube.com/watch?v=WlnqF9djPGM&playnext_from=TL&videos=df-4lu_ufaQ
it is in NL but it is so funny ;D
Nooo this is funny :P (http://static.pyzam.com/img/funnypics/8/pyzamexplosivepoo.jpg)
-
eeeeeeeeeeew
-
[youtubeHD]pU_Y0QKimGM[/youtubeHD]
-
:(
very very very funny Sport for Ush ::) :D
[youtube]http://www.youtube.com/watch?v=3JPYpCBNYSI&feature=related[/youtube]
-
:L
-
my favourite sport :D
-
[youtube]http://www.youtube.com/watch?v=OJ2mftZpfGE[/youtube]
-
this ones are good
(http://obczaj.net/obrazki/114154.jpg)
(http://obczaj.net/obrazki/114153.jpg)
(http://obczaj.net/obrazki/114159.jpg)
(http://obczaj.net/obrazki/114176.jpg)
-
this ones are good
(http://obczaj.net/obrazki/114154.jpg)
hahahah :L
-
lool :L :L
-
NIN ftw Phobos :D
-
Indeed :)
-
hah i love doing that to people who are counting things
-
haha
-
Evil minds...
All the stuff are great people :D
-
Peruan police
[youtube]oqHaEOzjkCY[/youtube]
Ush's tribute
[youtube]oZ8mPPwhax4[/youtube]
Please use break! FFS
[youtube]1hUfNWJoE9g[/youtube]
-
[youtube]http://www.youtube.com/watch?v=vh5GcesvcxM[/youtube]
-
that makes me feel sick lol
-
he's fatter than a 10-year-old boy.
-
good read
-
good read
-
good read
-
good read
-
this is amazing
video that you can turn around 360*
http://edition.cnn.com/interactive/2010/01/world/haiti.360/index.html
-
that is just too cool :O
-
that is just too cool :O
(http://imgur.com/T72zu.jpg)
-
it is though :L i didn't even say anything about it not being funny :o
-
i know it was cool lol
-
360 degree view videos :o :o :o :o
http://www.immersivemedia.com/demos/index.php
-
Just because it's so cool!
(http://3.bp.blogspot.com/_KgIqQvYUs3I/SrfNuRu0t0I/AAAAAAAASsI/FpjF0Ffc_B0/s400/fridge_01_400x400.jpg)
-
360 degree view videos :o :o :o :o
http://www.immersivemedia.com/demos/index.php
Bleh, FireFox says it's a dangerous site...
-
(http://img.moronail.net/img/4/0/5240.jpg)
-
Just because it's so cool!
(http://3.bp.blogspot.com/_KgIqQvYUs3I/SrfNuRu0t0I/AAAAAAAASsI/FpjF0Ffc_B0/s400/fridge_01_400x400.jpg)
WHERE IS FOOD ???
-
360 degree view videos :o :o :o :o
http://www.immersivemedia.com/demos/index.php
Bleh, FireFox says it's a dangerous site...
lol its not, perfectly safe ;)
-
Deer felt it hard... :(
[youtube]http://www.youtube.com/watch?v=uQPn0vgnzik[/youtube]
-
poor animal :(
lol
-
[youtubeHD]pU_Y0QKimGM[/youtubeHD]
he used god 1
[youtube] vWK5MITJ1p4 [/youtube]
-
Snoopy's avatar is hardcore.
-
:o
-
The avatar before was nice softcore :L
-
[youtube]http://www.youtube.com/watch?v=r56jqb-fWVM[/youtube]
-
[youtube]http://www.youtube.com/watch?v=fLXGKBFX5Jg&feature=popular[/youtube]
[youtube]http://www.youtube.com/watch?v=4MWXLlHGK14&feature=related[/youtube]
-
cool video falky :D
[youtube]http://www.youtube.com/watch?v=r56jqb-fWVM[/youtube]
(http://imgur.com/myPrv.jpg)
(http://imgur.com/keATz.jpg)
-
cool video falky :D
[youtube]http://www.youtube.com/watch?v=r56jqb-fWVM[/youtube]
OMGROFLMAOWTF!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
hahahahahahaahahahahahahaah
-
Not a picture or a video...possibly not even true but watevaz...
This scene took place on a British Airways flight
between
Johannesburg, South Africa & London.
A white woman, about 50 years
old, was seated next to a black man.
Very disturbed by this, she called
the air hostess. "You
obviously do not see it then?" she asked. "You placed
me next to a
black man. I did not agree to sit next to someone from such a
repugnant
group. Give me an alternative seat." "Be calm please," the hostess
replied.
"Almost all the places on this flight are taken. I will go to see if
another place is available."
The hostess went away & then came back a
few minutes later.
"Madam, just as I thought, there are no other available
seats in Economy Class.
I spoke to the captain & he informed me that
there is also no seat in Business Class.
All the same, we still have one
place in First Class."
Before the woman could say anything, the hostess
continued. "It is unusual for our company
to permit someone from Economy
Class to sit in First Class. However, given the circumstances, the
captain
feels that it would be scandalous to make someone sit next to someone so
disgusting."
She turned to the black guy & said, "Therefore, Sir, if
you would like to,
please collect your hand luggage, a seat awaits you in
First Class."
At that moment, the other passengers, who'd been shocked by
what they had just witnessed,
stood up & applauded.
-
[youtube]http://www.youtube.com/watch?v=aZpD0btOZx8[/youtube][youtube]http://www.youtube.com/watch?v=yf56jYDv2fc&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=62snxI79d74[/youtube][youtube]http://www.youtube.com/watch?v=3cf50q4xpts[/youtube]
[youtube]http://www.youtube.com/watch?v=kcKurvm_0oE&feature=related[/youtube][youtube]http://www.youtube.com/watch?v=GI2a7_XfKaI&feature=related [/youtube]
-
[youtube]http://www.youtube.com/watch?v=JpBGRA6HHtY&feature=fvw[/youtube]
ahahahhahah :D
-
cool video falky :D
[youtube]http://www.youtube.com/watch?v=r56jqb-fWVM[/youtube]
Can you stop being racist just for once?
-
Can you learn to take a joke just for once?
-
I did several times with your island jokes. But it ain't cool so small favor, shush with it.
-
lol k, moody person.
-
Justin Bieber pwns herself!
[youtube]http://www.youtube.com/watch?v=3kJjeRpPtY0[/youtube]
-
he took it like a man... i mean kid :o
-
@ Justin Bieber : :L what a fail
(http://www.plaatjesupload.nl/bekijk/2010/06/03/1275563131-530.jpg) (http://www.plaatjesupload.nl/bekijken/2707620.html)
-
he took it like a man... i mean kid :o
hahahah :L
-
He would have been the reason for a third world war if hitler was still alive:
[youtube]http://www.youtube.com/watch?v=DkKqihEUmH4[/youtube]
-
wtf how did this little douchebag get so famous... it's like 6 years old
[youtube]http://www.youtube.com/watch?v=XuYAtlQMycI&feature=related[/youtube]
-
:L
-
(http://memegenerator.net/Justin-Bieber/ImageMacro/715220/Justin-Bieber-IM-A-HUGE-FUCKING-FAGOT-PLEASE-RAPE-MY-FACE.jpg)
-
(http://imgur.com/xbVZ9.jpg)
(http://imgur.com/C9aV7.jpg)
-
wtf how did this little douchebag get so famous... it's like 6 years old
with his female voice :L
-
''Wow, that girl has a really beautiful voice!'' "Mum, it's Justin Bieber.''
-
[youtube]GaQB_tgS7f0[/youtube]
-
wtf
-
*removed*
-
I wish they all died slow and painful dead, I wish they suffered more than the poor animals, fucking chinese assholes!!
-
i dont want to see that.... i dont think anybody else does neither
-
Good.
-
Whaaaat ?
-
a video of animals being killed
-
dolphins ?
-
dunno, I didn't get very far it was quite sick
-
Mainly dogs...
-
I've seen a video with dolphins being caught from the sea and then fishermen were cutting dolphins' heads and so on... :-X
-
=/
-
who is into crush videos?
-
didn't see the vid but does max think animals being killed is funny? :O
-
ovals and dead animals
-
didn't see the vid but does max think animals being killed is funny? :O
hmm it was pretty bad, hence why i removed it :(
max has a sick personality lol
-
didn't see the vid but does max think animals being killed is funny? :O
no, no, no, killing animals isn't funny, even keeping them in homes/zoos neighter
you should read what i typed:
it isn't funny but i had no idea where to post it
-
ah ok. i didn't see that cos the whole message got deleted.
-
ok, ok, btw is there any topic with NOT FUNNY disturbed and disgusting things?
-
lol no...
-
meh...
(http://www.thatsphucked.com/image.axd?picture=fish_hook_in_eye.jpg)
-
hilarious lmao
-
lol no...
found only this, but it is about disturbing crashes, cheenese dogs have nothing to do with it
http://forum.adrenalinex.co.uk/index.php/topic,855.0.html
-
:L :L :L
[youtube]http://www.youtube.com/watch?v=23cjXModWpA[/youtube]
-
:L
-
(http://forum.adrenalinex.co.uk/Smileys/default/tRDvJjVtKsqb6zdWUBdiJt7emmc.gif)
-
(http://forum.adrenalinex.co.uk/Smileys/default/tRDvJjVtKsqb6zdWUBdiJt7emmc.gif)
-
(http://imgur.com/FXMBQ.jpg)
-
:L
[youtube]http://www.youtube.com/watch?v=_Qe904nt1DQ[/youtube]
-
lol entertaining :P
-
Awesome :L
-
[Youtube]http://www.youtube.com/watch?v=jwMHD4mteMs&feature=related[/youtube]
:D :D :D
-
[youtube]http://www.youtube.com/watch?v=0o9u2W_iGNY[/youtube]
oops wrong topic. oh well
-
lol, this is supposed to be a robotic dog
[youtube]http://www.youtube.com/watch?v=nUQsRPJ1dYw[/youtube]
-
[youtube]http://www.youtube.com/watch?v=K4-vIccfBtw&feature=player_embedded[/youtube]
-
Take it as a picture XD
http://thelongestlistofthelongeststuffatthelongestdomainnameatlonglast.com/
-
this town owns
http://dailycaller.com/wp-content/uploads/Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.jpg
http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/
-
And finally, sadly even the 67 character allowance for a .com domain name is still insufficient for the town of Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu
in New Zealand with a staggering 92 characters however even this seems positively tiny compared to the town of
Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit
in Thailand which is a whopping 163 characters long so long that it doesn't even fit on one line! However whilst the New Zealand place name is recognised by the Guiness Book of Record, the Thailand name is not.
-
[youtube]qbqi0j7y_H8[/youtube]
-
[youtube]qbqi0j7y_H8[/youtube]
WTF :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
-
(http://obczaj.net/obrazki/115241.jpg)
-
:L
-
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
(http://hig-pan.cocolog-nifty.com/photos/iroiro/animated20wtf.gif)
(http://izismile.com/img/img2/20091009/wtf_gifs_50.gif)
(http://izismile.com/img/img2/20091009/wtf_gifs_49.gif)
-
This is not all, more pictures tomorrow :D
(http://imgur.com/4QDVy.jpg)
(http://imgur.com/8b8l7.jpg)
(http://imgur.com/s8r57.jpg)
(http://imgur.com/Q4zCs.jpg)
(http://imgur.com/jmwhR.jpg)
(http://imgur.com/2ztEx.jpg)
(http://imgur.com/m3Zbu.jpg)
(http://imgur.com/YFBJZ.jpg)
(http://imgur.com/dbyu0.jpg)
(http://imgur.com/1bVXR.jpg)
(http://imgur.com/NUCjT.jpg)
(http://imgur.com/VI5vw.jpg)
(http://imgur.com/RHarJ.jpg)
(http://imgur.com/Q5TV5.jpg)
(http://imgur.com/6SUfB.jpg)
(http://imgur.com/9QL1I.jpg)
(http://imgur.com/Yfvjk.jpg)
(http://imgur.com/ccvmV.jpg)
(http://imgur.com/allfn.jpg)
(http://imgur.com/69GQS.jpg)
(http://imgur.com/VQZs0.jpg)
(http://imgur.com/iwlTR.jpg)
(http://imgur.com/uu7JF.jpg)
(http://imgur.com/tkRw8.jpg)
Epic :L :L :L
(http://imgur.com/chqwU.jpg)
-
:L nice pics
-
(http://i50.tinypic.com/2h38ryr.jpg)
(http://i47.tinypic.com/5ma8mh.jpg)
(http://i47.tinypic.com/sazl92.jpg)
(http://i47.tinypic.com/27y24rb.jpg)
-
(http://www.3dhole.com/gtapics/shaderpics/wireframe.JPG)
-
lol mods
-
(http://img43.imageshack.us/img43/1167/annoyingorange.jpg)
-
[youtube]http://www.youtube.com/watch?v=NdoHHK27RMM[/youtube]
[youtube]http://www.youtube.com/watch?v=mDGFgrOruDc[/youtube]
:D :D
-
[youtube]http://www.youtube.com/watch?v=qmPmIJyi0sc[/youtube]
-
(http://img43.imageshack.us/img43/1167/annoyingorange.jpg)
(http://imgur.com/xofFm.jpg)
-
Snooooooooopy
(http://www.freewebs.com/infiniteentertainment/ugly%20dog.bmp)
-
that looks abit creepy imo
-
that's what i look like first thing in the morning :)
-
[youtube]http://www.youtube.com/watch?v=4QrTT0Ab5eI[/youtube]
o_O
-
dude this shit can make an emo look healthy
-
Give me a gun to shoot that bitch. Gee.
-
ha, vid removed
-
ha, vid removed
She deleted her channel, lol
(http://api.ning.com/files/6Br6wwFL5ngdj53XzKMcjft3HCOTyjwg5FE8OLmms1*zf3eCDy*xRNN2vNokPLeNgFRPuBRg8CgI-iKD4xb6omQiVvFSSZ0o/qn1abc.jpg)
-
:L
-
Another pictures tomorrow...
:L
(http://imgur.com/RI5wo.jpg)
(http://imgur.com/k74C5.jpg)
(http://imgur.com/0sOVb.jpg)
(http://imgur.com/1Acs4.jpg)
(http://imgur.com/s6Bwr.jpg)
(http://imgur.com/bRGZN.jpg)
(http://imgur.com/lgluH.jpg)
(http://imgur.com/hdEWb.jpg)
(http://imgur.com/Cos81.jpg)
(http://imgur.com/uHXHd.jpg)
(http://imgur.com/uc5oZ.jpg)
(http://imgur.com/MoAVb.jpg)
(http://imgur.com/qygb5.jpg)
(http://imgur.com/I1mZu.jpg)
(http://imgur.com/EZ2zh.jpg)
(http://imgur.com/BnS94.jpg)
(http://imgur.com/8z9FO.jpg)
(http://imgur.com/zmBvf.jpg)
(http://imgur.com/yCz7G.jpg)
(http://imgur.com/3Mu63.jpg)
(http://imgur.com/jn8A9.jpg)
-
(http://imgur.com/zmBvf.jpg)
Hahhaah :L :L :L
Cool!
-
(http://imgur.com/zmBvf.jpg)
:L
-
[youtube]3eZBevXohCI[/youtube]
[youtube]5blbv4WFriM[/youtube]
-
Both good ones lol
-
Heh second video owns :L
[youtube]http://www.youtube.com/watch?v=zORxjHm94wQ[/youtube]
-
JOHN FUCK YOU!
(http://poetry.rotten.com/john-fu/john-fu-1.jpg)
(http://poetry.rotten.com/john-fu/john-fu-2.jpg)
http://poetry.rotten.com/john-fu/
-
[youtube]se_YJEQ_HOQ[/youtube]
-
JOHN FUCK YOU!
(http://poetry.rotten.com/john-fu/john-fu-1.jpg)
(http://poetry.rotten.com/john-fu/john-fu-2.jpg)
http://poetry.rotten.com/john-fu/
:L
-
(http://imgur.com/brGNF.jpg)
(http://imgur.com/oBPgm.jpg)
(http://imgur.com/8J0Rl.jpg)
(http://imgur.com/PE8j8.jpg)
(http://imgur.com/Xc35N.jpg)
(http://imgur.com/MJznD.jpg)
(http://imgur.com/7ltTG.jpg)
(http://imgur.com/rIdUR.jpg)
(http://imgur.com/Adu8g.jpg)
(http://imgur.com/dki5o.jpg)
(http://imgur.com/V11pw.jpg)
(http://imgur.com/qAs6b.jpg)
(http://imgur.com/wjUxu.jpg)
(http://imgur.com/01P9a.jpg)
(http://imgur.com/vt6CV.jpg)
(http://imgur.com/PmU3J.jpg)
(http://imgur.com/gQ1yg.jpg)
(http://imgur.com/zOccf.jpg)
(http://imgur.com/OCLGl.jpg)
(http://imgur.com/cViBQ.jpg)
(http://imgur.com/xlcIL.jpg)
(http://imgur.com/6o4CQ.jpg)
(http://imgur.com/ZIW4a.jpg)
(http://imgur.com/2NitF.jpg)
-
╔╗╔═ ╦╗
║╚╣║ ║╚╗
╚═╩═ ╩═╝ more pls
-
:L so nicee
-
╔╗╔═ ╦╗
║╚╣║ ║╚╗
╚═╩═ ╩═╝ more pls
I'll try :D
-
RESPAWNED LOL :L
-
[youtube]http://www.youtube.com/watch?v=aJyznrgJeeo[/youtube]
-
jeeeeeeeeeeeeeeeeeeeeeeeeeez!
-
(http://img808.imageshack.us/img808/2423/cars.jpg)
-
Cool ;D
-
(http://obczaj.net/obrazki/116078.jpg)
-
hahah nice one max!
-
Looks like Jay Leno's garage.
-
old but great
(http://obczaj.net/obrazki/116487.jpg)
(http://obczaj.net/obrazki/116190.jpg)
(http://obczaj.net/obrazki/116371.jpg)
(http://obczaj.net/obrazki/116372.jpg)
(http://obczaj.net/obrazki/116375.jpg)
(http://obczaj.net/obrazki/116397.jpg)
(http://obczaj.net/obrazki/116405.jpg)
(http://obczaj.net/obrazki/116406.jpg)
(http://obczaj.net/obrazki/116419.jpg)
(http://obczaj.net/obrazki/116245.jpg)
(http://obczaj.net/obrazki/116306.jpg)
-
I love these :L
[youtube]http://www.youtube.com/watch?v=LCYPGnJdO1U&NR=1[/youtube]
[youtube]http://www.youtube.com/watch?v=u6JKP_W_HGY[/youtube]
[youtube]http://www.youtube.com/watch?v=bj3rIUxhxhQ[/youtube]
-
this owns
http://hosting.gmodules.com/ig/gadgets/file/112581010116074801021/hamster.swf?up_earColor=D4C898&up_foodColor=cba920&up_tailColor=E6DEBE&up_bodyColor=E6DEBE&up_eyeColor=000000&up_wheelSpokeColor=DEDEDE&up_waterColor=E0EFFF&up_wheelColor=FFFFFF&up_bgColor=FFFFFF&up_feetColor=D4C898&up_wheelCenterColor=E4EB2F&up_wheelOuterColor=FF4D4D&up_snoutColor=F7F4E9&
click anywhere on white to feed him lol
-
Haha max, that's cool :L
(http://img824.imageshack.us/img824/954/28396399758933859921551.jpg)
(http://img695.imageshack.us/img695/4414/28396399784868859921551.jpg)
(http://img689.imageshack.us/img689/2041/28396399796088859921551.jpg)
(http://img231.imageshack.us/img231/5901/28396399803913859921551.jpg)
(http://img256.imageshack.us/img256/6082/28396399807203859921551.jpg)
(http://img251.imageshack.us/img251/7968/28396399946758859921551.jpg)
(http://img51.imageshack.us/img51/4606/28396399961723859921551.jpg)
(http://img641.imageshack.us/img641/1456/28396399963808859921551.jpg)
(http://img823.imageshack.us/img823/2052/28396399969338859921551.jpg)
(http://img80.imageshack.us/img80/5677/28396399978518859921551.jpg)
(http://img34.imageshack.us/img34/2149/28396399980113859921551.jpg)
(http://img444.imageshack.us/img444/1791/28396399993423859921551.jpg)
(http://img217.imageshack.us/img217/5541/28396399998738859921551.jpg)
(http://img180.imageshack.us/img180/9738/28396399999353859921551.jpg)
(http://img810.imageshack.us/img810/3412/28396399999693859921551.jpg)
(http://img38.imageshack.us/img38/5324/28396400015813859921551.jpg)
(http://img718.imageshack.us/img718/2433/28396400024433859921551.jpg)
(http://img153.imageshack.us/img153/5158/28496400260433859921551.jpg)
(http://img121.imageshack.us/img121/2730/28496400264888859921551.jpg)
(http://img514.imageshack.us/img514/8310/28496400284558859921551.jpg)
(http://img683.imageshack.us/img683/7442/28496400285908859921551.jpg)
(http://img808.imageshack.us/img808/2489/28496400389638859921551.jpg)
-
nomnomnomnom tastyyy pizza
(http://obczaj.net/obrazki/116717.jpg)Haha max, that's cool :L
(http://img34.imageshack.us/img34/2149/28396399980113859921551.jpg)
haha cheap GPS... FAIL!
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc3/hs613.snc3/32268_133845789960025_100000038157631_368877_4756837_n.jpg)
(http://img819.imageshack.us/img819/2919/1276446810962.jpg)
(http://imgur.com/c1wXK.jpg)
(http://img517.imageshack.us/img517/4366/om3ms.png)
(http://img251.imageshack.us/img251/852/db1ux.jpg)
(http://img413.imageshack.us/img413/8008/ye85o.gif)
-
:L :L :L
-
(http://pics.blameitonthevoices.com/062010/small_vuvuzela%20instruction%20manual.jpg)
-
Haha max, that's cool :L
(http://img121.imageshack.us/img121/2730/28496400264888859921551.jpg)
LOL
-
Haha max, that's cool :L
(http://img121.imageshack.us/img121/2730/28496400264888859921551.jpg)
LOL
BOOMER!!!!
-
nomnomnomnom tastyyy pizza
(http://obczaj.net/obrazki/116717.jpg)
doesn't look like a pizza to me lol
-
some racing funny/jokes
(http://www.musclecars.faketrix.com/content/joke-pics/page3/original-files/racing-takes-two-balls.jpg)
NASCAR
(http://blogs.rockymountainnews.com/denver/drew/archives/drew0323toon.gif)
(http://holycrapthatsfunny.com/wp-content/uploads/2008/07/funny-graphs-nascar-race.gif)
(http://image.internetautoguide.com/f/auto-news/history-of-nascar-safety-advancements-by-cracked/29163255/nascar-safety-diagram-bad-crashes-funny-redneck.jpg)
(http://img.photobucket.com/albums/v174/Polypinoon/EUvsUS1.jpg)
(http://img143.imageshack.us/img143/268/bored5iu.jpg)
(http://www.skylinepictures.com/NASCAR_Darlington_Art_Print_na90b_large.jpg)
(http://www.skylinepictures.com/NASCAR_Daytona_Art_Print_na91b_large.jpg)
(http://www.skylinepictures.com/NASCAR_Talladega_Art_Print_na92b_large.jpg)
(http://www.skylinepictures.com/NASCAR_Indianapolis_Art_Print_na92b_large.jpg)
F1
(http://pic.phyrefile.com/a/an/anonymous/2008/09/08/2007.bmp)
(http://pic.phyrefile.com/a/an/anonymous/2008/09/08/keepwalking.jpg)
-
:L nice pics
-
(http://www.masalatime.com/world/wp-content/uploads/2010/06/08-2047658680.jpg)
(http://www.masalatime.com/world/wp-content/uploads/2010/06/08-2005892288.jpg)
(http://www.masalatime.com/world/wp-content/uploads/2010/06/08-1333735333.jpg)
(http://www.masalatime.com/img/8960.jpg)
(http://www.masalatime.com/img/8961.jpg)
(http://www.masalatime.com/img/8962.jpg)
-
fail Robert Green pics
-
(http://i47.tinypic.com/s3istg.jpg)
(http://filesmelt.com/dl/vuvuzela.png)
(http://i46.tinypic.com/eb6iv7.jpg)
(http://img51.imageshack.us/img51/3556/lolforhalloween.jpg)
(http://img411.imageshack.us/img411/4489/tumblrl1ydg57g211qzv0cv.png)
(http://img217.imageshack.us/img217/8971/outq.png)
(http://img715.imageshack.us/img715/9637/yeahlikethat.png)
-
(http://208.116.9.205/10/content/19555/1.jpg) (http://rdr.diff.abrutis.com/eb60e54065b98091aaef686ff4c2ce91full.jpg)
(http://i105.photobucket.com/albums/m206/mdv_03/funny%20icons/Funny.jpg) (http://rdr.diff.abrutis.com/73f89df87fff0914834b61df4d24b16bfull.jpg)
(http://rdr.diff.abrutis.com/c4975e00e198cb2d54649710eb3539b3full.jpg)
(http://rdr.diff.abrutis.com/3fd0f122f639d4a9bdc2532286e3787efull.jpg) (http://www.humourr.com/divers/images-humour/ballon_figure_lens.jpg)
(http://rdr.diff.abrutis.com/b10d85cf2709142951c87230a2a4cdbffull.jpg) (http://2.bp.blogspot.com/__TAirjGWfLU/SzpAebuk8OI/AAAAAAAACvY/Cq_dpj0zSbM/s400/funny_women.jpg)
(http://www.roflgirls.com/images/girls/funny-pictures-women-driver.jpg) (http://i297.photobucket.com/albums/mm220/AnnaMollyMadison/Bush/funny-george-bush-picture.jpg)
(http://static.funnyjunk.com/pictures/untitled1747.png)
(http://static.pyzam.com/img/funnypics/misc/In_Her_Pooper-1.jpg) (http://static.pyzam.com/img/funnypics/stupid/thoughts2.gif)
-
Dont you just love these?
(http://i216.photobucket.com/albums/cc29/Marikku_Goth/FUUUUU.jpg)
(http://i45.photobucket.com/albums/f92/killjojo/1230617613939.jpg)
(http://i187.photobucket.com/albums/x85/Snowgirl7/BTkky0Aujogb2zx9YADT7bSdo1_500.jpg)
(http://i48.tinypic.com/35bb8za.jpg)
(http://i4.photobucket.com/albums/y143/burny2/1221831478401.jpg)
(http://i42.tinypic.com/rji3vm.jpg)
-
very famous
[youtube]http://www.youtube.com/watch?v=vvR66bZBCIk[/youtube]
-
:L
-
(http://imgur.com/Qy0lZ.jpg)
(http://imgur.com/n0MIQ.jpg)
(http://imgur.com/5LAjW.jpg)
(http://imgur.com/1dgIl.jpg)
(http://imgur.com/cJyCQ.jpg)
(http://imgur.com/8pf7J.jpg)
(http://imgur.com/Qv9zA.jpg)
(http://imgur.com/bUkKJ.jpg)
(http://imgur.com/PQBbO.jpg)
(http://imgur.com/5BISY.jpg)
(http://imgur.com/rN1Ky.jpg)
(http://imgur.com/DZc3n.jpg)
(http://imgur.com/wIFiR.jpg)
(http://imgur.com/CU0bb.jpg)
(http://imgur.com/hcSht.jpg)
(http://imgur.com/oH5ME.jpg)
(http://imgur.com/u9CvZ.jpg)
(http://imgur.com/phHMK.jpg)
(http://imgur.com/R3r2u.jpg)
(http://imgur.com/ndK6v.jpg)
-
:L really nice man
-
;D
-
(http://imgur.com/1dgIl.jpg)
hawt
-
seee this video please iss more more funny ahahahahh
http://www.facebook.com/video/video.php?v=1132313194222
-
lol, this is great
and also true :L
[youtube]http://www.youtube.com/watch?v=LcbDXNaBwvg[/youtube]
-
it is coming....
...and it is really close....
WATCH OUT!
...THERE IS....
(http://obczaj.net/obrazki/117700.jpg)
LOL ;D :L
-
lol?
(http://driph.com/words/wp-content/uploads/2008/04/e.gif)
(http://lolphoto.net/wp-content/uploads/2010/03/bugfuckfb.jpg)
(http://lolphoto.net/wp-content/uploads/2010/03/gamefail.jpg)
(http://lolphoto.net/wp-content/uploads/2010/03/Fired.jpg)
(http://lolphoto.net/wp-content/uploads/2010/03/heavy.jpg)
(http://pictures.pichaus.com/e415099f63fd227368a6c2b6791e9f919c436a0e?AWSAccessKeyId=0K4RZZKHSB5N2XYJWF02&Expires=1276840000&Signature=1hGN5lBogiG%2FUUVKtjn2aQb88%2Bc%3D)
(http://)
found original old devil avatar
(http://pictures.pichaus.com/df34cc02f24db8c13c7e8bb4c76f81b973ab4bc0?AWSAccessKeyId=0K4RZZKHSB5N2XYJWF02&Expires=1276840000&Signature=cLzOrX6uLzOw5vtzJLgzeQ%2Fez5o%3D)
(http://pictures.pichaus.com/1429cf11b75691e64a8c4a814a4e42b95a5fa4d7?AWSAccessKeyId=0K4RZZKHSB5N2XYJWF02&Expires=1276840000&Signature=f7X5EJsy0M4wzbYkamVaKEg85EM%3D)
(http://pictures.pichaus.com/137de9e7957996a81d064178aec4863c86c593b4?AWSAccessKeyId=0K4RZZKHSB5N2XYJWF02&Expires=1276840000&Signature=NVwHtZ8hasaQc4mmWgLzyLThSds%3D)
(http://28.media.tumblr.com/tumblr_kx5z4tudec1qzw4mno1_500.jpg)
(http://pichaus.com/top-gu0ef7e26d7a434130b/y-snow-cars-@eb20ded4f3537a88bc455b4120c3c66f/)
(http://pichaus.com/bourdin-photographer-guy-fashion-@168941072a6ac5a)
(http://pictures.pichaus.com/b68a91bb89c0250f2194de7ede618cb563b00fe3?AWSAccessKeyId=0K4RZZKHSB5N2XYJWF02&Expires=1276840000&Signature=arm5TBJZHP0enmCtvwvB4rHmlhw%3D)
(http://25.media.tumblr.com/tumblr_l44ec9oQPK1qzrlhgo1_500.jpg)
(http://designyoutrust.com/wp-content/uploads7/3785951239_9611ccc5ac_o.jpg)
(http://imgur.com/lZWsn.jpg)
(http://i.imgur.com/63EKI.jpg)
(http://technabob.com/blog/wp-content/uploads/2010/05/guide_to_pac_man_ghosts.jpg)
(http://designyoutrust.com/wp-content/uploads7/3786014173_248c80b900_o.jpg)
(http://www.humor4life.com/m_pictures/weddings_are_beautiful_500x500.jpg)
(http://www.humor4life.com/m_pictures/ebay0.jpg)
-
[youtubeHD]qKQAGh01ZaY[/youtubeHD]
-
Good album btw, I already got it :D It leaked
-
@scorps pics :L
-
LOL. I just got the reference:
(http://upload.wikimedia.org/wikipedia/commons/thumb/c/c7/Firth_of_Forth_bridges_panorama_by_Greg_Barbier_13750x1915.jpg/1400px-Firth_of_Forth_bridges_panorama_by_Greg_Barbier_13750x1915.jpg)
...look familiar? Guess where this is.
-
San Francisco (San Fierro) :D Or am I wrong about San Francisco? :-X
-
(http://sp7.fotologs.net/photo/23/36/35/simpson_exaaacto/1203549832_f.jpg)
-
(http://upload.wikimedia.org/wikipedia/commons/thumb/c/c7/Firth_of_Forth_bridges_panorama_by_Greg_Barbier_13750x1915.jpg/1400px-Firth_of_Forth_bridges_panorama_by_Greg_Barbier_13750x1915.jpg)
San Francisco (San Fierro) :D Or am I wrong about San Francisco? :-X
Actually, it's the River Forth in Scotland. A sneaky reference by (Scottish) R*.
(http://img203.imageshack.us/img203/9396/lolpictures20.jpg)
-
(http://i45.tinypic.com/xfqfxf.jpg)
-
(http://i45.tinypic.com/xfqfxf.jpg)
really really nice one firebox!!
i laughted about these pics with my workmates... when i worked xD cuz our coworkers do somethings like those... but no so huge stunt like this one
-
What's the point of quoting a post above yours lol
-
(http://www.everythingweird.com/images/afro-hair-cap_49.jpg)
-
Hahaha nice hair :L
-
devil @ those "stunt" are awesome when the ppl does it... u must to see it on person
[youtube]DYnz_06hcUI[/youtube]
-
can't wait
-
This one is awesome :L
[youtube]HFZtOk42ets[/youtube]
-
This is amazing...
[youtube]H23HDHRVjpA[/youtube]
-
Nais. Now he can play modern warfare in his house :D
-
agree with this one lol
(http://obczaj.net/obrazki/118999.jpg)
(http://obczaj.net/obrazki/118969.jpg)
(http://obczaj.net/obrazki/118892.jpg)
(http://obczaj.net/obrazki/119016.jpg)
(http://obczaj.net/obrazki/118895.jpg)
-
:L :L
-
:L :L
[youtube]http://www.youtube.com/watch?v=xbsSeVr5NSI[/youtube]
[youtube]http://www.youtube.com/watch?v=tC5FgQU-gns[/youtube]
-
agree with this one lol
(http://obczaj.net/obrazki/118999.jpg)
(http://obczaj.net/obrazki/118969.jpg)
(http://obczaj.net/obrazki/118892.jpg)
(http://obczaj.net/obrazki/119016.jpg)
(http://obczaj.net/obrazki/118895.jpg)
:L
-
world's smallest plane to carry people
[youtube]http://www.youtube.com/watch?v=TDmnjwbJrVM[/youtube]
and very intersting, and for sure taking a lot of time work
click this link, and when see text press ctrl+a (select all)
http://fichtre.net/yop.html
-
(http://img28.imageshack.us/img28/3873/3d0afb25tumblrl4dzyadef.jpg)
-
Chimp rapes a frog:
[youtube]qVE60zwXx1k[/youtube]
-
Simon you pervert!
-
So wrong.
-
not watching
-
lol and they let the kids watch it
-
(http://de.ifun.ru/x/v/xvydhua2.gif)
(http://de.ifun.ru/8/o/8on5vdnt.gif)
(http://de.ifun.ru/2/l/2lc0aqfu.gif)
-
:P:P
-
1st place in category SAFTY AT WORK
(http://obczaj.net/obrazki/119308.jpg)
if websites were people...
(http://obczaj.net/obrazki/119218.jpg)
-
4chan ftw
-
[YOUTUBE]http://www.youtube.com/watch?v=Pvj94XapyEU[/YOUTUBE]
[youtube]http://www.youtube.com/watch?v=nooIM9OdEps[/YOUTUBE]
-
Snoop Dogg in Amsterdam, enjoy!
[youtube]http://www.youtube.com/watch?v=OjL1Ftkjpug[/youtube]
-
In Amsterdam, their white people are as cool as black people.
Also, I have those Locs glasses, £7 on eBay. :D
-
In Amsterdam, their white people are as cool as black people.
Also, I have those Locs glasses, £7 on eBay. :D
ha, that shows even superstars like cheap stuff ;D
-
[youtube]http://www.youtube.com/watch?v=AzR_YkFhnNc[/youtube]
-
[youtube]http://www.youtube.com/watch?v=AzR_YkFhnNc[/youtube]
is he mad????????? nice one Jar :)
see this :D
http://www.youtube.com/watch?v=FQlgA68z_L4
-
vuvusela :D
http://www.youtube.com/watch?v=E2FYLCohgfM&feature=related
-
vuvusela :D
http://www.youtube.com/watch?v=E2FYLCohgfM&feature=related
:L :L :L :L :L :L :L :L :L :L :L
niceeeeee
-
vuvusela :D
http://www.youtube.com/watch?v=E2FYLCohgfM&feature=related
:L :L :L :L :L :L :L :L :L :L :L hahaha
niceeeeee
-
[youtube]BlaP7mx_kB8[/youtube]
-
thats quite disturbing
-
FAIL
(http://obczaj.net/obrazki/119817.jpg)
FAIL
(http://obczaj.net/obrazki/119827.jpg)
-
pwned
(http://images.paraorkut.com/img/funnypics/images/m/motorcycle_fail-12827.png)
wtf ???
(http://www.samizdata.net/blog/~pdeh/epicFAIL.jpg)
-
(http://i.imgur.com/rLP1S.jpg)
-
nice one, hehe toyota camry nascar, here before crashing
(http://paddocktalk.com/news/html/modules/ew_filemanager/08content/nascar/toyota/richmond/nascar-hamlin-pole-2.jpg)
-
(http://www.pckz.cl/blog/wp-content/uploads/2010/06/picinazoforce4501.gif)
(http://img175.imageshack.us/img175/1728/1277666137502.gif)
(http://www.pckz.cl/blog/wp-content/uploads/2010/06/torres.gif)
(http://img443.imageshack.us/img443/1870/121834800.jpg)
(http://9gag.com/photo/27606_540.jpg)
(http://www.pckz.cl/blog/wp-content/uploads/2010/06/21joh3q.jpg.gif)
(http://i84.photobucket.com/albums/k9/thelilpimp2/gol2.jpg)
(http://www.plaatjesupload.nl/bekijk/2010/06/18/1276850560-090.gif)
(http://www.mundoimg.com/imagenes/deportes/236747_mundoimg_rorok_2qks11e.gif)
-
[youtube]http://www.youtube.com/watch?v=AzR_YkFhnNc[/youtube]
is italian journalist of Milan Calcio
-
lol nice pictures fantomas :D
-
lol nice pictures fantomas :D
haha those are great :L
-
[youtube]http://www.youtube.com/watch?v=B7NTYeRg5Dg[/youtube]
-
great pics hahaha
-
I think this is better.
(http://img824.imageshack.us/img824/5165/wwwhotcelebsandmodelsbl.jpg)
-
heh, one of them got black socks lol. but no goalie outfit..
-
what was too scary for "Rambo"?...
(http://obczaj.net/obrazki/119866.jpg)
-
I think this is better.
(http://img824.imageshack.us/img824/5165/wwwhotcelebsandmodelsbl.jpg)
If they show this team on tv, i'm sure the channel will have 50% of the country watching. No matter what the level of the team is.
Is that an ad for puma? they're all wearingpuma shoes, different colours.
-
what was too scary for "Rambo"?...
(http://obczaj.net/obrazki/119866.jpg)
:L
-
Online Gamer Ep. 4
http://www.recklesstortuga.com/online-gamer/online-gamer-ep-4/
-
this is funny lol
24 ways to die
[youtube]http://www.youtube.com/watch?v=rTJLp2AUz_o[/youtube]
-
lol max, this is funnier :P
[youtube]http://www.youtube.com/watch?v=p32OC97aNqc[/youtube]
-
(http://obczaj.net/obrazki/119989.jpg)
coca cola in LOTR
(http://obczaj.net/obrazki/119920.jpg)
-
Vuvuzela vs Dog
[youtube]http://www.youtube.com/watch?v=Gqv4Vviod0c[/youtube]
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs015.ash2/34128_114126828633770_111797082200078_84921_6591365_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=koM4wyfCA_c[/youtube]
-
:L
-
Courtesy of Gen:
www.meatspin.com
-
http://www.youtube.com/watch?v=Z_S3phLKU30
-
fuck sake, simon,
http://www.2guys1horse.com/ (18+ highly disgusting)
-
(http://standardmadness.com/wp-content/uploads/2010/06/gravity-wins-01.jpg)
(http://standardmadness.com/wp-content/uploads/2010/06/gravity-wins-021.jpg)
-
the girl on the left is damn ugly lol
-
(http://obczaj.net/obrazki/120016.jpg)
(http://obczaj.net/obrazki/120018.jpg)
(http://obczaj.net/obrazki/120024.jpg)
Harrier (GTA Hydra LOL)
(http://obczaj.net/obrazki/120035.jpg)
-
LOL @ the vuvuzela
-
(http://imgur.com/yZV0f.jpg)
-
lol
-
(http://imgur.com/yZV0f.jpg)
ftw lol
-
Nice commercials lol
[youtube]http://www.youtube.com/watch?v=61AGuq1AnKI[/youtube]
-
The 1st one was lol
-
(http://images-0.redbubble.com/img/art/size:ularge/view:main/983330-3-a-fish-out-of-water.jpg)
-
(http://imgur.com/kUTnl.png)
lmao
-
New Vuvuzela By Me :D
(http://img204.imageshack.us/img204/1894/y1p1aaopxnh0fyiogjfcpjt.jpg)
(http://www.asjolly.it/emoticons/ahah.gif)
-
":L
-
(http://v7.lt/images/1277458114.jpg)
-
moobs
-
:L england
-
hahaha im embarrassed now lol
-
(http://blogs.warwick.ac.uk/images/luoxu/2004/11/22/img415ff861ae77e.jpg)
-
lol @ the american, no offence pod :P
-
this one is amazing
[youtube]http://www.youtube.com/watch?v=ODUqJCVL0K4[/youtube]
-
it's at saint martin, the airfield is right after the beach and every plane has to land that way.. you can stand beneath it and get blown away. it's a dutch/french island in the carribean.
-
korea and argentina hawt
-
(http://demotywatory.pl/uploads/201007/1278335234_by_Tezeterka_500.jpg)
-
nice":)
-
(http://imgur.com/kUTnl.png)
lmao
:L :L :L
-
(http://imgur.com/kUTnl.png)
lmao
:L :L :L
ROFL ive realised what it is :L :L :L :L :L :L :L
-
tell me, i can't figure it out myself :(
-
F.U.
(http://kontraband.se/blog/wp-content/uploads/2009/07/hypno.gif)
-
headache :(
-
headache :(
(http://1.bp.blogspot.com/_4B6BR9aWHAk/SL7gXrHm9AI/AAAAAAAAA1c/Hd9sLtfY7Ng/s400/weird-faces-069.jpg)
-
[youtube]http://www.youtube.com/watch?v=Oe0NPIMAsMQ[/youtube]
-
[youtube]http://www.youtube.com/watch?v=ez7i17g9Cm0[/youtube]
[youtube]http://www.youtube.com/watch?v=jF0wtJtqpIw&feature=fvw[/youtube]
ahahahaha ;D
-
[youtube]http://www.youtube.com/watch?v=lPtV-k15eqg&feature=related[/youtube]
-
Greatest of the photoshop yet!
(http://pix.motivatedphotos.com/2008/11/6/633615982105301408-Photoshop.jpg)
-
(http://obczaj.net/obrazki/120262.jpg)
-
nice animation, just watch it
http://vimeo.com/13094046
-
That's really nice :)
-
[youtube]http://www.youtube.com/watch?v=T-dQ4mXV0JY[/youtube]
-
(http://obczaj.net/obrazki/120262.jpg)
???? ??? ??? ???
-
???? ??? ??? ???
It's because she looks like a dirty crack-whore...which we call a 'train wreck.' Because like the disaster, it's such a tragic waste of human life. :)
-
in America, they are goin to record Darth Vaders voice for GPS. and there is ad
[youtube]http://www.youtube.com/watch?v=2ljFfL-mL70&playnext_from=TL&videos=tgAmndvEaHU[/youtube]
-
in America, they are goin to record Darth Vaders voice for GPS. and there is ad
[youtube]http://www.youtube.com/watch?v=2ljFfL-mL70&playnext_from=TL&videos=tgAmndvEaHU[/youtube]
:L
-
Is there any way you can make it sound little less depressing ?
Exit right ahead!?
Don't force it
:L
-
And we thought we were cool in our Sandkings...
[youtube]3EotjNThcAs[/youtube]
-
I wish Forza was not only on Xbox :-\ This is way better than our football matches :L
-
I wish Forza was not only on Xbox :-\ This is way better than our football matches :L
GT5 will come...eventually...maybe our children will live to play it.
-
And we thought we were cool in our Sandkings...
[youtube]3EotjNThcAs[/youtube]
Haha nice.
-
gosh, I didn't know about 2guyz1horse
I watched only 2 secs, it was enough for me ._.
-
gosh, I didn't know about 2guyz1horse
I watched only 2 secs, it was enough for me ._.
:L :L :L :L
-
u missed the hardcore part, that guy gotta be a mess on the inside
-
Best shot ever @1min
Better physics :( But our match is still cool to watch beside this :)
-
[YOUTUBE]http://www.youtube.com/watch?v=RRjpzH--Y28&feature=related[/YOUTUBE]
-
(http://i.imgur.com/5v39L.jpg)
(http://i.imgur.com/5OenM.png)
(http://i.imgur.com/7HMRE.jpg)
(http://i.imgur.com/2qLyo.jpg)
-
(http://i.imgur.com/7HMRE.jpg)
wtf :L
and lol @ the toilet paper :D
-
http://en.wiktionary.org/wiki/I'm_afraid_not
-
[youtube]QoZrqTbW_zg[/youtube]
-
i already seen it but i still want 1 ;D ;D ;D
-
(http://www.zipfm.lt/upl/polls/question833_2.jpg)
-
lol
-
(http://imgur.com/GKdW3.jpg)
-
i want a blow up doll lol.... :-X
-
why? doesn't your gf satisfy you enough?
-
lol, you can them carry them anywhere :D
-
pontoon to swim (spin)
-
[youtube]http://www.youtube.com/watch?v=DMhmXBuUkzs[/youtube]
-
(http://www.moronail.net/images/stories/dg_pictures/1007/0DE485B917C0-1.jpg)
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc3/hs172.snc3/19980_271237228799_553583799_3469070_5399437_n.jpg)
-
(http://lameness.info/wordpress/wp-content/uploads/2009/01/makeitcount.jpg)
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc3/hs168.snc3/19574_1184606223038_1464723743_30397606_3215005_n.jpg)
-
AWKWARD FAMILY PHOTOS!!!
(http://izismile.com/img/img3/20100706/640/awkward_family_photos_640_01.jpg)
(http://izismile.com/img/img3/20100706/640/awkward_family_photos_640_03.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_14.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_01.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_05.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_06.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_07.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_28.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_34.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_35.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_36.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_41.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_50.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_53.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_54.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_48.jpg)
(http://izismile.com/img/img2/20090820/family_2_15.jpg)
(http://izismile.com/img/img2/20090820/family_2_11.jpg)
(http://izismile.com/img/img2/20090820/family_2_06.jpg)
(http://izismile.com/img/img2/20090820/family_2_05.jpg)
(http://izismile.com/img/img2/20090820/family_2_24.jpg)
(http://izismile.com/img/img2/20090820/family_2_25.jpg)
(http://izismile.com/img/img2/20090820/family_2_28.jpg)
(http://izismile.com/img/img2/20090820/family_2_29.jpg)
(http://izismile.com/img/img2/20090820/family_2_32.jpg)
(http://izismile.com/img/img2/20090820/family_2_35.jpg)
(http://izismile.com/img/img2/20090820/family_2_36.jpg)
(http://izismile.com/img/img2/20090820/family_2_37.jpg)
(http://izismile.com/img/img2/20090820/family_2_38.jpg)
(http://izismile.com/img/img2/20090820/family_2_44.jpg)
(http://izismile.com/img/img2/20090820/family_2_48.jpg)
(http://izismile.com/img/img2/20090512/family_37.jpg)
(http://izismile.com/img/img2/20090512/family_36.jpg)
(http://izismile.com/img/img2/20090512/family_35.jpg)
(http://izismile.com/img/img2/20090512/family_33.jpg)
(http://izismile.com/img/img2/20090512/family_30.jpg)
(http://izismile.com/img/img2/20090512/family_27.jpg)
(http://izismile.com/img/img2/20090512/family_26.jpg)
(http://izismile.com/img/img2/20090512/family_20.jpg)
(http://izismile.com/img/img2/20090512/family_19.jpg)
(http://izismile.com/img/img2/20090512/family_17.jpg)
(http://izismile.com/img/img2/20090512/family_16.jpg)
(http://izismile.com/img/img2/20090512/family_15.jpg)
(http://izismile.com/img/img2/20090512/family_13.jpg)
(http://izismile.com/img/img2/20090512/family_07.jpg)
(http://izismile.com/img/img2/20090512/family_06.jpg)
(http://izismile.com/img/img2/20090512/family_05.jpg)
(http://izismile.com/img/img2/20090512/family_04.jpg)
(http://izismile.com/img/img2/20090512/family_03.jpg)
-
FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW!
FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW!
FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW!
FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW!
-
lulz pics
-
lol
-
(http://i.imgur.com/CQBQU.png)
-
[youtube]http://www.youtube.com/watch?v=ZPBvFXf9Q2U[/youtube]
-
Haha, great pictures Bunny :L
-
Why we love japan!
[youtube]0rm5j1WYi94[/youtube]
[youtube]igC4bPDp6cU[/youtube]
[youtube]LhXaFUlTwm0[/youtube]
[youtube]8iR0b2sNJbo[/youtube]
[youtube]c7paSzXEe2Q[/youtube]
no apts for embittereds
-
lol, they're the craziest people in the world :L
-
The Chuck Norris from India
[youtube]_K9AxO5t4BE[/youtube]
-
lol, sick movie
btw some pictures
(http://obczaj.net/obrazki/120718.jpg)
(http://obczaj.net/obrazki/120723.jpg)
(http://obczaj.net/obrazki/120733.jpg)
(http://obczaj.net/obrazki/120747.jpg)
(http://obczaj.net/obrazki/120755.jpg)
(http://obczaj.net/obrazki/120660.jpg)
(http://obczaj.net/obrazki/120664.jpg)
japan is really fucked
(http://obczaj.net/obrazki/120738.jpg)
-
:D nice pics Max
-
nice lol
-
The Chuck Norris from India
lol that horse slide under the truck FTW!!!
-
[youtube]http://www.youtube.com/watch?v=VmgdcBBGieg[/youtube]
-
1 more fun
(http://obczaj.net/obrazki/120866.jpg)
(http://obczaj.net/obrazki/120876.jpg)
(http://obczaj.net/obrazki/120897.jpg)
(http://obczaj.net/obrazki/120919.jpg)
(http://obczaj.net/obrazki/120939.jpg)
(http://obczaj.net/obrazki/120818.jpg)
(http://obczaj.net/obrazki/120819.jpg)
(http://obczaj.net/obrazki/120824.jpg)
(http://obczaj.net/obrazki/120847.jpg)
Porshee is for loosers, thats true lol
(http://obczaj.net/obrazki/120839.jpg)
in NASA lose money
(http://obczaj.net/obrazki/120908.jpg)
-
:L they are good ;) where found you them????
-
found this picture in my mobile, taken in winter :D
(http://imgur.com/5UfQl.jpg)
(http://imgur.com/p9vRa.jpg)
(http://imgur.com/rDbIX.jpg)
(http://imgur.com/K0cHo.jpg)
(http://imgur.com/0kRxs.jpg)
(http://imgur.com/HbW4L.jpg)
(http://imgur.com/NB4LG.jpg)
(http://imgur.com/lLlo9.jpg)
(http://imgur.com/D19bb.jpg)
(http://imgur.com/dAPcv.jpg)
(http://imgur.com/S7zFh.jpg)
(http://imgur.com/3F8sf.jpg)
(http://imgur.com/cYZpx.jpg)
(http://imgur.com/QrSzL.jpg)
(http://imgur.com/PurOo.jpg)
(http://imgur.com/FRklH.jpg)
(http://imgur.com/I7FpL.jpg)
(http://imgur.com/QsURV.jpg)
(http://imgur.com/gxxps.jpg)
(http://imgur.com/lrrXP.gif)
(http://imgur.com/3AtKr.jpg)
(http://imgur.com/l5Iej.jpg)
(http://imgur.com/jERwS.jpg)
(http://imgur.com/8ntu1.jpg)
(http://imgur.com/j3hul.jpg)
(http://imgur.com/DauUP.jpg)
-
haha xD
-
:L :L
-
awesum :L
-
http://www.dumpert.nl/mediabase/1047891/37406783/winkelwagen_bommetje.html
http://www.dumpert.nl/mediabase/841951/fe47b5c2/cameraman_moet_even_uitblazen.html
http://www.dumpert.nl/mediabase/778341/af4a667a/chinese_oma_leert_engels.html
-
http://kewl.bz/425
-
http://kewl.bz/425
LMAO!! :L :L :L
-
http://kewl.bz/?id=323
-
[youtube]http://www.youtube.com/watch?v=5OjJevHNIU0&feature=fvw[/youtube]
-
Militant Black Guy :D
Seen those videos like 500 times. :o
-
fail
(http://imgur.com/esGw3.jpg)
(http://imgur.com/6Jt2G.jpg)
(http://imgur.com/9MoR3.jpg)
(http://imgur.com/iPpJW.jpg)
(http://imgur.com/mJcN6.jpg)
(http://imgur.com/cJTSE.jpg)
(http://imgur.com/5751k.jpg)
(http://imgur.com/9e11n.jpg)
(http://imgur.com/pzEas.jpg)
(http://imgur.com/TGHnn.jpg)
(http://imgur.com/Y0IVN.jpg)
(http://imgur.com/pxmRc.jpg)
(http://imgur.com/gZ8hG.jpg)
(http://imgur.com/c4rq0.jpg)
(http://imgur.com/SI2pI.jpg)
(http://imgur.com/u1hGL.jpg)
(http://imgur.com/npsfx.jpg)
(http://imgur.com/hog26.jpg)
(http://imgur.com/6nk8Z.jpg)
(http://imgur.com/MTTap.jpg)
(http://imgur.com/fSmcn.jpg)
(http://imgur.com/OxDzD.jpg)
(http://imgur.com/dFQ4H.jpg)
(http://imgur.com/wySsP.jpg)
haha :L
[youtube]http://www.youtube.com/watch?v=VqBy6TgYxTU&NR=1[/youtube]
-
me(on the left), and my friends ;D for u iron :P :D
(http://i30.tinypic.com/2q8y39y.jpg)
-
(http://imgur.com/Igqiz.gif)
(http://imgur.com/mRRkJ.gif)
(http://i.imgur.com/h79KF.gif)
-
(http://imgur.com/Igqiz.gif)
hahahaha
-
(http://imgur.com/QXUJ2.jpg)
(http://imgur.com/P1zfX.jpg)
(http://imgur.com/9V6Oy.jpg)
(http://imgur.com/fDqjh.jpg)
(http://imgur.com/VFe80.jpg)
(http://imgur.com/UNFEZ.jpg)
(http://imgur.com/gCgXZ.jpg)
(http://imgur.com/Gkh7Q.jpg)
(http://imgur.com/X3QFL.jpg)
(http://imgur.com/whO74.jpg)
(http://imgur.com/6zGkQ.jpg)
(http://imgur.com/fgNgY.jpg)
(http://imgur.com/x9jSX.jpg)
(http://imgur.com/fzKrq.jpg)
(http://imgur.com/6jwk3.jpg)
(http://imgur.com/vamWm.jpg)
(http://imgur.com/9JVsc.jpg)
(http://imgur.com/FX7Oo.jpg)
(http://imgur.com/b8ybX.jpg)
(http://imgur.com/ojlRe.jpg)
(http://imgur.com/J9XlV.jpg)
(http://imgur.com/WR8Lv.jpg)
(http://imgur.com/uv02b.jpg)
(http://imgur.com/ziJpP.jpg)
-
nice :L
-
Typical black guy reactions.
[youtube]http://www.youtube.com/watch?v=4vZ-jF_1suE[/youtube]
-
lol his laughs are funny
-
:L that face
-
[youtube]http://www.youtube.com/watch?v=JP5mSDfCPsU[/youtube]
haha lol
-
lol he got killed twice
-
(http://imgur.com/vXsLn.jpg)
(http://imgur.com/O9Q4L.jpg)
(http://imgur.com/0YsZJ.jpg)
(http://imgur.com/JIAWA.jpg)
(http://imgur.com/1xzVc.jpg)
(http://imgur.com/mVLbM.jpg)
(http://imgur.com/qK3mv.jpg)
(http://imgur.com/Irx6N.jpg)
(http://imgur.com/NIzqM.jpg)
(http://imgur.com/28yk1.jpg)
(http://imgur.com/6vAob.jpg)
(http://imgur.com/fX5RS.jpg)
(http://imgur.com/i3E4a.jpg)
(http://imgur.com/X0IcW.jpg)
(http://imgur.com/m64B1.jpg)
(http://imgur.com/6tOAS.jpg)
(http://imgur.com/kO1G3.jpg)
if you don't understand, it means that he wrote "I will not throw paper airplanes in class." 500 times :D
(http://imgur.com/9GyrX.jpg)
(http://imgur.com/cnYic.jpg)
(http://imgur.com/q08uw.jpg)
(http://imgur.com/rzKgR.jpg)
(http://imgur.com/TC0j8.jpg)
(http://imgur.com/AQwOL.jpg)
-
(http://i31.tinypic.com/r0uxki.jpg)
-
lol haha
-
lol Sabre from Hell?
-
:L
-
(http://farm4.static.flickr.com/3159/2741943002_d677f2f706_o.gif)
-
:L
-
(http://i.imgur.com/t0UZj.jpg)
-
haha that got me
-
Haha
-
(http://obczaj.net/obrazki/121616.jpg)
(http://obczaj.net/obrazki/121622.jpg)
(http://obczaj.net/obrazki/121624.jpg)
(http://obczaj.net/obrazki/121533.jpg)
(http://obczaj.net/obrazki/121567.jpg)
(http://obczaj.net/obrazki/121568.jpg)
-
haha :L
-
http://kewl.bz/334
-
[youtube]http://www.youtube.com/watch?v=kvFokICvrfQ[/youtube]
-
(http://i48.tinypic.com/2nbcdgz.jpg)
(http://i47.tinypic.com/ng3pyw.jpg)
(http://i43.tinypic.com/25qfc4y.gif)
(http://img42.imageshack.us/img42/1434/advicecolumnv.jpg)
(http://api.ning.com/files/3Uoavia5AHrznA43OFJPxIjTQCCNeZAKYkIXTTlFwCTnJt3PJsZxSBu7kJVODTok*mOxIHzBPvz9Dgq5DL0FW7OAytEiAZNw/mcowned.jpg)
(http://api.ning.com/files/QUvlndC6HSe9RPJjplRu2lF7IlNxtlRhd*vIs*5ePj*R*w9hrmMt9YNQ0b7tET-vGH*GwyU37McxoARPg*XsbXyov14eANOj/plomero.jpg)
(http://api.ning.com/files/iBf26E95P54myhXk4IRHgEVdQF0umegTLp5XlFGg9k9Z-BnSkgz8MkTqv93LKxK4KFOz2cbMM7WGT29*xPLSN5ACLBBFqGDG/gps.jpg)
(http://api.ning.com/files/Elcx4MplAu*cF0RUSsf6RfhSPzyXqNie*j7FIFD9zMe5rJpv15QP0r0g7OxRXEfA4lqJWTxYS5pyJYfOylzBFRMHtgxtmQ9q/divorcedcar.jpg)
(http://api.ning.com/files/sGz3jAB9itBU4YI84zVPFyH5FoDXPIufi*NLtc340yEJdTkkb*VsaKGact3qj*rUNKMr7KLVRuQ4D3LeTSUSPEhLMuMOIZ*K/car_half.jpg)
(http://api.ning.com/files/wTtB8u*3tF4hosV9ov2RuVWNjD2YbnSvsmJmZRX7ARRjRUbMlIXvDwASc0CP5iqD8ba32m3u4QFThvW3CUaR4OsjLB7MA24P/onehorsepowercar.jpg)
(http://blogs.elcorreo.com/blogfiles/laotrafaz/bano.JPG)
(http://img641.imageshack.us/img641/9806/1255808056042.jpg)
(http://usuarios.multimania.es/kronoxweb/humor/grafico/DobleSentido1.jpg)
(http://img7.imageshack.us/img7/8136/lmaoeqb.jpg)
(http://img194.imageshack.us/img194/2718/rofle.jpg)
(http://photos-b.ak.fbcdn.net/hphotos-ak-snc3/hs195.snc3/20265_482009815318_715230318_11239929_6400591_n.jpg)
(http://www.eatliver.com/img/2009/3849.jpg)
-
Pyro might know about this since he's from Cork :L
[youtube]http://www.youtube.com/watch?v=nVVet6TNoyA[/youtube]
-
[youtube]http://www.youtube.com/watch?v=FHIZ2Jl2vuQ[/youtube]
skip to :50 on this one:
[youtube]http://www.youtube.com/watch?v=364dzVsBs2o[/youtube]
-
haha, insane videos lol
-
[youtube]http://www.youtube.com/watch?v=FHIZ2Jl2vuQ[/youtube]
:(
-
:L Fantomas nice pics
-
fun vids
-
[youtube]http://www.youtube.com/watch?v=2waIvp265CM[/youtube]
-
pod isn't a girl ??? ??? :-[ :'(
i think is girl :(
lmao
then again, I didn't even know pod was human :-[
-
Fail :L :L
[youtube]http://www.youtube.com/watch?v=ikdKvmkt6Rg[/youtube]
-
:L
-
lol @ 3:25
[youtube]http://www.youtube.com/watch?v=JqqKtqdrh7g[/youtube]
-
Hah :L
-
(http://obczaj.net/obrazki/121716.jpg)
(http://obczaj.net/obrazki/121719.jpg)
(http://obczaj.net/obrazki/121720.jpg)
(http://obczaj.net/obrazki/121721.jpg)
(http://obczaj.net/obrazki/121722.jpg)
(http://obczaj.net/obrazki/121655.jpg)
(http://obczaj.net/obrazki/121668.jpg)
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs069.ash2/36828_115486145170058_100001260200279_105121_970070_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs106.ash2/38655_142981422393596_100000452173346_311466_4711246_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs134.ash2/40046_145657125460614_100000489831628_368781_3305387_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs023.snc4/33499_107913539263186_100001336218027_53389_6266370_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs138.ash2/40225_143110282383902_100000547944311_321942_3098549_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs072.ash2/36962_1246505502189_1815960329_484314_4880185_n.jpg)
-
:L
-
(http://i38.tinypic.com/5dkpyg.jpg)
-
[youtube]http://www.youtube.com/watch?v=Rp0ksbz0mtE[/youtube]
[youtube]http://www.youtube.com/watch?v=OsWqXQcqj4E[/youtube]
[youtube]http://www.youtube.com/watch?v=81szj1vpEu8[/youtube]
[youtube]http://www.youtube.com/watch?v=wOur8qXvpnk[/youtube]
Here is all the collection of Remi
http://www.youtube.com/user/nqtv (http://www.youtube.com/user/nqtv)
n-joy ;D
-
(http://i38.tinypic.com/5dkpyg.jpg)
depends of metal
if this is just trashing like mad monkeys, it is crap
but when have looong artistic parts, even with some orchestral parts, with intresting text, that wanna tell somtehing, it is amazing
try epic progressive metal
my fav one
1 of most amazing songs i have ever heard, probably some of you know it, but it is amazing
[youtube]http://www.youtube.com/watch?v=MZDB0mAMkA4[/youtube]
Let me tell you a story to chill the bones
About a thing that I saw
One night wondering in the everglades
I'd one drink but no more
I was rambling, enjoying the bright moonlight
Gazing up at the stars
Not aware of a presence so near to me
Watching my every move
Feeling scared and I fell to my knees
As something rushed me from the trees
Took me to an unholy place
And that is where I fell from grace
Then they summoned me over to join in with them
To the dance of the death
Into the circle of fire I followed them
Into the middle I was led
As if time had stopped still I was numb with fear
But still I wanted to go
And the blaze of the fire did no hurt upon me
As I walked onto the coals
And I felt I was in a trance
And my spirit was lifted from me
And if only someone had the chance
To witness what happened to me
And I danced and I pranced and I sang with them
All had death in their eyes
Lifeless figures they were undead all of them
They had ascended from hell
As I danced with the dead
My free spirit was laughing and howling down at me
Below my undead body
Just danced the circle of dead
Until the time came to reunite us both
My spirit came back down to me
I didn't know if I was alive or dead
As the others all joined in with me
By luck then a skirmish started
And took the attention away from me
When they took their gaze from me
Was the moment that I fled
I ran like hell faster than the wind
But behind I did not glance
One thing that I did not dare
Was to look just straight ahead
When you know that your time has come around
You know you'll be prepared for it
Say your last goodbyes to everyone
Drink and say a prayer for it
When you're lying in your sleep, when you're lying in your bed
And you wake from your dreams to go dancing with the dead
When you're lying in your sleep, when you're lying in your bed
And you wake from your dreams to go dancing with the dead
To this day I guess I'll never know
Just why they let me go
But I'll never go dancing no more
'Till I dance with the dead
-
iron maiden is okay
-
Hip Hop or Rap ... its all the same CRAP!
-
I name Tupac and all you say is "ehhh" :)
-
:L
http://www.topgear.com/uk/car-news/methane-powered-volkswagen-beetle
-
LOOOL Japan and China
(http://i35.tinypic.com/2ilof82.jpg)
-
Chinese rally FTW! ;D
-
(http://i38.tinypic.com/5dkpyg.jpg)
Don't ever speak to me.
-
(http://i38.tinypic.com/5dkpyg.jpg)
Don't ever speak to me.
-
:L :L
-
[youtube]SMoXhepcU18[/youtube]
[youtube]FQMbXvn2RNI[/youtube]
[youtube]EMoEAfDJ8Iw[/youtube]
-
porn censorship lol
[youtube]http://www.youtube.com/watch?v=qtXFbTTW8es[/youtube]
[youtube]http://www.youtube.com/watch?v=jxGKaObibxY[/youtube]
-
some of these pictures aren't funny but they're still cool to share :D
(http://imgur.com/eS1IX.jpg)
(http://imgur.com/FTI8M.jpg)
(http://imgur.com/qsSxC.jpg)
(http://imgur.com/CQ8Da.jpg)
(http://imgur.com/5kBT0.jpg)
(http://imgur.com/gRdFv.jpg)
(http://imgur.com/afJ6q.jpg)
(http://imgur.com/05zC9.jpg)
(http://imgur.com/tlbQC.jpg)
(http://imgur.com/qvJUo.jpg)
(http://imgur.com/Dlvv9.jpg)
(http://imgur.com/vmS4U.jpg)
(http://imgur.com/u61k4.jpg)
(http://imgur.com/XEDvz.jpg)
(http://imgur.com/NrM46.jpg)
(http://imgur.com/8o2f5.jpg)
(http://imgur.com/RXjQU.jpg)
(http://imgur.com/ri9Qm.jpg)
(http://imgur.com/Viibh.jpg)
(http://imgur.com/h4Buk.jpg)
(http://imgur.com/Kz5Wr.jpg)
(http://imgur.com/hoSBL.jpg)
(http://imgur.com/ORv0O.jpg)
(http://imgur.com/rcamh.jpg)
(http://imgur.com/oW1wd.jpg)
and sorry for double post, i was expecting that auto-modify thing lol
-
:l really nice pitures
-
(http://obczaj.net/obrazki/122166.jpg)
-
(http://imgur.com/Dlvv9.jpg)
I ended up in: Seek help of a professional... should I buy an iPad or what?
-
(http://img704.imageshack.us/img704/434/lolcm.jpg)
[youtube]uvoEJI8HDYE[/youtube]
[youtube]6E51BQVOmdo[/youtube]
-
Dutch commercials FTW!
-
Haha, one of the best commercials I've ever seen :D
-
this have any sense lol
(http://staticrps.komixxy.pl/uimages/201008/1281361640_by_iwangrozny_500.jpg)
-
:L
-
(http://img704.imageshack.us/img704/434/lolcm.jpg)
ROFL nice pic
-
(http://img36.imageshack.us/img36/3137/sareal.jpg)
-
Nice one! :L
-
lol nice photoshop :L
-
I edited with paint LOL
-
http://www.rtl.nl/components/actueel/rtlnieuws/miMedia/2009/week36/Wed15.MOTORAGENT.xml
Really schoked
Look at the yellow car
-
[youtube]b0GjKiy3nSI[/youtube]
-
http://www.rtl.nl/components/actueel/rtlnieuws/miMedia/2009/week36/Wed15.MOTORAGENT.xml
Really schoked
Look at the yellow car
Wow, ouch. Even I was blushing for the driver :-[.
Also, I love how everyone picks on Justin Bieber, despite the fact he seems to take all these things pretty well. He just looks and sounds like a girl, but otherwise is a pretty sensible guy.
-
[youtube]b0GjKiy3nSI[/youtube]
Hahah when does her voice get manly?
-
haha about time that douchebag got what was coming to her
-
(http://imgur.com/DUxG0.jpg)
(http://imgur.com/QDUCM.gif)
(http://imgur.com/u3Fd3.jpg)
(http://imgur.com/tmpMI.jpg)
(http://imgur.com/wXnHt.jpg)
(http://imgur.com/d7OAv.jpg)
(http://imgur.com/y97DL.jpg)
(http://imgur.com/Fsti3.jpg)
(http://imgur.com/HqyPD.jpg)
(http://imgur.com/R0NVc.jpg)
(http://imgur.com/3XnzJ.jpg)
(http://imgur.com/SsPsB.jpg)
(http://imgur.com/j37kR.jpg)
(http://imgur.com/Ipodg.jpg)
(http://imgur.com/FsEaP.jpg)
(http://imgur.com/VFRvX.jpg)
(http://imgur.com/TQJy0.jpg)
(http://imgur.com/XVsPY.jpg)
(http://imgur.com/vEcQG.jpg)
(http://imgur.com/wxRyP.jpg)
(http://imgur.com/3gjk6.jpg)
(http://imgur.com/6WV3R.jpg)
(http://imgur.com/PyQaY.jpg)
(http://imgur.com/l7lUM.jpg)
(http://imgur.com/6o5U5.jpg)
(http://imgur.com/eyVk8.jpg)
(http://imgur.com/iroTm.jpg)
(http://imgur.com/oZmN0.jpg)
(http://imgur.com/NW8pl.jpg)
(http://imgur.com/fGQ57.jpg)
(http://imgur.com/obs4i.jpg)
-
:L nice pics
-
LOL, people in New Jersey have 3rd highest IQ in Amrika.
(http://www.imsotight.com/wp-content/uploads/2009/10/guidoalkdjff.jpg)
Forget GTL, it's GTLH: Gym, Tan, Laundry and....HOMEWORK.
Also, I want to buy the K11RWA numberplate but with a W.
-
Hah, Russia ftw :L
http://www.bezbrige.com/index.php/Stupid-and-Weird/only-in-russia.html
-
[youtube]8yUbzcatvCw[/youtube]
And proof that GTAIV isn't as good as San Andreas:
(http://www.rockpapershotgun.com/images/10/aug/graphs/gta.png)
-
(http://imgur.com/Dlvv9.jpg)
I ended up in: Seek help of a professional... should I buy an iPad or what?
this might help you a little
(http://obczaj.net/obrazki/122182.jpg)
-
[youtube]http://www.youtube.com/watch?v=jRyX1tC2OS0[/youtube]
-
Hah, nice :L
-
(http://www.moronail.net/images/stories/dg_pictures/1008/7701F2E9C253-1.jpg)
(http://www.moronail.net/images/stories/dg_pictures/1008/C581BE339DB9-1.jpg)
-
(http://www.fairfaxunderground.com/forum/file.php?2,file=13238,filename=BigDogTongueLOL.jpg)
-
Raginnnnnnnnnnnnnnn
[youtube]http://www.youtube.com/watch?v=tTFOncppkJg[/youtube]
[youtube]http://www.youtube.com/watch?v=A28FsIINbsU[/youtube]
Others parts are on youtube page
-
Best part 1:18
[youtube]http://www.youtube.com/watch?v=-7fudSMOva4[/youtube]
-
(http://img580.imageshack.us/img580/4996/spidey.gif)
(http://i.imgur.com/6BTII.jpg)
(http://i.imgur.com/XKgen.jpg)
(http://i.imgur.com/6IL7L.png)
(http://i.imgur.com/scn7h.jpg)
(http://cache.gawkerassets.com/assets/images/7/2010/08/500x_0813_thegap.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc1/hs215.snc1/8219_176961668335_503688335_3742652_7334859_n.jpg)
-
<AdrenalineX> [2F2Ft]DodgeR [0 ]: hai all
<AdrenalineX> [LSR]Cypher [1]: hi
<AdrenalineX> [LSR]Draguna [29]: hi
<AdrenalineX> [SR]Badrila [43]: hi
<AdrenalineX> Juninho [34]: hi
<AdrenalineX> [SR]Andro [46]: hi
<AdrenalineX> [LSR]Cypher [1]: hi
<AdrenalineX> [SR]Zim [26]: hi
<AdrenalineX> Juninho [34]: hi
<AdrenalineX> Karlip_laptop [IRC]: hi
<AdrenalineX> [LSR]Cypher [1]: hi
<AdrenalineX> [SR]Badrila [43]: hi
<AdrenalineX> [SR]Andro [46]: hi
<AdrenalineX> Juninho [34]: hi
<AdrenalineX> [SR]Zim [26]: hi
<AdrenalineX> [2F2Ft]DodgeR [0 ]: hi
<AdrenalineX> [SR]Badrila [43]: hi
-
Re: Funny Videos/Pictures
-
(http://pedobearpics.com/pedobear/pedo_bear41.jpg)
(http://pedobearpics.com/pedobear/pedo_bear6.jpg)
(http://pedobearpics.com/pedobear/Pedo_Bear_fin.jpg)
(http://pedobearpics.com/pedobear/pedo_bear3.jpg)
(http://pedobearpics.com/pedobear/pedo_bear22.jpg)
-
(http://i36.tinypic.com/2chp7nt.jpg)
-
Re: Funny Videos/Pictures
Didn't know where to post that. :0
-
[youtube]http://www.youtube.com/watch?v=49rvCIEEWds[/youtube]
-
(http://www.gifsoup.com/view/868832/pentada-violenta-o.gif)
-
(http://www.99blazed.com/modules/Forums/images/avatars/11719169174c13de6c1af1e.gif)
-
Theres a game news webpage in Lithuania and this is one of the news lol. Title says: Gotcha: GTA V cover leaked :L
(http://gamesnation.lt/images/stories/grand_theft_auto_5_cover_leaked_to_internet_image_1.jpg)
-
(http://mangukoobas.lahendus.ee/media_files/175565l.GIF)
-
Woo ;D
-
GTA Poland
PS3
(http://playstationeu.i.lithium.com/t5/image/serverpage/image-id/76477iD7F542E04E28627D/image-size/original?v=mpbl-1&px=-1)
X360
(http://c.wrzuta.pl/wi16685/5377ed85002a9f1b4925b4c9/0/gta%20poland)
-
Found another one, my city.. woo
(http://www.gamefriik.ee/images/users_images/16575.jpg)
-
What lol
-
Fixed, lol
-
[youtube]Coj2wfPouuk[/youtube]
[youtube]uykStESm3vw[/youtube]
[youtube]PnUtN13lLnA[/youtube]
[youtube]m1TnzCiUSI0[/youtube]
[youtube]GNlPfQi9sXI[/youtube]
[youtube]WKYD-cDd_Gs&feature=related[/youtube]
[youtube]k9p3cBktdqc[/youtube]
-
Try your best not to laugh...
[youtube]Yc7uFjXxzFE[/youtube]
-
(http://antiplath.files.wordpress.com/2008/05/grand_theft_auto_somalia.jpg)
:D
-
(http://www.interq.clan.su/_bl/0/80020.jpg)
(http://www.interq.clan.su/_bl/0/09672.gif)
(http://zparks.lv/lat/sakums/e_risinajumi/images/text/GTA_4_gerbonis.jpg)
(http://zparks.lv/lat/sakums/e_risinajumi/images/text/GTA_Gerbonis_GIF.gif)
-
[Youtube]http://www.youtube.com/watch?v=V55Zq5whVCI&feature=fvw[/youtube]
Lol.
-
YES! I managed to do it...after watching it about 100 times.
-
Congratz! You just won a banana.
-
I have not been able to laugh in this whole page....
-
(http://imgur.com/jk5mR.jpg)
-
(http://img338.imageshack.us/img338/8253/gtastockholmhihi0kc.jpg) (http://img338.imageshack.us/i/gtastockholmhihi0kc.jpg/)
-
I have not been able to laugh in this whole page....
that's cause you laugh at people getting run over by trains and shit like that rofl
-
this should be fun knu, lol
EDITED
-
Poorly cow,cant be funny see somebody die like that :-\
-
if porn isn't allowed, violent videos like that shouldn't be allowed neither
-
Agree with you
-
i get highly offended when it comes to animals being harmed in any way, it's something i try to avoid seeing on the internet but yet we get it on here.. not very nice for minors imo
-
if porn isn't allowed, violent videos like that shouldn't be allowed neither
Word, word.
EDITED
-
ride, sicko
-
this should be fun knu, lol
sick bastard, not funny at all
if porn isn't allowed, violent videos like that shouldn't be allowed neither
i agree, but if i see someone get seriously hurt and its their own fault and could have been avoided but they chose not to, then fuck them they deserve it
woops, double post :-[
-
lol POLSAT (polish TV)
-
ah fuck off with this shit, idiots
-
lame
-
next person to post something abusive, violent or disturbed gets a server and forum ban for a week? (just a thought, just my opinion)
-
porn isn't allowed
Wait...what?
-
porn isn't allowed
Wait...what?
(http://obczaj.net/obrazki/122449.jpg)
(http://obczaj.net/obrazki/122485.jpg)
(http://obczaj.net/obrazki/122494.jpg)
-
I drawed this picture in Paint after missing checkpoint due to lag. Post it everywhere and force new meme. ;D
(http://img529.imageshack.us/img529/9597/ragecolour.gif)
(It's not me in the picture btw)
LOOOL, also check out this memegenerator: http://memegenerator.net/nigga-cj?pageIndex=1 So many of these are soooooo true (if you play single-player). :D
-
[youtube]ho0WfS8opaI[/youtube]
-
[youtube]http://www.youtube.com/watch?v=WNr4EfGlGPg[/youtube]
[youtube]http://www.youtube.com/watch?v=Dz6gFokvOr0[/youtube]
-
[youtube]6v5h_7-0oPs[/youtube]
-
:L :L :L
(http://obczaj.net/obrazki/122485.jpg)
LOOOL, also check out this memegenerator: http://memegenerator.net/nigga-cj?pageIndex=1 So many of these are soooooo true (if you play single-player). :D
-
Ya dun goofed son!
[youtube]98Np9hNSIWo[/youtube]
-
LMAO that was fuckin perfect
-
At first I lol'd. :D
But then I serious'd :o:
[youtube]YH4hhC-aVHI[/youtube]
*shiver*
-
(http://img138.imageshack.us/img138/1593/birmz.jpg)
-
MadMax PRESENTS . . .
(http://2.bp.blogspot.com/_6_eHhH__mn8/SwG5iZr9LXI/AAAAAAAAOPo/qRPsqlKHzAU/s1600/G-VROS_BHX_2009.11.16-2.jpg)
ANOTHER VIRGIN IN BIRMINGHAM
btw Virgin Atlantic is airline owned by Richard Branson, like every other thing from Virgin Group lol
-
(http://img138.imageshack.us/img138/1593/birmz.jpg)
which is me! :D
-
more like the only gay in the village
(http://imgur.com/gb9if.jpg)
[youtube]http://www.youtube.com/watch?v=l4zx1ZX8GW4[/youtube]
-
Breaking news lol. This was supposed to be a friendly match
[youtube]http://www.youtube.com/watch?v=ste4A1v5W-o[/youtube]
-
Referee was horrible that is why all happened :-\
-
[youtube]rtZeIU9qpMo[/youtube]
:D
-
Haha, they probably had nothing to do :L ^
----------
Pokemon :D
(http://imgur.com/R0hcG.jpg)
(http://imgur.com/hTY2f.jpg)
quite crowded lol
(http://imgur.com/pkfmc.jpg)
(http://imgur.com/9T3o6.jpg)
(http://imgur.com/qNDx5.jpg)
(http://imgur.com/z4SJo.jpg)
(http://imgur.com/ExYuI.jpg)
(http://imgur.com/eTNEW.jpg)
(http://imgur.com/Selj4.jpg)
(http://imgur.com/OSkmq.jpg)
(http://imgur.com/YtbTv.jpg)
(http://imgur.com/IVXWD.jpg)
(http://imgur.com/AHqPc.jpg)
(http://imgur.com/hlyGy.jpg)
(http://imgur.com/kt12o.jpg)
(http://imgur.com/TIHEK.jpg)
(http://imgur.com/eRZkg.jpg)
(http://imgur.com/DH27n.jpg)
(http://imgur.com/L3KPq.jpg)
(http://imgur.com/Cgq0D.jpg)
(http://imgur.com/Umxkz.jpg)
(http://imgur.com/il7Lc.jpg)
-
[youtube]http://www.youtube.com/watch?v=2iCl223Y-kQ[/youtube]
-
Breaking news lol. This was supposed to be a friendly match
[youtube]http://www.youtube.com/watch?v=ste4A1v5W-o[/youtube]
Yeaaah... I imagine our neighbors supportin' ''WUT, WHY RU TALKIN TO HIM? CHOP HIS BALLS OFF!!'
love Balcan ;)
-
[youtube]http://www.youtube.com/watch?v=2iCl223Y-kQ[/youtube]
He looks like
(http://www.gymidiots.com/wp-content/uploads/2010/05/son-i-am-disappoint.gif)
-
lmao
-
(http://knowyourmeme.com/i/000/049/934/original/12739348379.jpg?1274016216)
-
Looks like Simon Cowell's eyes. :D
-
Ineed lol
-
Ineed lol
You can't have them!!!
-
Breaking news lol. This was supposed to be a friendly match
[youtube]http://www.youtube.com/watch?v=ste4A1v5W-o[/youtube]
Yeaaah... I imagine our neighbors supportin' ''WUT, WHY RU TALKIN TO HIM? CHOP HIS BALLS OFF!!'
love Balcan ;)
I guess a Serbian fucked their girlfriends ;)
lol but seriously that guy at the end is a scumbag lol
-
http://kotaku.com/5618397/the-busty-beautiful-custom-computers-of-gamescom (http://kotaku.com/5618397/the-busty-beautiful-custom-computers-of-gamescom)
-
http://kotaku.com/5618397/the-busty-beautiful-custom-computers-of-gamescom (http://kotaku.com/5618397/the-busty-beautiful-custom-computers-of-gamescom)
Where to insert 3.5" floppy?
(http://cache.gawkerassets.com/assets/images/9/2010/08/340x_img_0210-500.jpg)
This one is my favourite:
(http://cache.gawkerassets.com/assets/images/9/2010/08/500x_img_0200-500.jpg)
-
Maybe into vagina :D
-
[youtube]rtZeIU9qpMo[/youtube]
:D
lol at 0:08, guy throws chair and the guy he was throwing it at caught it :L
-
Why do they fight :(
-
[youtube]zy6C1Gm4ALA[/youtube]
:D
-
:L
-
epic XD
-
hahaha
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs195.ash2/45840_426095281295_209118161295_5479063_4025488_n.jpg)
-
LOLOLOLOLOLOL
-
Hahaha this video with dutch seniors is crazy :L :L
or at least I think they are dutch lol
http://www.loupak.cz/video/srandicky/4129-s-duchodci-je-zabava-kompilace
-
Hahaha this video with dutch seniors is crazy :L :L
or at least I think they are dutch lol
http://www.loupak.cz/video/srandicky/4129-s-duchodci-je-zabava-kompilace
0:42 :D
-
Hahaha this video with dutch seniors is crazy :L :L
or at least I think they are dutch lol
http://www.loupak.cz/video/srandicky/4129-s-duchodci-je-zabava-kompilace
Haha yeah that's a good show, very funny with elderly people joking the youngsters xD
It is not a Dutch programme, it's Belgium actually. But they talk Dutch(Flemish)
-
[youtube]http://www.youtube.com/watch?v=1DDuM7blKFI&NR=1[/youtube]
looooooooooooooooooooooooool
-
aahahhahahahhah
[youtube]http://www.youtube.com/watch?v=5fHqTo6oRBE[/youtube]
-
[YOUTUBE]http://www.youtube.com/watch?v=SF-9JNUtz0A&feature=related[/youtube]
-
;D
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs375.snc4/45773_142119529157115_110237549011980_199019_3786098_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs305.snc4/40601_142119542490447_110237549011980_199020_4403487_n.jpg)
-
lmao, photoshop ftw :L
(http://imgur.com/WM5KJ.jpg)
-
Much to his relief, I think the picture on the right looks like a drag queen.
Then again, so does Ke$ha. :D
-
Much to his relief, I think the picture on the right looks like a drag queen.
Then again, so does Ke$ha. :D
There you go, defending Bieber again, I think somebody has Bieber Fever :P
-
(http://blogs.phoenixnewtimes.com/bastard/parisjoe.JPG)
-
Much to his relief, I think the picture on the right looks like a drag queen.
Then again, so does Ke$ha. :D
There you go, defending Bieber again, I think somebody has Bieber Fever :P
hahahaha
-
Bieber is hawt
-
oh noes! the japaneses!!
[youtube]9hcElGydzb8[/youtube]
-
Might have been posted before, but these two are epic:
[youtube]OV7SXmHq0Bk[/youtube]
[youtube]1oRQTOcGqvI[/youtube]
-
It's all in the name!
(http://i.imgur.com/DewuU.jpg)
-
[youtube]9hcElGydzb8[/youtube]
0:30 OH NO HE STOLED THE PROTEIN. :( :( :( :( :o :o :o 8) 8) 8) ;)
Haha, there's even a polar bear bodybuilder like in Tekken.
-
(http://canofrage.info/rand/gatechallenge.jpg)
(http://canofrage.info/rand/soon-you-will-be-mine.jpg)
(http://canofrage.info/rand/whatare.png)
(http://canofrage.info/rand/Paul_deal_spain.png)
(http://canofrage.info/rand/Rihanna.jpg)
-
(http://imgur.com/B5Lsm.jpg)
-
(http://www.photoshoppix.com/modules/coppermine/albums/userpics/10002/baby_eminem.jpg)
(http://img.skitch.com/20100514-cqujyjxt8k5c2iig6axfc15b6y.jpg)
(http://img147.imageshack.us/img147/3332/poster4120730fs5.jpg)
(http://www.teacherjoe.us/photos/KungFuKitty.jpg)
(http://media.ebaumsworld.com/mediaFiles/picture/911972/80830474.jpg)
(http://9gag.com/photo/23737_540.jpg)
-
Hahaha check this :o
[youtube]http://www.youtube.com/watch?v=hCmlpzl-ARA&NR=1[/youtube]
-
(http://obczaj.net/obrazki/122665.jpg)
(http://obczaj.net/obrazki/122659.jpg)
-
[youtube]E1moQNo6GSs[/youtube]
-
Ouch indeed :L
[youtube]http://www.youtube.com/watch?v=xT73Y0RiGbA[/youtube]
-
headshot :L
-
oh shit hahahaha
-
Hahaha check this :o
[youtube]http://www.youtube.com/watch?v=hCmlpzl-ARA&NR=1[/youtube]
lol it looks like he's going backwards when it gets fast enough
-
:L
(http://imgur.com/jB8g3.jpg)
(http://imgur.com/HeB4O.jpg)
(http://imgur.com/nF6dZ.jpg)
(http://imgur.com/5Ol9j.jpg)
(http://imgur.com/ogZ94.jpg)
(http://imgur.com/EEsE4.jpg)
(http://imgur.com/jk1Z1.jpg)
(http://imgur.com/p5PJg.jpg)
(http://imgur.com/lO3Yv.jpg)
(http://imgur.com/OAxDA.jpg)
(http://imgur.com/k9mY0.jpg)
(http://imgur.com/qsoiT.jpg)
(http://imgur.com/8wz0a.jpg)
(http://imgur.com/ofdKN.jpg)
(http://imgur.com/UDvui.jpg)
(http://imgur.com/8eTPC.jpg)
(http://imgur.com/aZOoO.jpg)
(http://imgur.com/9muDO.jpg)
(http://imgur.com/zWxSc.jpg)
(http://imgur.com/tr0rG.jpg)
(http://imgur.com/ng9BF.jpg)
(http://imgur.com/OM674.jpg)
(http://imgur.com/L9fl5.jpg)
(http://imgur.com/WdJ19.jpg)
(http://imgur.com/G7fLY.jpg)
-
hahaha some of the best pics ive ever looked at :L
-
:D
-
(http://imgur.com/9AgVP.jpg)
-
[youtube]http://www.youtube.com/watch?v=cO7-_M-B1Qs[/youtube]
[youtube]http://www.youtube.com/watch?v=L_ggTxFpu_g[/youtube]
[youtube]http://www.youtube.com/watch?v=440RWS2Tv1c[/youtube]
[youtube]http://www.youtube.com/watch?v=q9dOnSKMBj0[/youtube]
-
[youtube]http://www.youtube.com/watch?v=amx-JHhtsHw[/youtube]
-
[youtube]http://www.youtube.com/watch?v=amx-JHhtsHw[/youtube]
I'd wait in that line for 1-2 hours, grab all my friends and once we get to the end of the line ask with a really loud voice 'Is this open on tuesdays'?' and then leave.... So random
-
loool what a row, it's so strange to know that the world of eastern europe changed so much in the last 21 years :o
-
http://www.youtube.com/watch?v=cY7bXU2Ye7k
start of 2f2f
hehe
-
http://www.youtube.com/watch?v=cY7bXU2Ye7k
start of 2f2f
hehe
very cool, shit annoying music, but kinda shows what could happened between "The Fast and The Furious" and "2 Fast 2 Furious"
-
nsfw: http://img227.imageshack.us/img227/5673/1283041590985.jpg
**edited by the porn police :(**
Edited by Epoxi: but there's no nudity! Anyway...
(http://img210.imageshack.us/img210/6460/1283050197655.jpg)
-
i'm just trying to save the kids! :(
-
WILL SOMEBODY PLEASE THINK OF THE CHILDREN
[youtube]http://www.youtube.com/watch?v=Qh2sWSVRrmo[/youtube]
-
(http://4.bp.blogspot.com/_Y4wE1e9WkKs/Sbhg_J7NweI/AAAAAAAAABY/3xDX0n7cNu8/s320/740.jpg)
-
[youtube]http://www.youtube.com/watch?v=Qh2sWSVRrmo[/youtube]
-
so nice you had to post it twice 8)
and misquote it
--------------
could've done this though
-
needed to make sure you was gonna come back to this topic and not miss the post above yours :L
-
<see my previous post>
-
[youtube]http://www.youtube.com/watch?v=gaF2P6oZuzk[/youtube]
-
this is lol for me, cause of that road in tunel, it looks psychotic
(try to watch it after ganja use)
[youtube]http://www.youtube.com/watch?v=AygkItzTBLw[/youtube]
-
imagine that tunnel in a fuckin f1 car, jeez
-
[youtube]http://www.youtube.com/watch?v=FsNulEYQutI&fmt=18[/youtube]
-
Sarah Jessica Parker looks like a horse.
Source: www.sarahjessicaparkerlookslikeahorse.com
The hardest 'spot the difference' game you'll ever play.
(http://sarahjessicaparkerlookslikeahorse.files.wordpress.com/2010/01/032.jpg?w=450&h=350)
(http://sarahjessicaparkerlookslikeahorse.files.wordpress.com/2010/01/041.jpg?w=450&h=350)
(http://sarahjessicaparkerlookslikeahorse.files.wordpress.com/2010/01/061.jpg?w=450&h=350)
(http://sarahjessicaparkerlookslikeahorse.files.wordpress.com/2010/01/081.jpg?w=450&h=350)
I personally like this one :D
(http://sarahjessicaparkerlookslikeahorse.files.wordpress.com/2010/01/151.jpg)
-
hah :L
-
[youtube]http://www.youtube.com/watch?v=FsNulEYQutI&fmt=18[/youtube]
That would be normal if he was driving on autobahn, but this is fuckin insane lol
-
I just saw that Southpark episode about Sarah Jessica Parker lol :L hahahah 1402 it is.
-
http://www.facebook.com/profile.php?id=100000017238043#!/album.php?profile=1&id=100000017238043
Just take a look on its pictures
-
http://www.facebook.com/profile.php?id=100000017238043#!/album.php?profile=1&id=100000017238043
Just take a look on its pictures
Turned me on.
-
Hahah that's Gens profile.
-
Hahah that's Gens profile.
Killed me :L
-
Gen is hawt. ;)
-
http://www.dumpert.nl/mediabase/1091801/fa57e2be/epic_moonwalk_stunt.html
LOOOOOL
-
Lmfao! :D
-
lmao, videos from russia :L :L
http://www.loupak.cz/video/srandicky/3410-ta-nejlepsi-videa-z-ruska-kompilace
http://www.loupak.cz/video/srandicky/4816-ta-nejlepsi-videa-z-ruska-2-dil
http://www.loupak.cz/video/srandicky/4869-ta-nejlepsi-videa-z-ruska-3-dil
-
(http://www.wowbash.com/images/1267012809.jpg)
-
(http://fc02.deviantart.net/fs42/f/2009/102/5/1/SA_MP_is_fer_serious_by_Orbitdum1.png)
-
???
-
looks like rp server lol
-
http://www.citizensunitednegatingtechnology.com/ (http://www.citizensunitednegatingtechnology.com/)
-
Haha, it's made by Rockstar :L
-
Is that one of those sites from GTAIII? I remember they had petsovernight.com and hiphophoneys.com (<-which was an actual, working proper site with rapstars and everything) but they closed both of them down. :(
(http://imgur.com/cwfwG.jpg)
-
Dont get worried, the fifth circle has no number
-
it has so you must be a possible latent homosexual
but we all knew that anyway ;D
-
:D
-
[youtube]http://www.youtube.com/watch?v=Sry6eJ570gQ[/youtube]
-
what the hell :L
-
It's funny, because those Russians are drinking Lithuanian beer :P
-
They are drinking their own home made vodka (samagon)
-
[youtube]http://www.youtube.com/watch?v=Sry6eJ570gQ[/youtube]
:L
-
haha iam downloading that film finally
[youtube]http://www.youtube.com/watch?v=ymzh7YAlZng[/youtube]
-
One of the best movies ever :L
-
[youtube]http://www.youtube.com/watch?v=cIdcHkMCzQw[/youtube]
ANGOLAA lmao so good.
-
(http://imgur.com/ljhfR.gif)
-
lol
-
lulz
-
lolete :D
-
(http://img651.imageshack.us/img651/8236/muted.jpg)
-
lel
-
It gets worse...
(http://img823.imageshack.us/img823/2926/wefwef.jpg)
-
:(
-
lol, wtf? Just doesn't learn :-\
-
It gets worse...
(http://img823.imageshack.us/img823/2926/wefwef.jpg)
haah lol :L
-
Ha, tard much? :p
-
I would have tempbanned lol
-
Same. (or maybe a kick first)
-
:D
[youtube]http://www.youtube.com/watch?v=lJ33NPptPpE[/youtube]
-
I would have tempbanned lol
Is banning that big pleasure for you? damn man
-
I would have tempbanned lol
range ban ftw
-
I would have tempbanned lol
Is banning that big pleasure for you? damn man
oh yes!!! I love banning people when they diserve it and right now Im wondering....who the hell are you?
-
oh yes!!! I love banning people when they diserve it and right now Im wondering....who the hell are you?
He is a fellow admin, so get off your high horse.
-
:D
[youtube]http://www.youtube.com/watch?v=lJ33NPptPpE[/youtube]
Awesome,too smart! ;D
-
[youtube]dIR3XFuY4Qs[/youtube]
-
oh yes!!! I love banning people when they diserve it and right now Im wondering....who the hell are you?
He is a fellow admin, so get off your high horse.
its too high :( I might get hurt gettin off, I might ban you aswell from up here ;)
nice vid sigh
-
:D
-
oh yes!!! I love banning people when they diserve it and right now Im wondering....who the hell are you?
He is a fellow admin, so get off your high horse.
its too high :( I might get hurt gettin off, I might ban you aswell from up here ;)
nice vid sigh
Noes, dont even try to come back.. we dont need that kind of people down here ;) enjoy bigshot
-
[youtube]http://www.youtube.com/watch?v=a64JEtZMVUc&feature=popt17us00[/youtube]
-
not such a big fail, yes its disgusting for us humans but animals tend to eat their own excrement(most usually) and others(less usual) when they detect the digestion process did not fully process the food ingested, if you have a hamster or guinea pig you can verify this yourself by watching them when they poop, most of the time they just leave it there or throw it away but sometimes you can see them put that poop in the begining of the process again :P
enjoy ur dinner guys!!! XD
-
:D
[youtube]http://www.youtube.com/watch?v=lJ33NPptPpE[/youtube]
Awesome,too smart! ;D
those who aren't that young remember 93 finals : scottie pippen on danny ainge
[youtube]http://www.youtube.com/watch?v=yhwSGU7T8Vw[/youtube]
-
Can't..stop..must...post..
[youtube]http://www.youtube.com/watch?v=7cmESdPIR2Q[/youtube]
-
Girlfriends & Gaming
;D
[youtube]zzrQSgtkFDA[/youtube]
[youtube]R5bozYf5JUo[/youtube]
Imagine the first girl playing on AX with the rams and all that..Rageeeeeee
:D
-
eek if that's real i'd say go die bitch lol
-
shit, an xbox, I would have killed her
-
first one is obviously fake, why else would a camera just happen to be recording
-
(http://imgur.com/99Fxf.jpg)
-
<censored>
OH GOD THE PAIN GET IT OFF!!!!
-
(http://www.clipzik.com/images/posts/justin-bieber-one-time.jpg)
-
Dosh? Readies?
[youtube]s33ouDOC8C8[/youtube]
WW_W_WW_W_W_W__WWWOOOONGA?
[youtube]oQZBSqus8Rw[/youtube]
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs275.snc4/40089_155142541167096_100000140546172_525710_1587248_n.jpg)
-
:L thats from a movie called "Race to Witch Mountain", very good movie
-
Polish engineers design Fiat 126p with Golf MK I engine on back :D[/blue]
[youtube]http://www.youtube.com/watch?v=xm0IaqGIMlI[/youtube]
-
"Cool engine, he's reversing out now...can't wait 'til he goes forward. Oh, he's still reversing...wait a second..."
-
http://www.youtube.com/watch?v=gfbgtasU__U&feature=related
-
nice
-
:L :L
-
loooooool
-
http://www.youtube.com/watch?v=gfbgtasU__U&feature=related (http://www.youtube.com/watch?v=gfbgtasU__U&feature=related)
(http://www.askdrtech.com/solutions/image.axd?picture=2009%2F8%2FPrint1.jpg)
-
http://www.youtube.com/watch?v=gfbgtasU__U&feature=related
hahaha @ 2:30
-
lol the others just proceed working :L
-
[youtube]http://www.youtube.com/watch?v=_fSpI4oZoDc[/youtube]
-
[youtube]http://www.youtube.com/watch?v=15S0g8pG6HU[/youtube]
[youtube]http://www.youtube.com/watch?v=-qMHNFOtjYk[/youtube]
-
heh that video of the girlfriend playing xbox in the previous page is nothing compared to this:
[youtube]http://www.youtube.com/watch?v=DJVBsUX-zCM[/youtube]
that's actual hate to gaming hehe :D
*though you may have seen this already*
-
[youtube]egcXvqiho4w[/youtube]
wat
-
Epoxi, that is the maddest thing i have seen in some time.....
-
epoxi is a mad one lol
-
(http://imgur.com/idiDZ.jpg)
(http://imgur.com/181Y0.jpg)
-
loool
-
AXE effect
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs305.ash2/58534_130433400338009_109204525794230_165100_4804336_n.jpg)
-
Madmax's parrot
[youtube]PWhxCB0ndJE[/youtube]
NINJA CAT / M4lyzs's cat
[youtube]OcUROQL29H0[/youtube]
Teh OMG cat
[youtube]C_S5cXbXe-4[/youtube]
Duck's conversation
[youtube]xJVwvq5z3MI[/youtube]
-
Seriously, ftw
-
8 bit Rick Roll
[youtube]b1WWpKEPdT4[/youtube]
Rickroll'd in metal
[youtube]W6APndhjWys[/youtube]
Metal Rick Roll
[youtube]x01WpfZsJTg[/youtube]
-
wat is this i dont even
[youtube]-jNsA_TAiVw[/youtube]
-
pro :L
-
jesus effin christ
-
(http://img194.imageshack.us/img194/3486/motivatedfunny7.jpg)
(http://img341.imageshack.us/img341/917/originalwl.jpg)
and... do you know him? xD
(http://s-ak.buzzfed.com/static/imagebuzz/2008/9/19/22/c365b53db1af4f82a4b9bd3e1f18803e.jpg)
-
lol mike litoris
-
NO, MINE! MIKE LITORIS! :L
-
[youtube]http://www.youtube.com/watch?v=oybRYXXqb54[/youtube]
-
^
MAJOR skillz. ;D
(http://www.itnurk.com/files/upload/urod/2010/09/1283431120-206_02.jpg)
(http://www.itnurk.com/files/upload/urod/2010/08/1283088169-247_01.gif)
-
[youtube]http://www.youtube.com/watch?v=2CjLd9o_Pno[/youtube]
-
^
MAJOR skillz. ;D
(http://www.itnurk.com/files/upload/urod/2010/09/1283431120-206_02.jpg)
(http://www.itnurk.com/files/upload/urod/2010/08/1283088169-247_01.gif)
lool awesum pics
-
[youtube]http://www.youtube.com/watch?v=2CjLd9o_Pno[/youtube]
:L
-
[youtube]FgwB8I2zrdE&feature=player_embedded[/youtube]
[youtube]XooISvoZ_rs[/youtube]
[youtube]kOROsJyNqrA[/youtube]
[youtube]s8Tvwj4gppc&feature=player_embedded#![/youtube]
[youtube]Uj-D6EiIq_0&feature=player_embedded[/youtube]
[youtube]Un2slS7q5Zw&feature=player_embedded#![/youtube]
-
(http://izismile.com/img/img3/20100910/640/funny_commixed_pictures_640_high_09.jpg)
(http://izismile.com/img/img3/20100910/640/funny_commixed_pictures_640_high_14.jpg)
(http://izismile.com/img/img3/20100910/640/funny_commixed_pictures_640_high_16.jpg)
(http://izismile.com/img/img3/20100910/640/funny_commixed_pictures_640_high_19.jpg)
(http://izismile.com/img/img3/20100910/640/funny_commixed_pictures_640_high_27.jpg)
(http://izismile.com/img/img3/20100910/640/funny_commixed_pictures_640_high_32.jpg)
-
Yo here is me as a Superman when we came back to home, after Vectra Klub Polska "grill spot"
[youtube]http://www.youtube.com/watch?v=CIvjjAnIMKc&feature=player_embedded[/youtube]
-
ahahahahahahah :L :L
-
Oh help me, superman! ;D
-
that's fucking hilarious lol ( ^_^ )
-
(http://izismile.com/img/img3/20100910/640/daily_picdump_486_640_94.jpg)
(http://izismile.com/img/img3/20100910/640/daily_picdump_486_640_106.jpg)
(http://izismile.com/img/img3/20100910/640/daily_picdump_486_640_03.jpg)
(http://izismile.com/img/img3/20100910/640/daily_picdump_486_640_17.jpg)
(http://izismile.com/img/img3/20100910/640/daily_picdump_486_640_high_31.jpg)
(http://izismile.com/img/img3/20100910/640/daily_picdump_486_640_34.jpg)
(http://izismile.com/img/img3/20100910/640/daily_picdump_486_640_high_56.jpg)
(http://izismile.com/img/img3/20100910/640/daily_picdump_486_640_high_91.jpg)
(http://izismile.com/img/img3/20100406/640/dailypicdump400_640_09.jpg)
(http://izismile.com/img/img3/20100406/640/dailypicdump400_640_11.jpg)
(http://izismile.com/img/img3/20100406/640/dailypicdump400_640_91.jpg)
(http://izismile.com/img/img3/20100406/640/dailypicdump400_640_92.jpg)
(http://izismile.com/img/img3/20100406/640/dailypicdump400_640_94.jpg)
-
(http://i54.tinypic.com/e8s49j.jpg)
-
awesum pictures :D
-
omg epoxi i love you man :L
-
(http://i54.tinypic.com/e8s49j.jpg)
o dear lol
-
might have posted one or two of these before but better to have 2 of something than none at all right?)
(http://imgur.com/wMENJ.gif)
(http://imgur.com/AnHGp.jpg)
(http://imgur.com/mhtMr.png)
(http://imgur.com/FnUeg.png)
(http://imgur.com/ueO4r.png)
(http://imgur.com/TdZ0U.jpg)
(http://imgur.com/iigjk.gif)
(http://imgur.com/H8M1B.gif)
(http://imgur.com/pz5NV.gif)
(http://imgur.com/DJgon.jpg)
(http://imgur.com/QP9No.jpg)
-
ftunked
-
mooman after drink :
(http://4.bp.blogspot.com/_ZxRGDDzgxkw/SyY1YQK6dvI/AAAAAAAAAL0/uPALb_7W35A/s400/YSID+MADEsingle+artlowres.jpgo)
-
somebody is really really drunk
-
Carl On Duty: Black Ops :L :L
-
(http://img230.imageshack.us/img230/3979/fastcompdy3.jpg)
-
:L
-
[youtube]http://www.youtube.com/watch?v=ei6HXjrWUpY[/youtube]
lol
-
[youtube]http://www.youtube.com/watch?v=vm03Dgu_yXA[/youtube]
-
not very funny but still :(
(http://imgur.com/1GAfP.jpg)
-
in that pic stays 2+2 = 8 :L
-
[youtube]http://www.youtube.com/watch?v=EzYLUxFinBQ[/youtube]
Soprano's Bike.
TIP:Set ur Volume Full On.
-
:o that warning message was never appeared to me, what did u do for get it???
-
(http://i609.photobucket.com/albums/tt174/mgs315/photo.jpg)
-
:L :L :L
-
No idea if posted before or not
[youtube]http://www.youtube.com/watch?v=BqLvBUSJucg[/youtube]
-
Obama's Bush's and Putin's beatbox battle. :D
[youtube]B8egDbULSlM[/youtube]
[youtube]1I9Cc35sCE8&feature=related[/youtube]
[youtube]-84V_aWXNS0[/youtube]
-
Not funny, just want to know what you think. Fake or real? :D
[youtube]http://www.youtube.com/watch?v=deoJUBW9CI8[/youtube]
-
[youtube]http://www.youtube.com/watch?v=m9F2fw5m47Y[/youtube]
damn save some for me :D
-
Not funny, just want to know what you think. Fake or real? :D
[youtube]http://www.youtube.com/watch?v=deoJUBW9CI8[/youtube]
Did Riot send this to you? :L
-
No, a friend of mine lol
-
This pic just beats all.
(http://i812.photobucket.com/albums/zz41/gtamyths1/norris.jpg)
-
Easy, Chuck Norris is what was left in Stig's toilet
-
http://memegenerator.net/AdrenalineX
-
Those are excellent :L
-
hahaha
-
:L the drag race one and pod the pope ftw
-
Woo, made one :L and another
-
:D
-
they're on there, no need to post 'em individually :(
-
You need to upload them PyroFox.
(http://img255.imageshack.us/img255/3300/rammerstheyareeverywher.jpg) (http://img255.imageshack.us/i/rammerstheyareeverywher.jpg/)
don't agree, i see rammers really rare, more often P.I.T. and pushing than ramming
-
You need to upload them PyroFox.
(http://img255.imageshack.us/img255/3300/rammerstheyareeverywher.jpg) (http://img255.imageshack.us/i/rammerstheyareeverywher.jpg/)
don't agree, i see rammers really rare, more often P.I.T. and pushing than ramming
Lol'd
-
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2614685/MediumThumbnail.jpg?instanceText=DOUBLEYOU-Finish-under-13-seconds-server-laughs-at-you)
-
alright, fineeeee, post 'em here, just use the small thumbnail lol
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2614314/MediumThumbnail.jpg?instanceText=Boat-race-Turn-on-frame-limiter)
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2614278/MediumThumbnail.jpg?instanceText=Level-3-Admin-joins-server-PM-test-my-new-race-plsss)
-
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2613416/MediumThumbnail.jpg?instanceText=Cant-stop-car-in-time-Keybinder-with-flip)
and mine :D
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2614802/MediumThumbnail.jpg?instanceText=JARNO-Who-is-this-guy-from-your-clan-I-dont-know)
-
haha nice. But i posted twice the one about rorox lol, thought it wasn't uploaded yet so i tried another pic.
-
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2615092/MediumThumbnail.jpg?instanceText=MADMAX-LOADS-A-RACE-COME-BACK-IN-45MINS-FOR-NEXT-RACE)
rofl who made it
-
they're on there, no need to post 'em individually :(
lol why do we need them on here when they're on that webiste to look at :(
-
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2615092/MediumThumbnail.jpg?instanceText=MADMAX-LOADS-A-RACE-COME-BACK-IN-45MINS-FOR-NEXT-RACE)
rofl who made it
lol that was me xD
-
lol sorry R :P
(http://imgur.com/av4Hc.jpg)
-
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2613416/MediumThumbnail.jpg?instanceText=Cant-stop-car-in-time-Keybinder-with-flip)
and mine :D
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2614802/MediumThumbnail.jpg?instanceText=JARNO-Who-is-this-guy-from-your-clan-I-dont-know)
:-[ nice maked
-
HAHAHA! this is great!
I finally found good pic for my avatar :D
-
:D
-
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2607029/MediumThumbnail.jpg?instanceText=enter-buildmode-spend-more-time-thinking-of-the-race-name-than-making-the-race)
and
(http://imgur.com/av4Hc.jpg)
hahaha :L
-
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2619098/MediumThumbnail.jpg?instanceText=knutico-has-joined-the-server-HIDE-YO-KIDS)
-
kinda off-topic now, but this is so cool :D
[youtube]http://www.youtube.com/watch?v=9p1yBlV7Ges[/youtube]
-
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2619098/MediumThumbnail.jpg?instanceText=knutico-has-joined-the-server-HIDE-YO-KIDS)
HAHAHAHAHA
-
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2619098/MediumThumbnail.jpg?instanceText=knutico-has-joined-the-server-HIDE-YO-KIDS)
HAHAHAHAHA
:L
-
(http://i129.photobucket.com/albums/p210/smaisey/60116_10150265534430134_865675133_14676983_4997486_n.jpg)
-
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2622969/MediumThumbnail.jpg?instanceText=riot-makes-fans-go-backwards)
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2622937/MediumThumbnail.jpg?instanceText=killerbunnies-makes-the-forum-horny)
-
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2619371/MediumThumbnail.jpg?instanceText=AX-forum-wanna-see-our-new-shoes)
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2620339/MediumThumbnail.jpg?instanceText=get-stuck-behind-ironman-finish-25th)
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2620195/MediumThumbnail.jpg?instanceText=Ironman-has-low-fps-Ironman-quits-forever-then-comes-back-the-next-day)
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2619399/MediumThumbnail.jpg?instanceText=ironman-he-is-back-again)
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2605089/MediumThumbnail.jpg?instanceText=-pod-has-entered-the-server-feel-like-Pope-has-arrived)
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2604919/MediumThumbnail.jpg?instanceText=New-race-available-by-MadMax-HotRingOval1283)
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2604886/MediumThumbnail.jpg?instanceText=i-dunt-hack-was-my-brother)
EARL
;D ;D ;D
-
nice ones ;D
i made too one:
(http://imgur.com/fGpCU.png)
-
lololol some of you guys who made these are fucking hilarious
http://memegenerator.net/AdrenalineX?pageIndex=0
-
lol, this one
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2641540/MediumThumbnail.jpg?instanceText=MADMAX-YOU-FAG-haha)
and now my 1st one
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2641590/MediumThumbnail.jpg?instanceText=BANSHEe-now-have-2-stripes)
-
hahaha this one was good
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2604919/MediumThumbnail.jpg?instanceText=New-race-available-by-MadMax-HotRingOval1283)
I know its just a joke but still funny :P
-
(http://images.memegenerator.net/AdrenalineX/ImageMacro/2642168/top1-in-TT-Dont-tell-MadMax.jpg)
-
notice me and slowdoh were almost only ones who raced /tt before counting them in highscore list, others just wanna get some points in that ranking
-
notice me and slowdoh were almost only ones who raced /tt before counting them in highscore list, others just wanna get some points in that ranking
not true.
-
not true either, i was still often going in /tt to beat some records.. same as i do do now
but i love normal racing anyway so that's where my skill is, not trying 1,895 times to beat a record in /tt lol
and about /tt, i have my opinion on that mode but i'll say it on here at a later date
and btw i don't need /tt to get records and be at the top of the hs list ^^ arrogant i know but true
-
ye, thats why i don't really like idea of /tt in Highscore board
back to funny topic
funny about racing
(http://www.musclecars.faketrix.com/content/joke-pics/page3/original-files/racing-takes-two-balls.jpg)
(http://coppermine.styggforden.se/albums/kul/20080803/normal_Despair_-_Muslim_Drivers.jpg)
(http://www.randomfunnypicture.com/pictures/1254submarine-races-spectator-sport.jpg)
(http://www.lolcaption.com/wp-content/uploads/2009/12/funny-fail-pics-moto-gp-fail.jpg)
-
(http://verydemotivational.files.wordpress.com/2010/09/demotivational-posters-air-bags.jpg)
(http://cheezcomixed.files.wordpress.com/2010/09/ca6cb96b-1503-4fde-bb6a-25ff823b019a.jpg)
(http://cheezcomixed.files.wordpress.com/2010/09/1857b9d9-ac75-4b48-a8ec-4e156ff7be0c.jpg)
(http://cheezcomixed.files.wordpress.com/2010/09/50ce4236-2336-40c2-8849-f888a56e8f34.jpg)
-
[youtube]-bAN7Ts0xBo[/youtube]
-
personally i've never found this very funny but mehlol1 :D
(http://imgur.com/T7VaF.png)
-
kinda classic, but this version owns
(http://obczaj.net/obrazki/124253.jpg)
-
haha
-
this good too
(http://staticrps.komixxy.pl/uimages/201009/1284842668_by_yea1_500.jpg)
-
Fucking laughed my ass off after 2:00 to the end-... listen to the whole thing tho
[youtube]http://www.youtube.com/watch?v=CtXp7Vdc1Do[/youtube]
-
(http://img19.imageshack.us/img19/782/1070242582007.jpg)
-
(http://imgur.com/PsRBQ.jpg)
-
(http://i190.photobucket.com/albums/z29/tostitosaregross/microsoftracistad.jpg)
-
What's funny in the above pics?
They don't like black ppl in whatever country that has that language?
anyway... check this:
[youtube]http://www.youtube.com/watch?v=ZA1NoOOoaNw[/youtube]
-
:D
-
It is funny, they replaced just black guy head with white guy head for polish advertisement LOL
and they left white guy hand black!
-
In some countries that happens often.. it's just a way (of the company) to mindfuck people and give them a particular view at things. Imo this is just racist.
-
Imo this is just racist.
IMO it's because there are no black people in Eastern Europe. :D
(http://img408.imageshack.us/img408/5890/londoners.jpg)
-
(http://imgur.com/PsRBQ.jpg)
:L
-
Imo this is just racist.
IMO it's because there are no black people in Eastern Europe. :D
(http://img408.imageshack.us/img408/5890/londoners.jpg)
Imagine american thinking...
-
^ you wanna see the american point of view of the world? here you go:
(http://www.tallrite.com/weblog/blogimages/refs2006/AmericanWorld.gif)
-
;D
-
http://www.youtube.com/watch?v=WUgqXGu_gTQ
-
I lol'ed. 1:22
[youtube]http://www.youtube.com/watch?v=fJuNgBkloFE[/youtube]
-
lol nice one
-
:L
[youtube]http://www.youtube.com/watch?v=wKAY-veOsK4[/youtube]
-
(http://i53.tinypic.com/28mg1hv.png)
-
that's so disgusting lol
-
This is just amazing!
[youtube]http://www.youtube.com/watch?v=sMoKcsN8wM8[/youtube]
-
(http://obczaj.net/obrazki/124491.jpg)
(http://obczaj.net/obrazki/124499.jpg)
and NASA special
(http://obczaj.net/obrazki/124535.jpg)
-
i feel amazing when i sing AAAIIEEEEEEEEEEEEEEEEEEE-eeee-eeee-EEEEE!
[youtube]2Z4m4lnjxkY[/youtube]
holyshit! classics never die!!
-
http://forum.adrenalinex.co.uk/index.php/topic,582.msg39641.html#msg39641 :L
-
^truly magical, why haven't I seen this before?
-
subtitles FTW!!!
-
[youtube]uqafYTKBpss[/youtube]
-
(http://www.fohguild.org/forums/attachments/screenshots/151311d1284984877-funny-strange-random-pics-mgf1i.gif)
-
haahah
-
lmao
-
(http://images.cheezburger.com/completestore/2010/8/19/be6369a9-8fed-4536-a3cd-dfbf071409bf.gif)
-
:L awesum
(http://i55.tinypic.com/aemgoy.jpg)
(http://i52.tinypic.com/2zg58bo.jpg)
(http://i51.tinypic.com/2evaooy.jpg)
(http://i56.tinypic.com/4zubko.jpg)
(http://i54.tinypic.com/29de5ty.jpg)
-
(http://i.imgur.com/8JrwM.jpg)
-
ha ha ha
-
lol
-
Btw if anyone didn't understand..... Spoiler : http://www.youtube.com/watch?v=DPWTVdCaBTQ , and yeah i know i'm immature ::)
-
:L awesum
(http://i55.tinypic.com/aemgoy.jpg)
[youtube]http://www.youtube.com/watch?v=GvIA_tpB11E[/youtube]
hahaha
-
Btw if anyone didn't understand..... Spoiler : http://www.youtube.com/watch?v=DPWTVdCaBTQ , and yeah i know i'm immature ::)
LOL. Thanks, I didn't get it until you said.
-
(http://obczaj.net/obrazki/124613.jpg)
btw woo 200 pages
-
(http://bestuff.com/images/images_of_stuff/210x600/oo-167433.jpg?1225038323)
-
i don't get it lol
-
(http://i.imgur.com/8JrwM.jpg)
:L I know it's fake but I actually went dizzy
-
EPIC!
[youtube]OfaCTg_2les[/youtube]
Trololo remix
[youtube]hrdN6t_0rvQ[/youtube]
-
[youtube]http://www.youtube.com/watch?v=6xZkl9pznIc[/youtube]
-
haha my friends made a prank with that video on some friends of us ;D
-
(http://obczaj.net/obrazki/124613.jpg)
lol is that mosca??
-
Dunno if this has been posted before.
Biggest Photoshop request fail ever!
(http://farm4.static.flickr.com/3159/2807838577_83cbed0126_o.jpg)
-
lol the guy and the woman picture made me laugh
-
ahahahahah
-
(http://www.joncomics.com/files/TAKEIT.png)
-
PWNED
:D :D :D lol
-
:D :D :D :D :D
-
That site is brilliant.
(http://joncomics.com/files/flower.png)
(http://joncomics.com/files/grammer.png)
(http://joncomics.com/files/comics.png)
-
HEADSHOT
[youtube]sYta3_HRkXY[/youtube]
-
[youtube]xnGnl-UElVA[/youtube]
-
he's like the comedic version of duke nukem lol
-
My new music video ;D
[youtube]http://www.youtube.com/watch?v=u5EetytkKwk[/youtube]
-
woow napoli song :D papalamericano
dialet napoli :P
-
(http://media.fukung.net/images/26860/a8f14b757aeefab79f35902a3babd551.jpg)
-
im not gonna read all of that, haha
-
I read like half
-
Haha, that's cool :D
-
cba
-
(http://www.men.mk/wp-content/uploads/2010/07/Corn2.jpg)
-
The curvy little bastard has such a hot rounded little ass that you always want to put a space after him when you use him a sentence
:o
-
non ho capito un cazzo !!!! ::)
-
4:00 :D:D:D:D
[youtube]http://www.youtube.com/watch?v=3Ly1uubccl8[/youtube]
-
haha, i'm still laughing.. :L
[youtube]http://www.youtube.com/watch?v=-qMHNFOtjYk[/youtube]
-
haahahah omg that was so funny hahahah :L
-
(http://obczaj.net/obrazki/125115.jpg)
Darth Vadre FAIL?
(http://obczaj.net/obrazki/125118.jpg)
(http://obczaj.net/obrazki/125122.jpg)
(http://obczaj.net/obrazki/125123.jpg)
(http://obczaj.net/obrazki/125135.jpg)
(http://obczaj.net/obrazki/125136.jpg)
-
this not funny, but its cool :) this girl from UK
[youtube]8yDjoEXJZ7Y[/youtube]
-
:L awesum 2 videos :D
[youtube]http://www.youtube.com/watch?v=0E84nU93HKk[/youtube]
[youtube]http://www.youtube.com/watch?v=ULnGXhbliDk&feature=fvwk[/youtube]
-
and some more lol:
Then ur pwnd:
[youtube]http://www.youtube.com/watch?v=5sbvHJmMGx0&feature=related[/youtube]
Here ur too really pwnd":
[youtube]http://www.youtube.com/watch?v=DPKvb75RdCE&feature=related[/youtube]
Like some dude who can't fly in hydra is this :L :
[youtube]http://www.youtube.com/watch?v=Qao49Wh7GvM&feature=related[/youtube]
Wives and driving LOL :
[youtube]http://www.youtube.com/watch?v=0XT96cPL5t8&feature=related[/youtube]
Nice ferrari but so stupid boy who in it lol:
[youtube]http://www.youtube.com/watch?v=mlZWFeBXWrg&feature=related[/youtube]
How to make the police angry:
[youtube]http://www.youtube.com/watch?v=Yi64NBehb5Q&feature=related[/youtube]
Lulz too fast with a bike:
[youtube]http://www.youtube.com/watch?v=OUPpfxtI_hc&feature=related[/youtube]
I wanna be a Billionare oohhh yeaa :
[youtube]http://www.youtube.com/watch?v=2a3d0gVyVWk&feature=related[/youtube]
Germany vs Netherlands :L
[youtube]http://www.youtube.com/watch?v=q0ldGjb-caI&feature=related[/youtube]
-
hahahahaha nice vids
[Youtube]http://www.youtube.com/watch?v=uHWPUNZQZ_0[/Youtube]
-
i have take this link from Karlip :L awesum:
[youtube]http://www.youtube.com/watch?v=AaU3MFNxOHI&feature=related[/youtube]
-
lel
[youtube]http://www.youtube.com/watch?v=IBPrqJ7xUjs&feature=player_embedded[/youtube]
-
LOL wtf..
[youtube]http://www.youtube.com/watch?v=hos8Buwd4WE&feature=autofb[/youtube]
-
Jarno, you may laugh, but there really is a Ferrari powered 2CV.
(http://www.blogcdn.com/www.autoblog.com/media/2009/05/citroen-2cv-nimik-580.jpg)
[youtube]5ZzNDzy9710[/youtube]
And can someone please explain "Geflist op de fiets" video for me?
-
(http://imgur.com/CO9HC.png)
-
[youtube]http://www.youtube.com/watch?v=cUb84k4KBMM[/youtube]
-
[youtube]http://www.youtube.com/watch?v=EyTPogJE_a4[/youtube]
-
Jarno, you may laugh, but there really is a Ferrari powered 2CV.
(http://www.blogcdn.com/www.autoblog.com/media/2009/05/citroen-2cv-nimik-580.jpg)
[youtube]5ZzNDzy9710[/youtube]
And can someone please explain "Geflist op de fiets" video for me?
ye i know but i did :L cuz that was made nice.
-
This joke is getting so old, but...
(http://img69.imageshack.us/img69/2294/knu1.jpg)
-
not a joke though :(
-
This joke is getting so old, but...
(http://i54.tinypic.com/5oflox.png)
-
I lol'd, and I lol'd again at your signature.
-
[YOUTUBE]http://www.youtube.com/watch?v=5B7RAgEN5Sk]http://www.youtube.com/watch?v=5B7RAgEN5Sk[/YOUTUBE]
Probably the biggest WTF moment ever
-
wtf huge melons :o
-
:L
i saw sort of that at the news here by germany search supertalent someone broked with her boobs some melons :O
-
hahaha I saw that too, it were cans not melons.. melons is the other word for big boobs :D
-
hahaha I saw that too, it were cans not melons.. melons is the other word for big boobs :D
ok :p but that was awesum to see lol that face from Sylvie Meis like O my Fucking Gosh :L
-
:L
(http://imgur.com/mry3n.jpg)
-
:L
(http://imgur.com/mry3n.jpg)
Lmao "vampire porn" and "Dad dancing"?
-
nasty you phobos :(
-
some others just put porn inside folder called 'win32'
....and jarno haha
(http://i54.tinypic.com/5oflox.png)
-
some others just put porn inside folder called 'win32'
I just watch at sites, no need for downloading :L
-
some others just put porn inside folder called 'win32'
I just watch at sites, no need for downloading :L
Me three :D
Don't ask how i found this video:
[YOUTUBE]http://www.youtube.com/watch?v=pYX_d4wi74o[/YOUTUBE]
-
(http://obczaj.net/obrazki/125518.jpg)
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs705.snc4/62536_1565401887469_1008057190_1594359_2496180_n.jpg)
-
I saw this guy when I was like 4-5 years old. It just blew my mind back then :D enjoy!
[youtube]http://www.youtube.com/watch?v=thRLDaGEq-U[/youtube]
RANDOM
[youtube]http://www.youtube.com/watch?v=vlSVxsZoYqA[/youtube]
[youtube]http://www.youtube.com/watch?v=rOSheCJVJm8[/youtube]
[youtube]http://www.youtube.com/watch?v=SMFE7C5y9Zw&feature=related[/youtube]
-
lool that shitface is awesum :P
-
[youtube]http://www.youtube.com/watch?v=SMFE7C5y9Zw&feature=related[/youtube]
lol that's a classic
(http://imgur.com/he4ZX.jpg)
-
I bet that snoopy drives like this guy :P
http://www.youtube.com/watch?v=9xhpmdUZSsg&feature=related
-
ok lol that was random
-
wet willie what the hell man? :-\
-
(http://4gifs.com/gallery/d/134940-1/Fatkidfapping.gif)
Fat Kid Fapping
(http://4gifs.com/gallery/d/133508-1/Teletubbies.gif)
(http://4gifs.com/gallery/d/62969-8/Kid_screamer_cries.gif)
(http://4gifs.com/gallery/d/131598-1/Drops_hat_upskirt.gif)
(http://4gifs.com/gallery/d/48338-7/PaulDeLeeuw_pedo.gif) PaulDeLeeuw Pedo
(http://4gifs.com/gallery/d/77658-3/Transvestite_truck.gif)
-
LOL @ the last one ! :L :L
-
lol
-
(http://4gifs.com/gallery/d/150365-5/Kid_gropes.gif)
(http://4gifs.com/gallery/d/147292-2/Smoke_grenade.gif)
(http://4gifs.com/gallery/d/62560-3/roofsurf.gif)
Rammer
(http://4gifs.com/gallery/d/125166-5/Jerk_dog_shoryukens.gif)
-
aweseme gifs !! ;D
[YOUTUBE]qrLpOFXLmdE[/YOUTUBE]
The new funny ad of NBA
-
(http://imgur.com/ZF1wc.jpg)
-
lol
-
Lmaooooo
[youtube]http://www.youtube.com/watch?v=Rc3jMoFJrBQ[/youtube]
-
http://www.liveleak.com/view?i=1f4_1244492864
;D
-
(http://imgur.com/4zesC.jpg)
-
heh meh
-
meh
-
[youtube]http://www.youtube.com/watch?v=1F3_bvIT0ig[/youtube]
-
hahahah great lol
i know cow geting hit by train or dog vs streetroller :L
-
(http://i52.tinypic.com/25utr7o.jpg)
lol
-
lol
-
lol
-
(http://static.funnyjunk.com/pictures/620ff9a8_6466_1884.jpg)
(http://static.funnyjunk.com/pictures/559114fb_49b3_7539.jpg)
-
(http://pics.kuvaton.com/kuvei/ninjas_cant_catch_you.jpg)
-
[youtube]http://www.youtube.com/watch?v=hZ4eJDmaNfU[/youtube]
-
LMAO m4
-
ahahah best hax since ages :L
-
Pandas can be so aggressive :(
[youtube]http://www.youtube.com/watch?v=hElms3Jk1Ls[/youtube]
-
[youtube]http://www.youtube.com/watch?v=hZ4eJDmaNfU[/youtube]
haha the ninja he was lol ::)
-
Pandas can be so aggressive :(
[youtube]http://www.youtube.com/watch?v=hElms3Jk1Ls[/youtube]
???????????????????? LOOLLLLLLLLLLLLLLLLLLLLLL
-
what the hell, panda cheese? :L
-
my post is apprently gay
but not this, i died from laughing
[YOUTUBE]http://www.youtube.com/watch?v=vQ73Xp6Wp8U[/YOUTUBE]
THE HULK SMASH
-
who thinks that dude is obese :L ?
-
Dosen't matter hes funny
-
[Youtube]http://www.youtube.com/watch?v=VnJuLqVsJQU&feature=player_embedded#![/Youtube]
[Youtube]http://www.youtube.com/watch?v=ty62YzGryU4&feature=player_embedded[/Youtube]
Lol 0:15
[Youtube]http://www.youtube.com/watch?v=fC4Spaw7npY&feature=player_embedded#![/Youtube]
-
(http://obczaj.net/obrazki/126007.jpg)
(http://obczaj.net/obrazki/126018.jpg)
(http://obczaj.net/obrazki/126020.jpg)
(http://obczaj.net/obrazki/126040.jpg)
-
[youtube]http://www.youtube.com/watch?v=hElms3Jk1Ls[/youtube]
???????????????????? LOOLLLLLLLLLLLLLLLLLLLLLL
ahahahahhahahahahahhahhahahahahhahahahahahahhahahahahahhahahahahahahahahahahahahahahahhahahahahahhahhahahahahhahahahahahahhahahahahahhahahahahahahahahahahahahahahahhahahahahahhahhahahahahhahahahahahahhahahahahahhahahahahahahahahahahahahahahahhahahahahahhahhahahahahhahahahahahahhahahahahahhahahahahahahahahahahahahahahahhahahahahahhahhahahahahhahahahahahahhahahahahahhahahahahahahahahahahahahahahahhahahahahahhahhahahahahhahahahahahahhahahahahahhahahahahahahahahahahahahahahahhahahahahahhahhahahahahhahahahahahahhahahahahahhahahahahahahahahahahah
-
haha
-
[youtube]http://www.youtube.com/watch?v=6KoYAK5c5eM[/youtube]
-
[youtube]http://www.youtube.com/watch?v=WD0I1ZB2D3Y[/youtube]
-
Just for people to know, that panda add is Egyptian lmao, i understand what there saying.
but yea, way to go to make us look bad
-
Lol seifo when did you come to Australia?
[youtube]http://www.youtube.com/watch?v=EZ3lw-eNrFk[/youtube]
-
hahaha that panda commercial best commercial ive seen loool
-
http://miljons.com/ (http://miljons.com/)
-
(http://img689.imageshack.us/img689/9449/failownedmovielineupfaiy.jpg)
(http://img213.imageshack.us/img213/4162/yahooanswershorseraisin.png)
(http://img441.imageshack.us/img441/5239/thirnut.jpg)
(http://img27.imageshack.us/img27/3685/solaru.png)
In a way there funny but retarded
-
The guy who wants a third nut is lithuanian lol
-
lmao :-X
-
[youtube]http://www.youtube.com/watch?v=kB4P_VMNGYQ[/youtube]
-
(http://www.lamebook.com/wp-content/uploads/2010/09/appa1.png)
(http://www.lamebook.com/wp-content/uploads/2010/10/tptp3.png)
(http://www.lamebook.com/wp-content/uploads/2010/10/dumb-assteroid.png)
(http://www.lamebook.com/wp-content/uploads/2010/10/braindrains2.png)
(http://www.lamebook.com/wp-content/uploads/2010/09/plusep2.png)
(http://www.lamebook.com/wp-content/uploads/2010/09/bc1.png)
(http://www.lamebook.com/wp-content/uploads/2010/10/braindrains3.png)
-
lmao
-
;D
lamebook > facebook
-
www.facecunt.com
-
www.facecunt.com
:L
-
look this ;D (embittered aren't allowed)
(http://izismile.com/img/img2/20090608/life_01.jpg)
(http://izismile.com/img/img2/20090608/life_02.jpg)
(http://izismile.com/img/img2/20090608/life_03.jpg)
(http://izismile.com/img/img2/20090608/life_04.jpg)
(http://izismile.com/img/img2/20090608/life_05.jpg)
(http://izismile.com/img/img2/20090608/life_06.jpg)
(http://izismile.com/img/img2/20090608/life_07.jpg)
(http://izismile.com/img/img2/20090608/life_08.jpg)
(http://izismile.com/img/img2/20090608/life_09.jpg)
(http://izismile.com/img/img2/20090608/life_10.jpg)
(http://izismile.com/img/img2/20090608/life_11.jpg)
(http://izismile.com/img/img2/20090608/life_12.jpg)
(http://izismile.com/img/img2/20090608/life_13.jpg)
(http://izismile.com/img/img2/20090608/life_14.jpg)
(http://izismile.com/img/img2/20090608/life_15.jpg)
(http://izismile.com/img/img2/20090608/life_16.jpg)
(http://izismile.com/img/img2/20090608/life_17.jpg)
(http://izismile.com/img/img2/20090608/life_18.jpg)
(http://izismile.com/img/img2/20090608/life_19.jpg)
(http://izismile.com/img/img2/20090608/life_20.jpg)
(http://izismile.com/img/img2/20090608/life_21.jpg)
(http://izismile.com/img/img2/20090608/life_22.jpg)
(http://izismile.com/img/img2/20090608/life_23.jpg)
(http://izismile.com/img/img2/20090608/life_24.jpg)
(http://izismile.com/img/img2/20090608/life_25.jpg)
(http://izismile.com/img/img2/20090608/life_26.jpg)
(http://izismile.com/img/img2/20090608/life_27.jpg)
(http://izismile.com/img/img2/20090608/life_28.jpg)
(http://izismile.com/img/img2/20090608/life_29.jpg)
(http://izismile.com/img/img2/20090608/life_30.jpg)
(http://izismile.com/img/img2/20090608/life_31.jpg)
(http://izismile.com/img/img2/20090608/life_32.jpg)
how to forget the people whom takes the photos
-
Video sampling
[youtube]http://www.youtube.com/watch?v=JzqumbhfxRo[/youtube]
[youtube]http://www.youtube.com/watch?v=LVCb52iQrfo&feature=related[/youtube]
human beatbox
[youtube]http://www.youtube.com/watch?v=UYHKhibzWlM&feature=related[/youtube]
the shape of sound
[youtube]http://www.youtube.com/watch?v=DGSU5rcHmRQ[/youtube]
Rocket bird
[youtube]http://www.youtube.com/watch?v=EQ7zbta79vo[/youtube]
-
[youtube]l-rC3fMCZIY[/youtube]
Drunk guy dancing panamericano
-
[youtube]http://www.youtube.com/watch?v=QMEJG5Jd6Bk[/youtube]
-
:L wanking and then sleep :L
-
Reporter FAILS EPICLY
[youtube]aiSTAcYl0_w[/youtube]
Best explanation :
chuck norris manufactured that window
;D ;D ;D
-
Source of that sig.
[youtube]W5ETtG3qO-o[/youtube]
1:00
-
LOL
-
LOL
-
LOL
-
LOL
-
LEL
-
LÖL
-
stonedmuth
-
LMAO
-
lol
-
LAWL
██████████████████████████████████████████████████
██████████████████████████████████████████████████
██████████████████████████████████████████████████
██████████████████████████████████████████████████
██████████████████████████████████████████████████
██████████████████████████████████████████████████
██████████████████████████████████████████████████
██████████████████████████████████████████████████
██████████████████████████████████████████████████
██████████████████████████████████████████████████
-
LMAO
-
ROFLMAO
-
Source of that sig.
[youtube]W5ETtG3qO-o[/youtube]
1:00
wooo dutch students :D
-
Source of that sig.
[youtube]W5ETtG3qO-o[/youtube]
1:00
wooo dutch students :D
:L
-
this one is amazing :D : [youtube]http://www.youtube.com/watch?v=iANRO3I30nM[/youtube]
-
this is better, it is called
NET-KILLER
makes me wonder what happens if you try on your PC
(http://www.allegrofun.pl/allegro/images/1/16016f61ecd9ac6a34d1786e8f4c42fa.jpg)
-
this is better, it is called
NET-KILLER
makes me wonder what happens if you try on your PC
(http://www.allegrofun.pl/allegro/images/1/16016f61ecd9ac6a34d1786e8f4c42fa.jpg)
I have something like that. It uses your house wiring as an ethernet cable. We have one with a wireless access point at the other end...it really works. :L
(http://www.ohgizmo.com/wp-content/uploads/2007/06/devolo_dlan.jpg)
-
[youtube]U_b3WopcR0U[/youtube]
-
(http://img143.imageshack.us/img143/6600/177323238.jpg)
-
[youtube]iUgeAyBdPSE[/youtube]
Even worse from the episodes in summer bewteen Greece and Serbia and it was a "friendly" game again ;D
-
What did the Brazilians do to deserve that?
I hope the chinese team and players get banned for that scummy shit.
-
What did the Brazilians do to deserve that?
I hope the chinese team and players get banned for that scummy shit.
It says in the description that the Brazilians did a nasty foul and that the Chinese team reacted on that + the Brazilian coach's anger, so I guess Brazil was at fault.
-
VAI!
-
Nah it was the Chinese coach going nuts. Plus no foul should ever result in a whole team kicking a player in the face. They are scumbags soz.
-
what a pussy fight
-
:D
-
[youtube]http://www.youtube.com/watch?v=3jCdpRwOGFs&feature=related[/youtube]
lol
-
[YOUTUBE]http://www.youtube.com/watch?v=HJOPpaWdddk&feature=player_embedded[/YOUTUBE]
-
[youtube]http://www.youtube.com/watch?v=nDkVcS6qGY4[/youtube]
-
classic ;D
-
heh MadMax will like this:
[youtube]http://www.youtube.com/watch?v=WTSUgIVSLn4[/youtube]
-
lol, was just on my way to starting the mission Madd Dogg's Rhyme Book and all of a sudden a plane flew into me and almost killed me O.o
never quite seen this before a mission...
(http://imgur.com/CFYQm.jpg)
-
Did you see it crash? :L i often saw hear them crash, then look to see it there, always miss it crash lol
-
:L i heard a noise from nowhere then all of a sudden it landed infront of me and nearly exploded :(
[youtube]http://www.youtube.com/watch?v=S_Bo5lM-3rE[/youtube] just like that and on a bike too
[youtube]http://www.youtube.com/watch?v=ZGkCr5KNN1o[/youtube] ftwwwwwwww!!
-
haha
-
;D
-
I never had the chance to enjoy that in my own game :(
-
I did ;D random plane just crashed into a house near me hahaha
-
Twomey when drunk:
[youtube]http://www.youtube.com/watch?v=8NAI8Vb54OQ[/youtube]
-
embarrassing :'(
-
(http://img213.imageshack.us/img213/4162/yahooanswershorseraisin.png)
source of that, lol
http://shutupwomangetonmyhorse.com/horse.swf
-
(http://img213.imageshack.us/img213/4162/yahooanswershorseraisin.png)
source of that, lol
http://shutupwomangetonmyhorse.com/horse.swf
LOL thats a new one
-
LOOOOOOOOOOOOOOOOOOOOOOOOOOL!!!!!!!!!
[youtube]http://www.youtube.com/watch?v=UyzCVgR6uZc&feature=related[/youtube]
-
whahahhahhahahaha great fail :L
-
:D
-
me and my friends trolled one of my other friends so hard
http://cheezburger.com/apopiso/lolz/View/4087414784
vote for me to get on the main page! wooooo hahaha
-
LOOOOOOOOOOOOOOOOOOOOOOOOOOL!!!!!!!!!
[youtube]http://www.youtube.com/watch?v=UyzCVgR6uZc&feature=related[/youtube]
haha the original is even funnier
me and my friends trolled one of my other friends so hard
http://cheezburger.com/apopiso/lolz/View/4087414784
vote for me to get on the main page! wooooo hahaha
(http://imgur.com/p83nI.jpg)
-
really stupid dude XD
[youtube]http://www.youtube.com/watch?v=u3t46Z36_K8[/youtube]
-
really stupid dude XD
[youtube]http://www.youtube.com/watch?v=u3t46Z36_K8[/youtube]
Pff, thats not funny at all, just sick-..Shame on you jarno.
-
I agree, its not funny at all plus thats a raw video since that guy died instantly!
Story:
"One man in India Blames everyone standing on the roof of an express train, he demands something and blames them he will hold the High Voltage Electric Wire Running over the Train if his demand will not be accepted. Actually he was travelling in the Mahananda Express, a route from Delhi to Alipurduar. He had embarked upon the train from Aligarh.In his Procrastination he holds the wire and within fraction of second the High voltage passes his body and he dies with a huge sparks and fire. It is a worrying thing that people started using these kind of dangerous thing as a suicide medium. :( "
Even youtube censored the original video
[youtube]5Ll7Cp9VRfs[/youtube]
-
i refuse to watch shit like that, and if mooman wants to stop porn on here then he should stop videos like that too otherwise we might as well just post videos from redtube or pornhub :)
-
and cliphunter and xhamster and.....
-
lol
[youtube]http://www.youtube.com/watch?v=d3PCLn3xU78[/youtube]
-
5:47
-
1:02 fail + excuse to park
-
lol
-
I agree, its not funny at all plus thats a raw video since that guy died instantly!
Story:
"One man in India Blames everyone standing on the roof of an express train, he demands something and blames them he will hold the High Voltage Electric Wire Running over the Train if his demand will not be accepted. Actually he was travelling in the Mahananda Express, a route from Delhi to Alipurduar. He had embarked upon the train from Aligarh.In his Procrastination he holds the wire and within fraction of second the High voltage passes his body and he dies with a huge sparks and fire. It is a worrying thing that people started using these kind of dangerous thing as a suicide medium. :( "
Even youtube censored the original video
[youtube]5Ll7Cp9VRfs[/youtube]
ah ye sorry dudes next time i need better watch it stupid me :'( :'( :-\
-
[youtube]http://www.youtube.com/watch?v=A9zaZik3n2E[/youtube]
-
I agree, its not funny at all plus thats a raw video since that guy died instantly!
Story:
"One man in India Blames everyone standing on the roof of an express train, he demands something and blames them he will hold the High Voltage Electric Wire Running over the Train if his demand will not be accepted. Actually he was travelling in the Mahananda Express, a route from Delhi to Alipurduar. He had embarked upon the train from Aligarh.In his Procrastination he holds the wire and within fraction of second the High voltage passes his body and he dies with a huge sparks and fire. It is a worrying thing that people started using these kind of dangerous thing as a suicide medium. :( "
Even youtube censored the original video
[youtube]5Ll7Cp9VRfs[/youtube]
still more than a billion to go :(
-
I agree, its not funny at all plus thats a raw video since that guy died instantly!
Story:
"One man in India Blames everyone standing on the roof of an express train, he demands something and blames them he will hold the High Voltage Electric Wire Running over the Train if his demand will not be accepted. Actually he was travelling in the Mahananda Express, a route from Delhi to Alipurduar. He had embarked upon the train from Aligarh.In his Procrastination he holds the wire and within fraction of second the High voltage passes his body and he dies with a huge sparks and fire. It is a worrying thing that people started using these kind of dangerous thing as a suicide medium. :( "
Even youtube censored the original video
[youtube]5Ll7Cp9VRfs[/youtube]
Even tho this is not funny, Why the hell was he up there?
first thing i would think of if i was on top of a train would be WTF am i doing here?
-
I don't even get the reference, but I found this funny.
(http://static.vgcats.com/comics/images/101018.jpg)
-
(http://chzgifs.files.wordpress.com/2010/10/d77d0646-f9c4-4c27-94c4-1b49a7cd78ff.gif)
-
I can't decide whether that's hilarious or disgusting...I'm just too confused. :D
-
what's the funny part of it anyway?
-
lol this owns
-
holy shit hahahahaha
-
ROFLMAO
-
(http://95.154.244.129/randomimage?a)
-
halloween ep :p when they turned inside out :p
aw it changed again!
-
:D
-
what's the funny part of it anyway?
watch as the bloke jumps, he shits himself :L
-
what's the funny part of it anyway?
watch as the bloke jumps, he shits himself :L
he throws something with his right hand in the water, what is funny about that?
-
Anyone who's played JFK Reloaded (it's free to download by the way) will know that you have to replicate the assassination of John F. Kennedy as accurately as possible to gain maximum points.
Let's just say this guy isn't aiming to score any points...
[youtube]G1jV1ZoxQa4[/youtube]
-
lol Awesome change to history
Game developers must be running out of ideas though
-
that's the worst game I've ever seen.
-
[youtube]http://www.youtube.com/watch?v=ggB33d0BLcY[/youtube]
-
(http://i.imgur.com/ej6Y0.png)
-
Jesus, what the :-X
-
FOREVER ALONE
bahahha
-
[youtube]http://www.youtube.com/watch?v=pvgL5t4Y3VY[/youtube]
The epitome of raging. For those of you who don't understand lithuanian, a guy lost 20$ on online poker.
-
yeeah!! ;D
i love controlled rage
-
AND FOR EVERYBODY SOME RAGE OUT OF CONTROL ;D
[youtube]http://www.youtube.com/watch?v=5W8lmQ63PGs[/youtube]
1:34 ftw
2:38 haha
-
[youtube]http://www.youtube.com/watch?v=pvgL5t4Y3VY[/youtube]
The epitome of raging. For those of you who don't understand lithuanian, a guy lost 20$ on online poker.
Su tuo pokeriu jau tikrai zmones nebenormalus daros...
-
[youtube]http://www.youtube.com/watch?v=pvgL5t4Y3VY[/youtube]
The epitome of raging. For those of you who don't understand lithuanian, a guy lost 20$ on online poker.
Su tuo pokeriu jau tikrai zmones nebenormalus daros...
lmao do you still believe in these vids? they're all fake.
-
can someone translate this?:
(http://obczaj.net/obrazki/127138.jpg)
-
Some results of Financial crisis ;D
(http://www.mypoco.net/wp-content/uploads/2010/10/afrikan-kranos2.jpg)
(http://www.mypoco.net/wp-content/uploads/2010/10/extreme-magio2.jpg)
Best own goal ever, with da ass :P
[youtube]yBaOjw2yqCU[/youtube]
-
its in dutch but so awesum:
[youtube]http://www.youtube.com/watch?v=Kaqmy5dfhC8[/youtube]
-
can someone translate this?:
(http://obczaj.net/obrazki/127138.jpg)
1. take out intestines
2. put them back in backwards
3. eat shit
shit food!
-
max never was a talent in understanding the message pictures :L
-
hahahaaha
[youtube]http://www.youtube.com/watch?v=OTjD9K9xTJY[/youtube]
-
:L nice one
-
bahaha Ush why are you calling up british tv shows man ;D
-
its in dutch but so awesum:
[youtube]http://www.youtube.com/watch?v=Kaqmy5dfhC8[/youtube]
-
[youtube]http://www.youtube.com/watch?v=jiXua16uYYA[/youtube]
-
ahahahahahahahahahhahahahah wtf nooob ahahhaha
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs911.snc4/72458_1499933891437_1026855658_31120943_5557114_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs932.snc4/74575_1499930131343_1026855658_31120934_647324_n.jpg)
what is that ?, mmh i don't know , me from lineup = translated lol
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs308.snc4
/40748_1499925771234_1026855658_31120915_2836011_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs468.ash2/74133_1499920891112_1026855658_31120898_8344271_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs830.snc4/69026_1499920691107_1026855658_31120897_3086930_n.jpg)
see the tv lol
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs137.snc4/37183_1499919571079_1026855658_31120893_5416926_n.jpg)
GESù Say:As I like to make jokes up there
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs451.ash2/72449_1561991663445_1644934490_1318754_1110017_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs884.snc4/71718_164787550205560_100000229474117_461221_7585040_n.jpg)
bimbominkia= mmh in english maybe is kidnoob
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs833.snc4/69331_164787206872261_100000229474117_461219_3764775_n.jpg)
other bimbominkia
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs918.snc4/73154_1498226248747_1026855658_31117233_3310010_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs797.snc4/67702_172091009467864_100000008990823_640507_2296805_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs291.snc4/40903_1570063384127_1611767400_1374748_1583138_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs381.ash2/65962_141023262612475_100001144067530_221700_2119723_n.jpg)
-
oh my gooood i talk with cleverbot
(http://img100.imageshack.us/img100/5606/omggy.png)
:o
-
what is that ?, mmh i don't know , me from lineup = translated lol
And what is this?
I don't have the slightest idea, it's been there since morning.
Help me up...
-
second part
(http://img51.imageshack.us/img51/2227/senzanomenr.png)
-
what is that ?, mmh i don't know , me from lineup = translated lol
And what is this?
I don't have the slightest idea, it's been there since morning.
Help me up...
translated phrases of the pic
-
Scorpion getting owned by a bot ;D
-
Colpo di Fulmine = "Lightning Strike" literally = also means "Love at first sight"
trentamila volt e morire sul colpo = "30,000 volts and you die on the spot"
then Jesus says "Oh, how I love to play jokes from up here"
-
Colpo di Fulmine = "Lightning Strike" literally = also means "Love at first sight"
trentamila volt e morire sul colpo = "30,000 volts and you die on the spot"
then Jesus says "Oh, how I love to play jokes from up here"
nice!!!
-
This woman's annoying...in French, English, Spanish AND Italian.
(http://img522.imageshack.us/img522/9981/francaist.jpg)
-
ahahhahahahahha
-
(http://imgur.com/AQgNo.png)
not so cleverbot :D
-
(http://i190.photobucket.com/albums/z282/Flopster2/loool.jpg)
Translation:
I have a dog.
I dont like dogs, i like cats
But your a cunt
-
ahahaha :L
-
Maan, this is a CuntBOT
I asked him, 'why so quiet'
(http://i190.photobucket.com/albums/z282/Flopster2/stupid.jpg)
-
:L lol
-
My last pic, finally got revenge, lmao...
(http://i190.photobucket.com/albums/z282/Flopster2/hahahaha.jpg)
-
;D
(http://i.imgur.com/G8JGd.png)
-
snik got OWND
-
(http://dl.dropbox.com/u/7442169/dick.jpg)
-
Did this one ages ago.
(http://img255.imageshack.us/img255/2511/clevertrolled.png)
Got owned :(
-
Ohhhh noooooooo. :o
[youtube]0suvlx3ehJ4[/youtube]
-
Oh God Gtorx's avatar is inappropriate! :o
-
[youtube]Vo0Cazxj_yc[/youtube]
-
Astonishing.
-
[youtube]Vo0Cazxj_yc[/youtube]
Best extreme compilation ever.
Imagine how many people died to make this video. :D
-
sick vid, people are just insane.
-
Did this one ages ago.
(http://img255.imageshack.us/img255/2511/clevertrolled.png)
Got owned :(
:L :L :L :L
-
(http://www.naointendo.com.br/wp-content/uploads/2010/10/Batman1.jpg)
This topic was blatantly made for Snoopy lol... :D
http://forum.adrenalinex.co.uk/index.php/topic,2499.0.html
-
(http://www.naointendo.com.br/wp-content/uploads/2010/10/Batman1.jpg)
This topic was blatantly made for Snoopy lol... :D
http://forum.adrenalinex.co.uk/index.php/topic,2499.0.html
ahahahahaha
-
For some reason I thought that "NSFW" is Need For Speed World. lmao
-
NSFW: http://www.mmocrunch.com/wp-content/uploads/2010/05/NFSW-Pic.jpg
:L
-
i was capable of changing my own picture... :/
-
8) last time i try to be helpful :-[
-
good job with the rules. finally glad to see some lol, hated those death videos :(
-
For some reason I thought that "NSFW" is Need For Speed World. lmao
same lol
-
Can someone please explain the Batman thing, i totally don't get it...
-
http://knowyourmeme.com/memes/forever-alone
-
Oh right. That one missed me by. No loss, not really the best meme ever.
-
Oh right. That one missed me by. No loss, not really the best meme ever.
Yeah, I didn't like it to begin with either: doesn't really have enough charm to be a meme. But when people started finding puns and going overboard, it got good. :D
-
[youtube]http://www.youtube.com/watch?v=1a0E5BuvZ28&feature=aso[/youtube]
-
its not funny but its nice:
[youtube]http://www.youtube.com/watch?v=AdRZyeSL4Mo&feature=player_embedded[/youtube]
-
Nice car chase, but I don't get it lol. ???
-
Nice car chase, but I don't get it lol. ???
-
lul
he have visions about that girl and he want find her and save
-
fuck bikes stoppie, this is better
[youtube]http://www.youtube.com/watch?v=eW_1NEMcYIY[/youtube]
-
(http://obczaj.net/obrazki/127402.jpg)
-
lol
-
(http://img87.imageshack.us/img87/1952/90927096.png)
-
(http://obczaj.net/obrazki/127402.jpg)
o ja pierdole :L
-
http://piv.pivpiv.dk/ (http://piv.pivpiv.dk/) PORN!
-
(http://hejibits.com/comics/2010-08-02-originality.png)
-
fuck bikes stoppie, this is better
[youtube]http://www.youtube.com/watch?v=eW_1NEMcYIY[/youtube]
:L
-
Simon is sure to try and do that ! :L
-
Simon is sure to try and do that ! :L
hahah ye but that van from vid has 3 wheels isn't it?
-
[youtube]http://www.youtube.com/watch?v=rj9IczhnXuI[/youtube]
[youtube]http://www.youtube.com/watch?v=ZDpJLIHUMi0[/youtube]
-
here's the original for one of the clips:
[youtube]http://www.youtube.com/watch?v=xENNnpQeKcM[/youtube]
-
yeh vomiting fucking dogs.. that's so funny.
-
Id rather watch some anal pr0n... :( BTW "NSFW" mark?
-
Id rather watch some anal pr0n... :( BTW "NSFW" mark?
baaaaaaaaaaaaaaaaaaaaaaaaaaaaaaan
-
This gave me major nostalgia.
(http://img338.imageshack.us/img338/7273/cutbackonfunding.gif)
This video makes me amazed...just...wow...
[youtube]b9zQRNHNGs8[/youtube]
Another one...
[youtube]9FHwFDlqazM[/youtube]
-
Especially for M4lsyz and whomever love bicycles and stunts :)
[youtube]http://www.youtube.com/watch?v=Winf5n6lFUE[/youtube]
[youtube]http://www.youtube.com/watch?v=DwTkaLD-rPU[/youtube]
-
[youtube]9FHwFDlqazM[/youtube]
i seriously thought the preview was a real photo :o
-
looks cool shame about 50 cent
-
awesome
-
Especially for M4lsyz and whomever love bicycles and stunts :)
[youtube]http://www.youtube.com/watch?v=Winf5n6lFUE[/youtube]
[youtube]http://www.youtube.com/watch?v=DwTkaLD-rPU[/youtube]
Red Bull Rampage FTW!
-
[youtube]In9XbjyCbnY[/youtube]
;D
-
Not funny, but might interest you. GTA San Andreas secret:
(http://img219.imageshack.us/img219/7816/rgsecret.jpg)
(http://ps3.kombo.com/images/content/news/302px-Rockstar_Games_logo.png)
-
cj you fat bastard go to the gym!
-
NSFW:
http://s3-llnw-screenshots.wegame.com/4-9551591126467622/9551591126467622_l.jpg
-
(http://www.moronail.net/images/stories/dg_pictures/1010/7662C9006695-1.jpg)
(http://www.moronail.net/images/stories/dg_pictures/1010/6897CEC5DF5A-1.jpg)
-
i dont understand what the funny thing is of dead beings.
-
i agree
-
dead is fun
-
you got a sickmaking taste of humour anyway.
death is interesting, not fun.
-
how is death fun or interesting?? O.o
-
(http://imgur.com/84lNZ.gif)
-
OMFG
NOTHING FUNNY BUT O SO PRO SKILLS
View My Video (http://nl.tinypic.com/r/2mdjdhc/7)
-
Scandinavian drivers are the best.
LOLOLOL: I found pictures of the first cars I made.
(http://img299.imageshack.us/img299/8074/1stingameprevss5.jpg)
(http://img398.imageshack.us/img398/5637/gallery149dc7.jpg)
-
LOL, looks like Mercedes-Benz
-
maybe because it got the same logo max :) ;)
-
(http://imgur.com/x6C4j.png)
-
(http://imgur.com/71bpM.png)
Did not want too make it smaller but look at my finish time, I crashed a pole and got 14th then I was gonna finish on the board so i was coming at full speed at the train station then i was gonna lose the control then I maneged to slide it cross the finishline being 12th and passing Pig with that time diffrence :L
-
lol I've won races with 0.001 time difference(and I don't mean drag races, lol).
-
i've finished at the same time as someone :D
-
i've finished at the same time as someone :D
:L:L thats atleast the closest i've got, but the finish was awesom xD. then i did all the slidin.
Lol moo i've seen that and that is hillarious
-
same mooman :D
-
lol I've won races with 0.001 time difference(and I don't mean drag races, lol).
same mooman :D
I didn't even knew you won races :O
-
I won't blame you for not knowing, children often forget things :)
-
NSFW:
http://www.youtube.com/watch?v=LGl0uvonq9k trolololol its in dutch over J.B
http://www.youtube.com/watch?v=rcXXKyFvve4&feature=related
-
(http://www.crnobelo.com/images/stories/2010/07/testirajte-kolku-ste-brzi-1.jpg)
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
*
(http://www.crnobelo.com/images/stories/2010/07/testirajte-kolku-ste-brzi-2.jpg)
-
lol i thought 6 total different things.. :P
-
lol i thought 6 total different things.. :P
same :L
-
(http://imgur.com/AWWzi.jpg) my car ended like that and idk what angle that is
Started like that
(http://imgur.com/n4qs7)
-
[youtube]hGFDF96hwTE[/youtube]
LOOOOL
-
(http://www.crnobelo.com/images/stories/2010/07/testirajte-kolku-ste-brzi-1.jpg)
*
*
(http://www.crnobelo.com/images/stories/2010/07/testirajte-kolku-ste-brzi-2.jpg)
1 books
2 random
3 penis
4 fucks
5 pulse
6 sex
lol
-
1. boobs
2.condom
3.penis
4.fuck
5.pulse
6.six
-
[youtube]http://www.youtube.com/watch?v=HsEm9XHOj2M[/youtube]
-
[youtube]http://www.youtube.com/watch?v=5lNahLlx7YQ[/youtube]
-
(http://imgur.com/N5win.jpg)
(http://imgur.com/i6mbs.png)
-
andy abraxam
-
haha
-
[youtube]http://www.youtube.com/watch?v=SEVU-YLpM8A[/youtube]
-
[youtube]PJQVlVHsFF8[/youtube]
This is just painful to watch. Why David, why!?
-
jesus fuckin christ, makes me feel retarded
-
(http://lou.pe/wp-content/uploads/2010/01/cursor_disco.gif)
-
lol
-
(http://i.imgur.com/QAAuW.jpg)
I found "X" from Adrenaline X character. Press "Quote" to see what I mean. ;)
ADRENALINE✗
-
ADRENALINEX
-
SUNRISEX
-
troll roll
(http://4gifs.com/gallery/d/84065-3/Troll_roll.gif)
-
LSR ADRENALINEX
-
SEX
(http://i53.tinypic.com/2i7935w.png)
(http://i.imgur.com/sJKY1.gif)
-
last one is epic
-
Who would like ?
(http://uploadffs.nl/images/axyoutubes.png)
-
/me
-
BIKE HAX FTW!!! LOL
[youtube]WCRlN09NqA0[/youtube]
Octuber Fails
[youtube]e8qwQQ4F1kM[/youtube]
Parkour Dog
[youtube]TS1sYm1NHNg[/youtube]
WINS
[youtube]2jVomOZA8_8[/youtube]
Obama Security Bodyguard Team
[youtube]wmob20ikscs[/youtube]
GO!!
[youtube]miJvEmVo8O0[/youtube]
Cheats!
[youtube]7MNBuhYtv9s[/youtube]
FAILS
[youtube]DKNVkE9dlfM[/youtube]
-
NSFS: http://www.youtube.com/watch?v=QWbZ6xH8Nxc
-
lol
-
haha nice combined
"what the hell is a gay bar?"
(http://www.undersec.info/style_emoticons/default/715m7b7.gif)
-
(http://1.bp.blogspot.com/_CytbWnE70wY/TJ1deXbRWkI/AAAAAAAAACU/kQrkY5OwsvE/s1600/FunnyPictures-100AcreDrugs.jpg)
-
http://www.youtube.com/watch?v=Tg4u7ko333U
-
(http://i.imgur.com/niNt3.png)
-
Those fail videos that bunnies posted make me cringe.
-
[youtube]http://www.youtube.com/watch?v=8bw2X1oq_js[/youtube]
-
ffs
-
?
-
i've got the clap and i'm givin it to you ( 8 )
-
[youtube]http://www.youtube.com/watch?v=NBWQCHb95rg&feature=related[/youtube]
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs056.ash2/36145_459678404716_5510669716_5317952_3837117_n.jpg)
[youtube]http://www.youtube.com/watch?v=Mgk2dgDT4gk[/youtube]
-
[youtube]http://www.youtube.com/watch?v=Q6pbZLiLt30[/youtube]
-
:L
-
http://www.collegehumor.com/web-celeb-hall-of-fame/crazy-frog-bros/tribute:1821139
-
how about a cop chase?
(http://obczaj.net/obrazki/128127.jpg)
nazi-party costume
(http://obczaj.net/obrazki/128146.jpg)
-
(http://imgur.com/7LHNM.jpg)
-
ahhahahahahahahahahahahahahahahhaha
AdrenalineX a Bugs life mauhauahuahauh :L :L :L :L :L :L :L
poor R* M* P*
-
Gibe Moni pls!
Gibe moni plos!!
Gibe moni pl0x!!!
(http://www.lolbot.net/pix/2956.png)
-
What does hua hue mean?
-
aehueahueahaueheauhaeue = Brazilian laughter.
like
lolololololololololololol
kekekekekkekekekekekekekk
ikikikikiikkikikkiikkikikk
hahahahhahaahahah
(http://i.imgur.com/ghmPs.jpg)
-
(http://ilike.mk/wp-content/uploads/images/2010/11/c79743.jpg)
-
aehueahueahaueheauhaeue = Brazilian laughter.
or: usahauhsuashsauashsausahuashasusah
-
ushushushushushushushushushush
-
ye thats what I read when I see them laughing :(
+111111111111111111111111111 for you avatar, hahaha :L :L :L
-
(http://28.media.tumblr.com/tumblr_lc0wdpQuQr1qzmepzo1_500.jpg)
-
:D
-
it is funny, isn't brutal or sth, but some ppl might say NSFW so
NSFW: http://www.youtube.com/watch?v=aYrR6Lukxt8
-
[youtube]http://www.youtube.com/watch?v=4cycjSaXeD4&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=iTfmXrPFbRE&feature=related[/youtube]
-
http://www.youtube.com/watch?v=o-ZeNSL7k3w&feature=related total IDIOTS :D
-
[youtube]jm3dm5J5r0A[/youtube]
-
Lmaooo
-
Nothing calms down a person like eating a piece of paper in a disappointing moment (http://forum.adrenalinex.co.uk/Smileys/default/tRDvJjVtKsqb6zdWUBdiJt7emmc.gif)
[youtube]http://www.youtube.com/watch?v=y9HiJVBA0CE&feature=player_embedded[/youtube]
-
[youtube]http://www.youtube.com/watch?v=klKUuINlmrQ&feature=related[/youtube]
-
lithuanian daddy.
[youtube]http://www.youtube.com/watch?v=jQRn-COuenU[/youtube]
-
Your dad ?
-
I wish he was
-
(http://obczaj.net/obrazki/128653.jpg)
-
":L
-
[youtube]wTn9rvBUMK0[/youtube]
[youtube]Utp3mvH-gW4&feature=player_embedded[/youtube]
-
lool that gta4 gay cop :L
-
this one owns, so better never run with scissors
(http://www.chyba-ty.pl/photo/1280/1241087192/1/tumblr_l9kzpyfLLy1qzy7s2)
-
Queen of Vagina
NSFW: http://www.youtube.com/watch?v=JIpisxCEV1g
NSFW: http://www.youtube.com/watch?v=0uteEBQ-NlY
-
this one owns, so better never run with scissors
(http://www.chyba-ty.pl/photo/1280/1241087192/1/tumblr_l9kzpyfLLy1qzy7s2)
Taste the cock! muahahah
-
lol
-
THIS ISN'T FUNNY BUT ITS HOLY CRAP:
[YOUTUBE]http://www.youtube.com/watch?v=WptBPHDIIvE&feature=aso[/YOUTUBE]
Tip: Look at number 16 Suarez
-
Omg Suarez in action again! :o
EDIT: Found this lmao.
[youtube]VJ13AxE81Po[/youtube]
-
(http://i.imgur.com/ofrof.jpg)
(http://media.riemurasia.net/albumit/mmedia/63/hjz/wmfw/71622/763760038.jpg)
(http://img843.imageshack.us/img843/345/tgjem.jpg)
-
(http://i.imgur.com/wgN6v.jpg)
-
[MAF]Penguin your bro :D
[youtube]http://www.youtube.com/watch?v=u-ZnEOXszKg[/youtube]
rolf ;D
-
Bed Intruder song
[youtube]VKsVSBhSwJg[/youtube]
-
[youtube]http://www.youtube.com/watch?v=pezdRcVe04c[/youtube]
-
(http://i812.photobucket.com/albums/zz41/gtamyths1/sa-mp-999.png)
lol @ runty's confession
-
(http://i812.photobucket.com/albums/zz41/gtamyths1/sa-mp-999.png)
lol @ runty's confession
nice camera angle to cover up a load of bollocks
-
[MAF]Penguin your bro :D
[youtube]http://www.youtube.com/watch?v=u-ZnEOXszKg[/youtube]
rolf ;D
one of my all time favourite childhood cartoons :)
-
[MAF]Penguin your bro :D
http://www.youtube.com/watch?v=u-ZnEOXszKg
rolf ;D
one of my all time favourite childhood cartoons :)
me too :P and i learned to make pingu's voice when I was little hahaha
(http://www.ludicer.it/streaming-cartoni-animati/pingu/pingu.gif)
-
[youtube]http://www.youtube.com/watch?v=pezdRcVe04c[/youtube]
died pepper imao :L
-
[MAF]Penguin your bro :D
http://www.youtube.com/watch?v=u-ZnEOXszKg
rolf ;D
one of my all time favourite childhood cartoons :)
me too :P and i learned to make pingu's voice when I was little hahaha
(http://www.ludicer.it/streaming-cartoni-animati/pingu/pingu.gif)
me too :P i enjoyed this cartoon when a tv cultural network put it on-air, now all cartoon in every channel are shit, bollocks, bullshit
-
lmao pingu ftw
i fucking love it when he gets angry ;D
-
Bed Intruder song
[youtube]VKsVSBhSwJg[/youtube]
That is brilliant. The video's those guys do are really great.
Brett Domino's stuff is also really good:
[youtube]NQBjNnfWMPI[/youtube]
-
I also assume you have all seen/heard this before:
[youtube]ckMvj1piK58[/youtube]
-
Nice LOL, got nothing on "R u gonna bang doe" though. :D
-
[youtube]http://www.youtube.com/watch?v=lVmmYMwFj1I[/youtube]
loooooooool
-
(http://figurefeatures.com/Happy-Keanu/1286468530725.jpg)
(http://figurefeatures.com/Happy-Keanu/1286468603802.jpg)
(http://figurefeatures.com/Happy-Keanu/1286468818434.jpg)
(http://figurefeatures.com/Happy-Keanu/1286468881117.jpg)
(http://figurefeatures.com/Happy-Keanu/1286468982981.jpg)
(http://figurefeatures.com/Happy-Keanu/ggg.jpg)
(http://figurefeatures.com/Happy-Keanu/gggg.png)
(http://figurefeatures.com/Happy-Keanu/jjj.jpg)
(http://figurefeatures.com/Happy-Keanu/ttt.jpg)
(http://figurefeatures.com/Happy-Keanu/1286471459328.jpg)
(http://figurefeatures.com/Happy-Keanu/1286468997300.jpg)
(http://figurefeatures.com/Happy-Keanu/matrix.jpg)
(http://figurefeatures.com/Happy-Keanu/1286469417968.jpg)
(http://figurefeatures.com/Happy-Keanu/1286469698867.jpg)
(http://figurefeatures.com/Happy-Keanu/1286469874327.jpg)
(http://figurefeatures.com/Happy-Keanu/1286469904177.jpg)
(http://figurefeatures.com/Happy-Keanu/1286469938369.jpg)
(http://figurefeatures.com/Happy-Keanu/1286469988131.jpg)
(http://figurefeatures.com/Happy-Keanu/1286470980272.jpg)
(http://figurefeatures.com/Happy-Keanu/1286472123220.jpg)
http://happykeanu.com/
-
[youtube]http://www.youtube.com/watch?v=lVmmYMwFj1I[/youtube]
loooooooool
Simon, you've outdone yourself. :D :D :D :D :D :D :D :D
-
Whhhhahahahahahah Flop Great :L
-
OMG :o
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs669.snc4/60901_153529161338836_130849060273513_376321_5605888_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs707.snc4/62733_157176347640784_130849060273513_395387_7569273_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs687.snc4/62733_157176357640783_130849060273513_395390_3987424_n.jpg)
wtf ???
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs707.snc4/62733_157176360974116_130849060273513_395391_3468431_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs007.snc4/33717_157176580974094_130849060273513_395411_6646329_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs713.snc4/63322_157176670974085_130849060273513_395415_7392776_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs713.snc4/63322_157176687640750_130849060273513_395420_1047951_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs116.snc4/36165_158632910828461_130849060273513_403480_3733808_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs386.snc4/44895_158633007495118_130849060273513_403488_2976143_n.jpg)
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs621.snc4/58113_159638400727912_130849060273513_408694_4376034_n.jpg)
ops
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs011.ash2/33905_160216870670065_130849060273513_411665_6487374_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs002.ash2/33466_160217020670050_130849060273513_411670_1132267_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs792.snc4/67210_164188200272932_130849060273513_434013_3651173_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs797.snc4/67789_164188380272914_130849060273513_434024_1823007_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs793.snc4/67377_164188436939575_130849060273513_434027_1098646_n.jpg)
big fail !!!!
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs415.ash2/69388_164188556939563_130849060273513_434036_7918311_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs181.snc4/37411_134521389906280_130849060273513_277004_1406025_n.jpg)
ahahahha
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs181.snc4/37411_134521416572944_130849060273513_277012_2218289_n.jpg)
-
Simon, you've outdone yourself. :D :D :D :D :D :D :D :D
It's a great video and i am happy to take the credit for posting it, but it was Vert :p
-
Horny turks gone to far!
[youtube]http://www.youtube.com/watch?v=F8yJOjrIcoA[/youtube]
-
lololol
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc3/hs605.snc3/31843_1405317785013_1594455066_949279_4083776_n.jpg)
-
(http://i.imgur.com/2ccPe.jpg)
-
lmao :L
-
This video has to be watched from start to finish or else I am disappoint.
[youtube]pMiE1jLfC-o[/youtube]
-
This video has to be watched from start to finish or else I am disappoint.
[youtube]pMiE1jLfC-o[/youtube]
1:09 he has 3 arms lol
fake video
-
(http://www.funnyforumpics.com/forums/flame-insults/6/Flame-I_have_connections.jpg)
(http://www.funnyforumpics.com/forums/flame-insults/7/Gay-Coleman.jpg)
(http://www.funnyforumpics.com/forums/flame-insults/7/Gay-According_To_This.jpg)
(http://www.funnyforumpics.com/forums/flame-insults/7/Gay-And_Communist.jpg)
(http://www.funnyforumpics.com/forums/flame-insults/7/Gay-Antonio.jpg)
(http://www.funnyforumpics.com/forums/flame-insults/11/normal_Gay-YoureBoth.jpg)
(http://www.funnyforumpics.com/forums/flame-insults/13/anyone_retard.jpg)
-
(http://www.funnyforumpics.com/forums/flame-insults/13/anyone_retard.jpg)
LOOOOOOOOOOOOOL
-
(http://img413.imageshack.us/img413/5574/cablesk.jpg)
(http://img824.imageshack.us/img824/4193/nickcleggtuitionfeesple.jpg)
-
Anyone seen this yet?
http://www.youtube.com/watch?v=UyzCVgR6uZc
Or did that Jeremy Kyle Fanatic tell you about it :P ( Epoxi )
-
(http://i.imgur.com/sOAS8.jpg)
(http://i.imgur.com/Mp50M.jpg)
(http://i.imgur.com/57A8I.jpg)
-
What is it about the second pic what is that sopposed to me ???
-
What is it about the second pic what is that sopposed to me ???
it's sopposed to me left 4 dead 2
-
(http://i.imgur.com/JaaPy.gif)
(http://i.imgur.com/DLAZP.gif)
(http://i.imgur.com/v4t0F.gif)
(http://i.imgur.com/wzYcv.gif)
(http://i.imgur.com/EooR3.jpg)
(http://i.imgur.com/AUOy8.jpg)
(http://i.imgur.com/bz0ZS.jpg)
(http://i.imgur.com/1ART8.jpg)
(http://i.imgur.com/CWHoS.jpg)
(http://i.imgur.com/SU0S1.jpg)
(http://i.imgur.com/eyIQ7.jpg)
(http://i.imgur.com/fWUQN.jpg)
(http://i.imgur.com/XZ4R7.jpg)
(http://i.imgur.com/k2pi8.jpg)
(http://i.imgur.com/1A87F.jpg)
(http://i.imgur.com/Z60CU.jpg)
(http://i.imgur.com/wx5P4.jpg)
(http://i.imgur.com/MvtPE.jpg)
(http://i.imgur.com/bp8OO.jpg)
(http://i.imgur.com/9yrem.jpg)
(http://i.imgur.com/0piDf.jpg)
(http://i.imgur.com/BhVs0.jpg)
(http://i.imgur.com/d8voY.jpg)
(http://i.imgur.com/luXF3.jpg)
(http://i.imgur.com/qVxCb.jpg)
-
hahahahaha
-
lolololololololonden :L
-
(http://niklasblomqvist.se/dump/doland1.jpg)
-
(http://i55.tinypic.com/317fkuh.jpg)
-
hah :L
-
LOOOL
[youtube]http://www.youtube.com/watch?v=NAkGC1JSTlo[/youtube]
-
Watch that at your own risk, I will have nightmares for weeks :'(
-
She wears a garbage bag as underwear? :o
-
[youtube]http://www.youtube.com/watch?v=NAkGC1JSTlo[/youtube]
O_O
-
I don't understand how people get that fat. lol
-
[youtube]http://www.youtube.com/watch?v=TwJbnMbv0lU[/youtube]
-
lol
-
lol ^
[youtube]http://www.youtube.com/watch?v=NNu25BeIobA&feature=player_embedded[/youtube]
-
omg
-
haha
-
http://www.funnyjunk.com/funny_pictures/1287325/Slap+da+biatch/
-
ducksauce
[youtube]http://www.youtube.com/watch?v=uu_zwdmz0hE[/youtube]
-
(http://static.funnyjunk.com/pictures/4c16340b_1cdb_83ab0.jpg)
-
NSFW: http://funchun.com/pictures/funny-fatty-5.jpg
PLEASE DON'T READ THIS YOU WILL BE KISSED ON THE NEAREST POSSIBLE FRIDAY BY THE LOVE OF YOUR
LIFE.TOMORROW WILL BE THE BEST DAY OF YOUR LIFE. NOW YOU'VE STARTED READING THIS. DON'T STOP. THIS IS SO
FREAKY.
1. say your name 10 times
2. say your mom's name 5 times
3. say your crushes name 3 times
4. paste this to 4 other pictures. if you do this, your crush will kiss you on the nearest Friday. but if you read this and do not paste this, then you will have very bad luck. SEND THIS TO 5 PICTURES IN 143 MINUTES. WHEN YOU'RE DONE PRESS F6 AND YOUR CRUSH'S NAME WILL APPEAR IN BIG LETTERS ON THE SCREEN. THIS IS SO FREAKY BECAUSE IT ACTUALLY WORK..
(http://www.thanksgivingjoys.com/funny_pictures/thanksgiving_funny_picture_02.jpg)
PLEASE DON'T READ THIS YOU WILL BE KISSED ON THE NEAREST POSSIBLE FRIDAY BY THE LOVE OF YOUR
LIFE.TOMORROW WILL BE THE BEST DAY OF YOUR LIFE. NOW YOU'VE STARTED READING THIS. DON'T STOP. THIS IS SO
FREAKY.
1. say your name 10 times
2. say your mom's name 5 times
3. say your crushes name 3 times
4. paste this to 4 other pictures. if you do this, your crush will kiss you on the nearest Friday. but if you read this and do not paste this, then you will have very bad luck. SEND THIS TO 5 PICTURES IN 143 MINUTES. WHEN YOU'RE DONE PRESS F6 AND YOUR CRUSH'S NAME WILL APPEAR IN BIG LETTERS ON THE SCREEN. THIS IS SO FREAKY BECAUSE IT ACTUALLY WORK..
(http://lucrurisimplee.files.wordpress.com/2009/05/funny.jpg)
PLEASE DON'T READ THIS YOU WILL BE KISSED ON THE NEAREST POSSIBLE FRIDAY BY THE LOVE OF YOUR
LIFE.TOMORROW WILL BE THE BEST DAY OF YOUR LIFE. NOW YOU'VE STARTED READING THIS. DON'T STOP. THIS IS SO
FREAKY.
1. say your name 10 times
2. say your mom's name 5 times
3. say your crushes name 3 times
4. paste this to 4 other pictures. if you do this, your crush will kiss you on the nearest Friday. but if you read this and do not paste this, then you will have very bad luck. SEND THIS TO 5 PICTURES IN 143 MINUTES. WHEN YOU'RE DONE PRESS F6 AND YOUR CRUSH'S NAME WILL APPEAR IN BIG LETTERS ON THE SCREEN. THIS IS SO FREAKY BECAUSE IT ACTUALLY WORK..
(http://lh4.ggpht.com/_ec1BOF9ZilU/S8gVx9tIy7I/AAAAAAAAAts/NN3KietLuAk/s800/funny-face.jpg)
PLEASE DON'T READ THIS YOU WILL BE KISSED ON THE NEAREST POSSIBLE FRIDAY BY THE LOVE OF YOUR
LIFE.TOMORROW WILL BE THE BEST DAY OF YOUR LIFE. NOW YOU'VE STARTED READING THIS. DON'T STOP. THIS IS SO
FREAKY.
1. say your name 10 times
2. say your mom's name 5 times
3. say your crushes name 3 times
4. paste this to 4 other pictures. if you do this, your crush will kiss you on the nearest Friday. but if you read this and do not paste this, then you will have very bad luck. SEND THIS TO 5 PICTURES IN 143 MINUTES. WHEN YOU'RE DONE PRESS F6 AND YOUR CRUSH'S NAME WILL APPEAR IN BIG LETTERS ON THE SCREEN. THIS IS SO FREAKY BECAUSE IT ACTUALLY WORK..
-
.............................................................................................
-
^
-
I just had to do it lol, cant risk any bad luck today, going to a party of someone I like a lot, common, gotta admit I chose some good pics :P
-
you're too superstitious :)
unrelated image:
(http://i.imgur.com/ccCMC.jpg)
-
you're too superstitious :)
didnt work anyway :(
-
(http://www.gifbin.com/bin/072009/1248697866_bottle-rocket.gif)
ahahahah
(http://www.gifbin.com/bin/072009/1248709222_slap-dance.gif)
(http://www.gifbin.com/bin/2005309swsw.gif)
(http://www.gifbin.com/bin/20083yusw98.gif)
(http://www.gifbin.com/bin/200swsw59080.gif)
ahahah
(http://www.gifbin.com/bin/2074yu4sw2.gif)
ahahahah
(http://www.gifbin.com/bin/208sw22yu2sw8.gif)
-
(http://www.gifbin.com/bin/230sw7sw0000.gif)
(http://www.gifbin.com/bin/2509493sw3.gif)
o.O""
(http://www.gifbin.com/bin/250988398.gif)
(http://www.gifbin.com/bin/25yu3420sw.gif)
(http://www.gifbin.com/bin/2723swyu4802.gif)
ahahaha
(http://www.gifbin.com/bin/102009/1256127105_how_many_cops.gif)
ftw pedobear
(http://www.gifbin.com/bin/102009/1256553611_cat-vs-teddy-bear.gif)
(http://www.gifbin.com/bin/112010/1290708698_magic-chair.gif)
-
all links failed XD
-
spam fails :'( :D
-
READ THIS BACKWARDS THEN HOLD CTRL+W AND YOU'RE CRUSHES NAME WILL APPEAR ON YOUR SCREEN AND YOU WILL HAVE THE BEST DAY OF YOUR LIFE TOMORROW
:o worked for me
-
why im sooo ILL i wish ders an angle cn swep mii off ma feel nd keep miii warm r u dat angle ♥ plz tell mi now
-
AND YOU'RE CRUSHES NAME
you're ???
-
[youtube]http://www.youtube.com/watch?v=vvhr3PFHX-k[/youtube]
-
[youtube]http://www.youtube.com/watch?v=vvhr3PFHX-k[/youtube]
:L ftw
-
so fucking catchy :L
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1190.snc4/154277_178738002153077_128713107155567_606220_332946_n.jpg)
:L
-
[youtube]http://www.youtube.com/watch?v=-00yQLu_Z18[/youtube]
-
[YOUTUBE]http://www.youtube.com/watch?v=OT7_JL6sijU[/YOUTUBE]
LOL
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1190.snc4/154277_178738002153077_128713107155567_606220_332946_n.jpg)
:L
lol why wouldn't he just delete it instead of replying? fake fake fake :(
-
lololololol
[youtube]http://www.youtube.com/watch?v=bNz7VY-JySI[/youtube]
-
that one on the left laugh like a witch ;D
[youtube]http://www.youtube.com/watch?v=0MD6Cx0qzRA[/youtube]
-
(http://img838.imageshack.us/img838/4558/foreveraloneinthedarkby.png)
-
lmao :L
-
[youtube]http://www.youtube.com/watch?v=J72d1Bzf22A[/youtube]
-
that one on the left laugh like a witch ;D
[youtube]http://www.youtube.com/watch?v=0MD6Cx0qzRA[/youtube]
LOL XD
-
http://video.nl.msn.com/watch/video/auto-vs-gladde-helling-wie-wint/5cml0rq0
lool america in snow
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs469.ash2/74249_10150317175955710_10150138064740710_15986399_4521410_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1181.snc4/150393_10150317201260710_10150138064740710_15986921_4530633_n.jpg)
Alone in the dark ahhahahah
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1170.snc4/154295_10150317177645710_10150138064740710_15986437_7390936_n.jpg)
kikkkiriikii
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs955.snc4/74877_10150317175400710_10150138064740710_15986379_3426792_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1336.snc4/162834_10150330875345710_10150138064740710_16215667_7238798_n.jpg)
O.o" lol
[/img]http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs604.ash2/155670_10150317177865710_10150138064740710_15986445_4658678_n.jpg[/img]
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1170.snc4/154245_10150317178035710_10150138064740710_15986452_6373425_n.jpg)
lololol
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs586.ash2/150817_10150317179705710_10150138064740710_15986496_4291348_n.jpg)
ahahah
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1178.snc4/155037_10150317179760710_10150138064740710_15986498_7978246_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1158.snc4/150007_10150317178400710_10150138064740710_15986462_6941055_n.jpg)
3D
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs963.snc4/75672_10150317179035710_10150138064740710_15986480_568388_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1143.snc4/148530_10150317180990710_10150138064740710_15986531_6033571_n.jpg)
:P
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs976.snc4/76986_10150317180325710_10150138064740710_15986513_3695704_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs581.ash2/150340_10150317180485710_10150138064740710_15986518_5709186_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1174.snc4/154638_10150317180570710_10150138064740710_15986519_4976101_n.jpg)
ahahahahha
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs602.ash2/155450_10150317181490710_10150138064740710_15986547_3775577_n.jpg)
ahahahahhaha
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1206.snc4/155836_10150317181530710_10150138064740710_15986548_5108549_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1126.snc4/148858_10150317181285710_10150138064740710_15986540_287618_n.jpg)
Hot dog
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1128.snc4/149048_10150317181310710_10150138064740710_15986541_3379030_n.jpg)
ahahahahahahha
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs984.snc4/75790_10150317181650710_10150138064740710_15986553_4193727_n.jpg)
ahahahahaha
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1186.snc4/150892_10150317182760710_10150138064740710_15986586_4853629_n.jpg)
ahahahahahah
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs976.snc4/76903_10150317182845710_10150138064740710_15986589_2491603_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1221.snc4/155302_10150317183080710_10150138064740710_15986599_1766388_n.jpg)
Wazzupppppp
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1195.snc4/154789_10150317183330710_10150138064740710_15986610_978975_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1200.snc4/155258_10150317183545710_10150138064740710_15986620_1671706_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1177.snc4/154985_10150317183725710_10150138064740710_15986626_4002052_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1137.snc4/149983_10150317183985710_10150138064740710_15986638_4686311_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1133.snc4/149537_10150317184110710_10150138064740710_15986645_2268392_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1196.snc4/154847_10150317184160710_10150138064740710_15986647_5802889_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs971.snc4/76434_10150317184545710_10150138064740710_15986667_4684776_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs955.snc4/74813_10150317199100710_10150138064740710_15986911_6176161_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1130.snc4/149206_10150317201430710_10150138064740710_15986925_6384892_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs971.snc4/76489_10150317209260710_10150138064740710_15987009_1593287_n.jpg)
lol
(http://l30.sphotos.l3.fbcdn.net/hphotos-l3-snc4/hs946.snc4/73984_10150317209320710_10150138064740710_15987011_3486288_n.jpg)
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs469.ash2/74249_10150317175955710_10150138064740710_15986399_4521410_n.jpg)
Lol'd, i guess i'm 'TRAAAAAAAA'
-
Haha nice pics :L
-
TRAAAAAAAAAAAAAAAAAAAAAAAAAA
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1130.snc4/149206_10150317201430710_10150138064740710_15986925_6384892_n.jpg)
lol @ Gen in the background
-
[youtube]http://www.youtube.com/watch?v=eAns4rCzQKY&feature=player_embedded[/youtube]
HAHAHAHAH
-
Haha nice pics :L
first-class :D
-
I have recently returned from a party, I did not sleep, What do? ??? ???
-
smoke a joint, helps :)
-
sleep
-
[youtube]http://www.youtube.com/watch?v=eAns4rCzQKY&feature=player_embedded[/youtube]
HAHAHAHAH
nice one
-
In Polish it would be KUUUUURWA
-
[youtube]http://www.youtube.com/watch?v=DPof1s_W9AA[/youtube]
-
(http://www.crnobelo.com/images/stories/2010/07/tazniot-kraj-na-oktopodot-pol-2.jpg)
(http://www.crnobelo.com/images/stories/2010/07/tazniot-kraj-na-oktopodot-pol-3.jpg)
(http://www.crnobelo.com/images/stories/2010/07/tazniot-kraj-na-oktopodot-pol-4.jpg)
-
(http://i.imgur.com/juVdF.jpg)
(http://i.imgur.com/8QF3j.jpg)
(http://i.imgur.com/Yotdj.jpg)
-
lol garf-eel
-
lmao :L :L
-
omfg I rofled so fuckin hard at those messages.
Jeez my stomach, I might die of laughter
-
lol me too. i don't know why but i find them so funny and by the end i was almost crying from laughter
-
http://www.metacafe.com/watch/1296583/trapped_in_an_elevator_with_diarrhea/
-
poor guy ^
and...
epic duckface :L
(http://i.imgur.com/OHRt4.jpg)
-
ivan
-
:L
-
(http://www.mccullagh.org/db9/d30-14/jesus-and-satan.jpg)
-
Devil and Neptune ? :L
-
more like Jesus than Neptune lol
-
1st of all, MadMax crashed his Jetmax boat :(
(http://obczaj.net/obrazki/130429.jpg)
(http://obczaj.net/obrazki/130461.jpg)
(http://obczaj.net/obrazki/130456.jpg)
(http://obczaj.net/obrazki/130433.jpg)
(http://obczaj.net/obrazki/130432.jpg)
(http://obczaj.net/obrazki/130462.jpg)
-
ivan
i knew you/thomas would say something like that lol
-
@Madmax: The full version is actually...
E^2 = m^2*c^4 + m^2*p^2
-
wtf
[youtube]http://www.youtube.com/watch?v=17Eb8RMMNEQ&feature=fvsr[/youtube]
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs696.snc4/63625_1504633256830_1264225318_31104420_4308253_n.jpg)
-
Lol ivan,this is not funny >:( this is for crying... : :o
-
this is epic
(http://staticrps.komixxy.pl/uimages/201012/1292350832_by_diarra_500.jpg)
-
[youtube]http://www.youtube.com/watch?v=v1JJF2OQYy8[/youtube]
Real life GTAIV: watch all the way through.
-
ahahahahah cooollllllllllllllllllllllllllllllllllllllllll :D :D :D :L :L :L :L
-
This is epic :L
[youtube]http://www.youtube.com/watch?v=FavUpD_IjVY[/youtube]
and this must be the craziest videoclip I've ever seen :L
[youtube]http://www.youtube.com/watch?v=PKTPf4BaHNs[/youtube]
both of them are surely great when you're high lol
-
lool that cows
-
omg what an asshole, fuckin cunt hit a porshce cayenne when driving back
-
(http://static.gamesradar.com/images/mb/GamesRadar/us/Features/2010/12/Worst%20box%20art%202010/justdance1--article_image.jpg)
(http://static.gamesradar.com/images/mb/GamesRadar/us/Features/2010/12/Worst%20box%20art%202010/justdance2--article_image.jpg)
(http://static.gamesradar.com/images/mb/GamesRadar/us/Features/2010/12/Worst%20box%20art%202010/justdance3--article_image.jpg)
(http://static.gamesradar.com/images/mb/GamesRadar/us/Features/2010/12/Worst%20box%20art%202010/justdance4--article_image.jpg)
(http://static.gamesradar.com/images/mb/GamesRadar/us/Features/2010/12/Worst%20box%20art%202010/justdance5--article_image.jpg)
(http://static.gamesradar.com/images/mb/GamesRadar/us/Features/2010/12/Worst%20box%20art%202010/justdance6--article_image.jpg)
-
http://www.vidup.de/v/Jwopc/ :L
-
Phobos, all of Cyriak's stuff is mental/great, like this:
[youtube]gq7MvLgxSB4[/youtube]
And now for something completely different:
[youtube]m6w0r-ScEG4[/youtube]
-
[youtube]http://www.youtube.com/watch?v=UnE3Oh_AMbA[/youtube]
Can You Dig It SUCKA!? :L :L :L :L :L
-
(http://25.media.tumblr.com/tumblr_ldhva1EHgh1qc0cxpo1_500.png)
-
[youtube]http://www.youtube.com/watch?v=XJ1zcm0_khk&feature=player_embedded[/youtube]
-
lol
-
OzzY owns, as always, owns
-
OzzY owns, as always, owns
true true..
-
Serious time.
(http://www.funnypictures.com/pictures/Flags_of_the_World_Explained.jpg)
Also from an actual picture taken by Jarno in Snow topic...
Jarno's big pics.
(http://img218.imageshack.us/img218/6923/vant.jpg)
-
whaha i know it must be art :L
-
Admit it Jarno you and your dad went for a ride and you bought mom a new car at the same brand and parked it there before she woke up
-
strange piece of art, lol.
-
(http://img213.imageshack.us/img213/5858/wtfgifs03.gif)
(http://i.imgur.com/JSbe5.gif)
(http://i.imgur.com/v4Nh5.gif)
(http://i.imgur.com/rnxf7.gif)
(http://i.imgur.com/jjERp.jpg)
(http://i.imgur.com/GI1RL.jpg)
(http://i.imgur.com/s86Ig.jpg)
(http://i.imgur.com/VjHgo.jpg)
(http://i.imgur.com/GEINk.jpg)
(http://i.imgur.com/JjoiY.jpg)
(http://i.imgur.com/S8XuO.jpg)
(http://i.imgur.com/A7FSP.jpg)
(http://i.imgur.com/tjCdo.jpg)
-
lool great pics
-
(http://i.imgur.com/GEINk.jpg)
Hhaahah so true XD
-
There should also be this: "Jarno goes crazy and makes a topic about it on AX forum."
-
For all the Estonians
[youtube]http://www.youtube.com/watch?v=h6XgPkNPKvk&feature=player_embedded[/youtube]
-
lmao!
-
Ooooold!
-
[youtube]http://www.youtube.com/watch?v=OTya267fe1Y[/youtube]
(http://bestuff.com/images/images_of_stuff/210x600/oo-167433.jpg?1225038323)
and this gay is famous
[youtube]http://www.youtube.com/watch?v=bUrH1wJVz5Q&feature=related[/youtube]
(http://bestuff.com/images/images_of_stuff/210x600/oo-167433.jpg?1225038323)
-
[YOUTUBE]http://www.youtube.com/watch?v=ivctGA5WeF8&feature=player_embedded#![/youtube]
-
:L
-
[youtube]http://www.youtube.com/watch?v=Kk9oa_PiXAk[/youtube]
-
Gotta watch that film :)
-
Only for estonians! :D :-*
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash1/hs752.ash1/164368_174924015874799_100000716058907_423785_4118739_n.jpg)
-
hahaha!
-
[youtube]tch5a1vOwbw[/youtube]
Watch all of it. O0
-
catchy song :P ^
(http://i.imgur.com/BV51O.jpg)
-
Only for estonians! :D :-*
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash1/hs752.ash1/164368_174924015874799_100000716058907_423785_4118739_n.jpg)
I APPROVE THIS MESSAGE
-
MESSAGE DOESN'T APPROVE YOU
-
Excuse me sir, your caps lock button seems to be stuck.
-
Only for estonians! :D :-*
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash1/hs752.ash1/164368_174924015874799_100000716058907_423785_4118739_n.jpg)
Complaining to Jesus because your favourite celebrities die ftw.
-
(http://obczaj.net/obrazki/131366.jpg)
-
(http://artoftrolling.files.wordpress.com/2010/12/chatroulette-trolling-lemon-of-troy.jpg)
-
Only for estonians! :D :-*
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash1/hs752.ash1/164368_174924015874799_100000716058907_423785_4118739_n.jpg)
Complaining to Jesus because your favourite celebrities die ftw.
Everyone can use a translator and FAIL with it.
-
(http://i.telegraph.co.uk/telegraph/multimedia/archive/01455/White-afro_1455424i.jpg)
(http://i.telegraph.co.uk/telegraph/multimedia/archive/01455/Helicopter_1455412i.jpg)
(http://i.telegraph.co.uk/telegraph/multimedia/archive/01455/Handles_1455390i.jpg)
(http://i.telegraph.co.uk/telegraph/multimedia/archive/01455/Head-glasses_1455375i.jpg)
(http://i.telegraph.co.uk/telegraph/multimedia/archive/01455/Face_1455397i.jpg)
(http://www.video2funny.com/files/pictures/red-head-haircut_1.jpg)
-
(http://static.funnyjunk.com/gifs/release_the_kraken.gif)
-
(http://filesmelt.com/dl/psywat.png)
-
Woo this commercial was recorded in my town :D :D
the countryside is somewhere else though
[youtube]http://www.youtube.com/watch?v=aJgfXD9TYEw[/youtube]
-
[youtube]http://www.youtube.com/watch?v=YTI2Z9QkbYU&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?v=YTI2Z9QkbYU&feature=related[/youtube]
(http://lh5.ggpht.com/_zXUbph947iU/TIW4Oz0ckvI/AAAAAAAAAGc/Lc4AuRwHDwg/afff.gif)
-
(http://d3uwin5q170wpc.cloudfront.net/photo/61605_700_v1.jpg)
-
[youtube]http://www.youtube.com/watch?v=YTI2Z9QkbYU&feature=related[/youtube]
(http://lh5.ggpht.com/_zXUbph947iU/TIW4Oz0ckvI/AAAAAAAAAGc/Lc4AuRwHDwg/afff.gif)
:L
-
fuckin rabbits
[youtube]http://www.youtube.com/watch?v=jiAe1AuDJ8o[/youtube]
-
[20:48:44] SA-MP 0.3b-R3 Started
[20:48:49] Connecting to 78.129.221.58:7777...
[20:48:49] Connected. Joining the game...
[20:48:49] *** [2F2F]MikeGTFO (Portugal) has joined the server [Registered Player]
[21:04:50] [___]B_M_W[___] by [LSD]Snoopy 5.2 Miles No Extra Information
[21:05:28] <Digiben> mike gtfo h@cker
[21:05:41] <[2F2F]MikeGTFO> cool story bro
[21:05:45] <Digiben> ....
[21:05:49] <Digiben> i saw u speeding
[21:06:14] <[2F2F]MikeGTFO> Digiben, don't use report id please :(
[21:06:15] <[MAF]Snoopy> digiben is probably the one speedading
[21:06:20] <[MAF]Snoopy> speeding(
21:07:03] >> Digiben(6) i chit, don't tell no one it will be our secret!
[21:07:09] <Digiben> kk
[21:07:27] >> Digiben(6) you also chit?
[21:07:39] ** Digiben(6): nope lol dont have hacks
[21:08:11] >> Digiben(6) oh, okay my friend :) if you want my speeding i can give you in my msn
[21:08:44] ** Digiben(6): mod sobeit? ;p
[21:08:54] >> Digiben(6) ya you have it also?
[21:09:06] ** Digiben(6): nah used it old times after windows restart
21:09:29] ** Digiben(6): do u have skype?
[21:09:36] ** Digiben(6): lol
[21:10:43] >> Digiben(6) want me to give it by skype?
[21:10:59] ** Digiben(6): yh plz?
[21:11:39] >> Digiben(6) xD we could both start haxing here right?
[21:11:45] ** Digiben(6): yh l0l
He google his cheats and came back...
[21:22:44] Digiben has been banned by [FSR]Phobos (Reported:airbrake)
I think he deserves an unban, it was my faul i made him hack... he didn't hack if i don't tell him to
-
owned lol
-
:L
-
lmao that dude was great
-
[youtube]http://www.youtube.com/watch?v=RKuGKh5wLHI[/youtube]
"How to become a Sponge Bob"
First comment with 36 "Ups" - In soviet russia hay stacks you
lol
Oh and that
(http://lh5.ggpht.com/_zXUbph947iU/TIW4Oz0ckvI/AAAAAAAAAGc/Lc4AuRwHDwg/afff.gif)
is just epic :D
-
To be a spongebob
1st. Buy a tractor
2nd.Buy a Hey-bale maker
3rd.jump in it
4. FINISHED YOU'RE A SPONGE
-
you're*
-
It says You're there :P
-
Kinda NSFW, for people from Britain and who understand british only words, watch.
[youtube]http://www.youtube.com/watch?v=esVcr8E4fTE[/youtube]
-
This video contains content from Channel 4, who has blocked it in yoru country on copyright grounds.
-
This video contains content from Channel 4, who has blocked it in your country on copyright grounds.
Sorry about that.
FUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU
-
Lmfao, it's a british video.
-
I could watch it O0
-
found it on a different site, with no country limit :S
http://www.dailymotion.com/video/x4vq2d_balls-of-steel-mr-inappropriate_fun
-
Yeh, Mr. Ina Proppriate helped me go long way in life.
-
Yeh, Mr. Ina Proppriate helped me go long way in life.
wanking in public? showing your cock at a hairdressers? your life is pretty fucked then :P
-
lol
(http://i53.tinypic.com/2nm185d.jpg)
-
[YOUTUBE]http://www.youtube.com/watch?v=eUY3ro_9FJ4&feature=player_embedded[/YOUTUBE]
(A)O0 >:D O0 >:D (A) >:D O0 (A)
-
lol
(http://i53.tinypic.com/2nm185d.jpg)
LIKE PETER GRIFFIN
(http://www.myspaceimagecodes.net/images/70568The_simpsons_homer_simpson_vs_family_guy_peter_griffin.jpg)
-
Easily one of the most amazing videos you will ever see.
[youtube]u3L2_Z2V2tg[/youtube]
-
Holy shit.
-
Hah, that is epic :D
and 2:00 WTF :L
-
lmao that plane at 0.40
-
lol the last one
-
(http://www.rgbpicture.com/img/weird/wtf-photos/wtf-photos01.jpg)
(http://www.rgbpicture.com/img/weird/wtf-photos/wtf-photos19.jpg)
(http://www.rgbpicture.com/img/weird/wtf-photos/wtf-photos18.jpg)
(http://www.rgbpicture.com/img/weird/wtf-photos/wtf-photos09.jpg)
(http://www.rgbpicture.com/img/weird/wtf-photos/wtf-photos24.jpg)
-
(http://www.rgbpicture.com/img/weird/wtf-photos/wtf-photos01.jpg)
lol cartman
-
[youtube]VKsVSBhSwJg[/youtube]
"hide your kids, hide your wife
and hide your husband
cuz they're rapin errbody out here"
:L :L
(Original video)
[YOUTUBE]EzNhaLUT520[/YOUTUBE]
-
(http://files.sharenator.com/foreveralone_honey_Forever_Alone_Meme-s500x446-111791-580.jpg)
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc6/hs005.snc6/165575_180491795308027_100000416221069_531969_451404_n.jpg)
-
1:30
[youtube]http://www.youtube.com/watch?v=8gPRZFZrVp0[/youtube]
-
wtf :L
-
???
-
lmao :L
-
i thought that blonde haired person at the beginning was gen
-
same ^
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs009.ash2/33788_1661607134699_1072804869_31817591_2371670_n.jpg)
-
o.0 Did you think it was gen ???? ??? ??? ???
-
Estonia is only 16 people, it was Me, Gen, Karlip and umm Phil was the fat one.. the rest were spectators... obviously
-
What about the referee and the guy commenting it? karlip's brother?
-
(http://i.imgur.com/U7iqK.gif)
-
hahahaahahahahahahahhahahhaha
-
(http://chzmemebase.files.wordpress.com/2011/01/memes-dorablocked.jpg)
(http://artoftrolling.files.wordpress.com/2010/12/chatroulette-trolling-m.jpg)
(http://chzmemebase.files.wordpress.com/2011/01/memes-troll-jokes.jpg)
(http://artoftrolling.files.wordpress.com/2010/12/chatroulette-trolling-meloncholy-bear.jpg)
(http://artoftrolling.files.wordpress.com/2010/12/chatroulette-trolling-that-is-pretty-wimpy.jpg)
-
LOL
-
Which one was first, egg or chicken? :D
[youtube]zz-tkhBJJY8[/youtube]
-
During the process of evolution, the genetic mutation occurs in the embryo. This means the egg came first. What laid the egg what genetically VERY similar, but it wasn't, what we call by today's standards, a chicken. The funny thing is, this is EXACTLY what the "X-Men" are all about. These mutants are, in fact, the next evolutionary step from homo-sapien to homo-superior. The first mutant's parent was a human. If anybody should understand the chicken/egg question, it would be mutants.
-
lolol
Which one was first, egg or chicken? :D
[youtube]zz-tkhBJJY8[/youtube]
-
(http://chzmemebase.files.wordpress.com/2011/01/memes-dorablocked.jpg)
This is sooooo true. :L
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc6/hs047.snc6/167759_487886599716_5510669716_5736380_2709697_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs125.ash2/39597_455440834716_5510669716_5257937_169554_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs404.ash2/68208_483968159716_5510669716_5660995_5368619_n.jpg)
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc6/hs047.snc6/167759_487886599716_5510669716_5736380_2709697_n.jpg)
"The death star"
-
[youtube]http://www.youtube.com/watch?v=WUgqXGu_gTQ[/youtube]
-
(http://totallylookslike.files.wordpress.com/2010/12/adcc57cb-01ed-40cf-9c5a-9c8bdc4e92a4.jpg)
(http://totallylookslike.files.wordpress.com/2010/12/d6875fd7-f658-4621-b654-f64bd6e1acd1.jpg)
(http://totallylookslike.files.wordpress.com/2010/11/955f3b47-44fb-4caa-aaa1-1bc185ab3048.jpg)
(http://totallylookslike.files.wordpress.com/2010/12/katy-perry-totally-looks-like-2-rolls-of-towlet-paper-and-a-basket.jpg)
(http://totallylookslike.files.wordpress.com/2010/11/c6e6b605-c6c3-42c5-8c97-8faef8b8cf92.jpg)
(http://i.imgur.com/GPvjw.png)
This happened the other day when three girls came into my room. I just left it on full volume and cool-ly talked to them as if I was watching BBC Country File.
(http://4.bp.blogspot.com/_ymugoI_yvFY/TNt40sdXeQI/AAAAAAAAAAs/0Kqbq44TSrE/s200/trollface.jpg)
-
:L :L :L
-
(http://totallylookslike.files.wordpress.com/2010/11/c6e6b605-c6c3-42c5-8c97-8faef8b8cf92.jpg)
hard to believe they are so similar....
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1372.snc4/164404_480410444700_792794700_5499589_4388319_n.jpg)
-
[youtube]ZX6bMSG0Gy8[/youtube]
[youtube]ml7ZhupDLok[/youtube]
-
http://www.youtube.com/watch?v=WkbCpEtntrI&feature=player_embedded (http://www.youtube.com/watch?v=WkbCpEtntrI&feature=player_embedded)
-
[youtube]http://www.youtube.com/watch?v=7E63H6kOMnE&feature=related[/youtube]
-
Still sucks, but it's 1,000,000x better than the original.
[youtube]http://www.youtube.com/watch?v=oemgqr1t60A[/youtube]
-
omg i cant believe this.. this is a disgrace to metal music
-
Still sucks, but it's 1,000,000x better than the original.
[youtube]http://www.youtube.com/watch?v=oemgqr1t60A[/youtube]
Hmm, this sounds like the average metal artist.
-
Remove Bieber and place someone who can sing and then it would be a pretty good metal song lol
-
Still sucks, but it's 1,000,000x better than the original.
[youtube]http://www.youtube.com/watch?v=oemgqr1t60A[/youtube]
Hmm, this sounds like the average metal artist.
heavy metal singing is usually low pitched shouting, the opposite of what bieber does. but yeah, the background music is like normal metal.
-
[youtube]http://www.youtube.com/watch?v=uu_zwdmz0hE[/youtube]
Was this song copied from an Estonian song shown below? :o
[youtube]http://www.youtube.com/watch?v=klsqFRvXFFs[/youtube]
-
[youtube]http://www.youtube.com/watch?v=7E63H6kOMnE&feature=related[/youtube]
m4? O_o
-
woo, you're awake before 4pm :) and wtf at that fat guy lol
-
woo ^-^
-
Still sucks, but it's 1,000,000x better than the original.
[youtube]http://www.youtube.com/watch?v=oemgqr1t60A[/youtube]
Hmm, this sounds like the average metal artist.
heavy metal singing is usually low pitched shouting, the opposite of what bieber does. but yeah, the background music is like normal metal.
That sucked. A bad song will be bad whatever genre its transformed into. Now heres a metal version of a good song (Back In The USSR by The Beatles):
[youtube]http://www.youtube.com/watch?v=iScYtBqV_w8[/youtube]
EDIT: nothing HD about that
-
Like I said, it's Bieber, so it's gonna suck. But the metal version owned the pop one.
-
[youtube]http://www.youtube.com/watch?v=uu_zwdmz0hE[/youtube]
lol old O0
-
[youtube]http://www.youtube.com/watch?v=uu_zwdmz0hE[/youtube]
lol old O0
Read the whole post noob! ;D
-
Still sucks, but it's 1,000,000x better than the original.
[youtube]http://www.youtube.com/watch?v=oemgqr1t60A[/youtube]
turn screen off, and you can think like it is female vocal metal band (don't know any good examples for now, but i m sure there are female vocal in metal bands too))
-
(http://i.imgur.com/oALG8.jpg)
-
turn screen off, and you can think like it is female vocal metal band (don't know any good examples for now, but i m sure there are female vocal in metal bands too))
Simone Simons, one of the best vocals I've ever heard, just listen to that voice..
[youtube]http://www.youtube.com/watch?v=Dys1_TuUmI4[/youtube]
oh and shes also hot O0
(http://sphotos.ak.fbcdn.net/photos-ak-sf2p/v354/213/122/36054882909/n36054882909_992457_2390.jpg)
-
why do all these boys have long hair lol, they look nurdy and.. not what a man should be like.
-
richardhamster
-
:L :L :L :L
-
richardhamster
Jesus
-
why do all these boys have long hair lol, they look nurdy and.. not what a man should be like.
we are not messing with your rap shit, this is the second time you do it, stop doing it mr I want to be black
-
Simone Simons, one of the best vocals I've ever heard, just listen to that voice..
Nice voice and fit. I'd like to hear her in another tune though, as i am not great fan on that one.
*Runs off to youtube her*
-
oh and shes also hot O0
(http://sphotos.ak.fbcdn.net/photos-ak-sf2p/v354/213/122/36054882909/n36054882909_992457_2390.jpg)
Perhaps I've been looking at her boobs for too long, but that area looks photoshoped lol.
-
[youtube]http://www.youtube.com/watch?v=uTysXITBCmk[/youtube]
Why can't the guy with the big issue be like this? :o
-
(http://img41.imageshack.us/img41/4550/wankupcall.png)
(http://img641.imageshack.us/img641/5979/wankadoodledoo.png)
:L
-
[youtube]http://www.youtube.com/watch?v=uTysXITBCmk[/youtube]
Why can't the guy with the big issue be like this? :o
It was glad to see this guy with a great talented voice after all this shit he passed to get a job, what an optimistic story! (A)
Ted Williams' Life-Changing 48 Hours (http://www.cbs.com/daytime/the_early_show/video/?pid=2JSyrR9K5RDV6D_FC1uGrtY_uJCJKJWN)
-
yeah nice story. would've never happend to him in Europe.
-
why do all these boys have long hair lol, they look nurdy and.. not what a man should be like.
we are not messing with your rap shit, this is the second time you do it, stop doing it mr I want to be black
Don't worry, i agree with both of you.
-
(http://www.lolbrary.com/lolimages/lolimage%20%281471%29.jpg)
-
lmao
-
(http://onceuponawin.files.wordpress.com/2009/01/win-pictures-nerds.jpg)
-
To be fair to Bill, i think it is great he jacked in leading MS to concentrate on giving his money away through his foundation with his wife Melissa.
-
(http://img828.imageshack.us/img828/8937/562bad0840d86738.jpg)
Most Muslims are nice guys. :D
-
lol
-
Muslims make most casualties among other muslims..
-
Not sure and cba to look if this got posted already before Christmas:
[youtube]ljPFZrRD3J8[/youtube]
-
^LoOL Simon's wedding.
(http://img35.imageshack.us/img35/5849/1236806571968.jpg)
-
omg poor bird :'(
-
(http://www.impactlab.com/wp-content/uploads/2008/12/hamster-wheel-448.jpg)
(http://www.impactlab.com/wp-content/uploads/2008/12/sock-eye-view-980.jpg)
(http://www.xenophilia.com/news/humanmouse.jpg)
-
^LoOL Simon's wedding.
(http://img35.imageshack.us/img35/5849/1236806571968.jpg)
Holy shit. :-\
-
[youtube]http://www.youtube.com/watch?v=c_FMtBZ47RI[/youtube]
I didn't see Gen. HE LIED TO US.
-
I didn't see Gen. HE LIED TO US.
Nonono, he told me he is gonna dress himself as a girl to not be noticed.
-
Not sure and cba to look if this got posted already before Christmas:
[youtube]ljPFZrRD3J8[/youtube]
hahaha, they're so popular here, well obviously since it's irish :L didn't think I'd see it here :L
-
ROTFSHTWIGUISOTRABBAAIHMHSHTIHTFAWMMLSHTIWROTFSH…:
Rolling on the floor so hard that when I got up I slipped over the randomly appeared banana by accident and I hit my head so hard that I hit the floor again, wich made me laugh so hard that I was rolling on the floor so hard…
-
:L
-
I didn't see Gen. HE LIED TO US.
Nonono, he told me he is gonna dress himself as a girl to not be noticed.
he's the girl shown on the posters.. with the brown hair!
-
(http://chzmemebase.files.wordpress.com/2011/01/memes-dishwasher.jpg)
-
hahahahahahaha :L :L :L :L :L :L
NICE ONE!
-
last one is for [HC] chocolate lover :L :L :L :L
[youtube]http://www.youtube.com/watch?v=rJAwf2dKIds&feature=related[/youtube] | [youtube]http://www.youtube.com/watch?v=YWFP3TDmu1o[/youtube] |
[youtube]http://www.youtube.com/watch?v=z9Zppcjecww&feature=related[/youtube] | [youtube]http://www.youtube.com/watch?v=MzOMogWRIo4[/youtube] |
-
epic :)
-
(http://creativestudios.com/csdevblogpictures/uploaded_images/comeoutside-717712.gif)
-
loool chris :L
-
(http://creativestudios.com/csdevblogpictures/uploaded_images/comeoutside-717712.gif)
TRAAAAAAAAAAAAAAAAAAAAAAAAAA
-
:L
-
(http://i.imgur.com/xnhJv.jpg)
-
(http://img268.imageshack.us/img268/6424/imsoindie.jpg)
(http://img413.imageshack.us/img413/5084/canihavelike20bucks.jpg)
-
old but funny
[youtube]tu8aSa4ViYg[/youtube]
[youtube]BHJ1uKic-_Y[/youtube]
[youtube]O52qo40xl9s[/youtube]
-
Bieber fever. :L
[youtube]AimrmMlD5Tk[/youtube]
...I didn't know he was allowed to say that word. (A)
-
(http://lolyounghollywood.com/wp-content/uploads/2010/07/JustinoBieberezFilipino.png)
-
(http://images1.wikia.nocookie.net/__cb20100621164530/uncyclopedia/images/6/67/TheAntiBelieber.jpg)
-
(http://img715.imageshack.us/img715/2295/huehuehue.jpg)
-
(http://img715.imageshack.us/img715/2295/huehuehue.jpg)
jajajajajajajajajajaja
-
old but funny
[youtube]tu8aSa4ViYg[/youtube]
I must be missing something, but how is that funny at all. The bloke gets run over :-\
-
(http://img155.imageshack.us/img155/4267/638e4a1a89dde0e8.jpg)
-
(http://obczaj.net/obrazki/132736.jpg)
-
[YOUTUBE]http://www.youtube.com/watch?v=4moPhSeDWFI&feature=player_embedded#![/youtube]
-
old :L
-
Your old 8)
Still funny :L
-
Your
You're*
-
OHHHHH >:(
Again :L
-
(http://www.explosm.net/db/files/Comics/Dave/comichangmannew.png)
-
[youtube]T3JQjKKd_gI[/youtube]
[youtube]1_H-6kY41eo[/youtube]
-
[youtube]http://www.youtube.com/watch?v=ZSwCXQ2KqUk[/youtube]
:L
-
omg :L
-
(http://obczaj.net/obrazki/132883.jpg)
(http://obczaj.net/obrazki/132749.jpg)
-
[youtube]tvw9uWH9BFM[/youtube]
I GOT A FEELIN' Mexican Ver.
[youtube]-hdfiTQR8Go[/youtube]
[youtube]biH0uGHsPaU[/youtube]
not funny but whatever :)
-
:L :L :L loooooooooool hahahaha lmao roflcoaster :L :L :L
-
(http://static.funnyjunk.com/pictures/18a09caf_ee2e_3f2d.jpg)
-
[youtube]biH0uGHsPaU[/youtube]
not funny but whatever :)
^ It's stuff like this that always has me wondering why you're inside playing video games. :L
-
[youtube]http://www.youtube.com/watch?v=ZSwCXQ2KqUk[/youtube]
:L
lmaoooo!!!! :L :L
-
[youtube]GNlPfQi9sXI[/youtube]
[youtube]WKYD-cDd_Gs&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?v=ZSwCXQ2KqUk[/youtube]
:L
hahaha this is hilarious :L
-
ahahahahahhahahahahahahahahahahahahaahahhaahahahahh :L :L :L :L :L :L :L :L :L :L :L
-
[youtube]http://www.youtube.com/watch?v=9JhuOicPFZY&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?v=egxjuLkhXUw[/youtube]
-
Hhahahahhahha :L :L fuunny :L :L hahah ;D :D
-
:L
-
[youtube]http://www.youtube.com/watch?v=NrIIwfUS9X4&feature=channel[/youtube]
(A) (A) (A) (A) (A) (A) (A) (A) (A) (A) (A) (A)
-
"look at this shit!"
"who put this in the game?!"
"WHY!"
sounds like myself LOL
-
[youtube]http://www.youtube.com/watch?v=jbE2SMCK5Q0[/youtube]
:L
-
LOLOLOL
-
:L :L :L
"i gonna punch you in the face while you sleeping! (fuck you)"
EDIT: and lol the end
-
haha, that's fucking funny :L
-
Everybody know it but its epic!
[youtube]http://www.youtube.com/watch?v=EnSoLoNzWh4[/youtube]
-
[youtube]http://www.youtube.com/watch?v=jbE2SMCK5Q0[/youtube]
:L
"i'm gonna delete your world of warcraft character" lol
-
lol check this:
[youtube]http://www.youtube.com/watch?v=MJYpjS9DSew&feature=related[/youtube]
-
haha
-
wow he`s great 8)
-
at heart attack i just loled
-
i lol`ed after seeing 1:10-1:15 :L
-
I never said that to him
And he tells me to fuck off :'(
-
"VERA! BRING ME AN ASPIRIN!" :L
-
[youtube]http://www.youtube.com/watch?v=Drp9o4E7G7U[/youtube]
-
lol :L
How to do that ?
-
LMAO thats funny, gouing to try it
How to do that ?
edit the wbias column in the handling.dat file to a negative number like -9
-
this should do it.
put it in \GTAIV\common\data
-
cars are alive >:D
-
haahah loool that looks damn funny, btw there was a glitch too :L
-
lol 1:48 - Ruiner Ravange?
-
cool lol, the only car that worked fine for me was infernus :L
-
Lol try it with Faggio
[youtube]cf8bxH3GAns[/youtube]
-
2012 is close
[youtube]http://www.youtube.com/watch?v=GESD1IF-vIc[/youtube]
-
lol that must feel weird in his stomach
and btw, im glad when 2013 arrives.. silly jokes about 2012 lol.. im tired of them :L
-
Nice :D xDD
-
:o :L
[Youtube]http://www.youtube.com/watch?v=ko5XPf2ha0I[/Youtube]
-
[youtube]tX9O_R3dS4Y[/youtube]
[youtube]LO73N0iUn7c[/youtube]
-
(http://www.adnkronos.com/IGN/Assets/Imgs/P/pillolacontraccettivabio_web--400x300.jpg)
-
[youtube]http://www.youtube.com/watch?v=uM2CtXPmTqM&feature=player_embedded[/youtube]
-
i have seen it on fb :L
-
[youtube]YP7nmsBGaUc[/youtube]
-
[youtube]http://www.youtube.com/watch?v=mg11glsBW4Y[/youtube]
[youtube]YP7nmsBGaUc[/youtube]
hahaha 2:50
-
[youtube]http://www.youtube.com/watch?v=tUaxgrDk6s0[/youtube]
-
lol
[youtube]http://www.youtube.com/watch?v=Ux1FZpPKh20[/youtube]
-
(http://www.geekologie.com/2011/01/13/trollin-for-craigslisters.jpg)
-
:L :L :L
-
lmao :L
-
(http://pics.kuvaton.com/kuvei/long_cat_is_looooooooong.jpg)
(http://cheezfailbooking.files.wordpress.com/2011/01/085dcaa7-6793-4dad-bab2-e419387be376.jpg)
(http://1.bp.blogspot.com/_S2sooKgAocY/TSiIJXbfgaI/AAAAAAAAAO0/6OGQFOLt8PA/s640/%25E6%2583%25A1%25E6%2590%259E%25E6%2598%259F%25E5%25B7%25B4%25E5%2585%258B.jpg)
-
(http://www.geekologie.com/2011/01/13/trollin-for-craigslisters.jpg)
HAHAHAHAHAHA AH AH AH AHAHA ;D
-
haah ^^
-
Michael Winslow - The Man Of 10,000 Sound Effect. :L
[youtube]S0PuIsK2ySk[/youtube]
[youtube]3yAlq1wqoXc&feature=related[/youtube]
[youtube]oO0RjErOYVY&feature=related[/youtube]
[youtube]lUvqt-AsRB0&feature=related[/youtube]
[youtube]tug7dE3dCEA&feature=related[/youtube]
-
(http://i.imgur.com/L5eOw.jpg)
(http://i.imgur.com/nHPMR.jpg)
(http://i.imgur.com/4hc3G.png)
-
(http://i.imgur.com/L5eOw.jpg)
FUCKING GENIUS
-
(http://1.bp.blogspot.com/_S2sooKgAocY/TSiIJXbfgaI/AAAAAAAAAO0/6OGQFOLt8PA/s640/%25E6%2583%25A1%25E6%2590%259E%25E6%2598%259F%25E5%25B7%25B4%25E5%2585%258B.jpg)
hah, they really messed the new logo up
-
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash1/hs746.ash1/163885_179444198745402_176234809066341_485022_6370066_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash1/hs784.ash1/167437_179444238745398_176234809066341_485023_2289293_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1388.snc4/164048_180237778666044_176234809066341_490075_7009009_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1338.snc4/163053_180237905332698_176234809066341_490083_145138_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc6/hs054.snc6/168428_180238121999343_176234809066341_490098_801444_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs029.ash2/34807_181790948510727_176234809066341_497735_3914596_n.jpg)
-
who know movie 'Escape from NY' or LA should remember him:
(http://obczaj.net/obrazki/133219.jpg)
-
LA not NY
-
[youtube]Kv9H2M5sCsA[/youtube]
(http://images.cuantocabron.com/ccs/2011/01/84cd10da7ab63c99fb233a1ca2fce5d6.jpg)
-
^haha
This video is awesome, there's a special surprise at the end... :o
[youtube]NXbCwq4ewBU[/youtube]
-
[youtube]http://www.youtube.com/watch?v=17RGmGZX7ng&feature=related[/youtube]
please i want this mod :L :L :L
-
lol Scorpion. What an idiot. :L
-
i don't think that's very funny.. imagine actually being in that situation
-
I was assuming it's staged. :o
Youtube usually pulls illegal videos and that's been around for over 3 years with 800k+ views.
-
that kind of stuff does happen in america, kinda scary really :/
-
Happens here too, remember that guy who got stabbed to death because he told guys in another car to not throw sweet wrappers at his girlfriend?
http://www.telegraph.co.uk/news/uknews/1580735/Teenagers-killed-man-over-sweet-wrapper.html
I personally have been attacked by a gang of 10 guys because of mistaken identity, spent the night in hospital with fractured eye socket, nose and was for several weeks blind in one eye, had to take antibiotics for months...never managed to identify them because it was dark. At least I survived...
OH WELL. :L :L
-
eeek.
also, cool story bro
-
(http://img141.imageshack.us/img141/135/gtasad.jpg)
But srs, it's true
-
ah right, i believe you :D
also:
(http://i.imgur.com/OzVtp.png)
-
LOL, I am stuck, I don't have a clue how to do that one. To be honest I've been using an online decoder because I don't have a fancy phone. :L
-
yeah i had to use an online decoder for the giant one in the other thread too. if you want to read my most recent one you can borrow a barcode scanner or click here (http://tinyurl.com/6e3mjez)
-
Er...yeah, that link doesn't work. :'(
-
browser?
hm just tested, doesn't work on chrome or ie but does on ff and opera.
-
My fancy phone can read Epoxi's but not mooman's.
Also, that story about you (Epoxi) and the other about the sweet wrapper man made me feel sick.
-
(http://i.imgur.com/izYgH.gif)
-
[youtube]http://www.youtube.com/watch?v=KzwQgkDl4lk&feature=player_embedded[/youtube]
never knew you liked basketball gen
-
[youtube]http://www.youtube.com/watch?v=KzwQgkDl4lk&feature=player_embedded[/youtube]
never knew you liked basketball gen
http://forum.adrenalinex.co.uk/index.php/topic,2853.0.html
-
didnt see that thread, oh well some admin can delete the post
-
How did you find the video though?
-
(http://cheezcomixed.files.wordpress.com/2011/01/c7727252-91de-44c7-a4b8-a1718e2194c0.jpg)
(http://img.photobucket.com/albums/v207/OdDsOcK/cry_lol.jpg)
-
How did you find the video though?
he stalks you
-
ELECTRIC BOOGALOOS
FTW O0 O0 O0 O0 O0
[youtube]http://www.youtube.com/watch?v=ivGnvAu1KS8[/youtube]
original vid
[youtube]http://www.youtube.com/watch?v=WTzb1av_yMM&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?v=uIb07In73ic&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?v=ivGnvAu1KS8[/youtube]
Wow cool tunes! O0
-
Oh, woah, ey...
[youtube]zFON1IE13Lg[/youtube]
-
did i just really watch 2 minutes of people saying oh? :P
-
did i just really watch 2 minutes of people saying oh? :P
You actually watched 8 years of people saying 'oh.' 8)
I can't even do this in SA...
[youtube]http://www.youtube.com/watch?v=wrtNC1e8kG0[/youtube]
-
bump
(http://img141.imageshack.us/img141/2097/ad22c87e696fe63c.jpg)
-
[youtube]http://www.youtube.com/watch?v=f5Pjo0WjBcs&feature=related[/youtube]
-
phobos wtf :L :L
[youtube]http://www.youtube.com/watch?v=WLKk00OYKhU[/youtube]
-
did i just really watch 2 minutes of people saying oh? :P
You actually watched 8 years of people saying 'oh.' 8)
I can't even do this in SA...
[youtube]http://www.youtube.com/watch?v=wrtNC1e8kG0[/youtube]
I saw some guy do this and park up + get out on two wheels on SA a few weeks ago; me, tom and krissi were amazed :L
-
makes me wonder how this could work...
(http://obczaj.net/obrazki/133997.jpg)
-
Simple: It doesn't.
-
You might want to find something funny about it but you won't. It's just a concept phone preview ;D
[youtube]http://www.youtube.com/watch?v=mHLrPOTYNQg[/youtube]
-
Phone has lost it's name, 'Phone', it should just now be a Tablet..
-
makes me wonder how this could work...
(http://obczaj.net/obrazki/133997.jpg)
As Joe said it doesnt work cause USB gives you 3V in best cast 5V depend of motherboard and Power Supply Unit,and if am right for any Laptop you need at least 15V or more.With that charger you can charge battery on cell phone or similar gadgets ;)
-
You might want to find something funny about it but you won't. It's just a concept phone preview ;D
[youtube]http://www.youtube.com/watch?v=mHLrPOTYNQg[/youtube]
[youtube]http://www.youtube.com/watch?v=udlxr8t1nZM[/youtube]
:L :L :L
-
(http://i.imgur.com/PY52g.jpg)
somebody is messing up with the forum :L
----
(http://i.imgur.com/4pcbt.jpg) (http://i.imgur.com/alRTU.jpg)
(http://i.imgur.com/0Wu46.jpg)(http://i.imgur.com/Fta0P.jpg)
(http://i.imgur.com/LFmkd.jpg)(http://i.imgur.com/otJ2s.jpg)
(http://i.imgur.com/u0JtF.jpg) (http://i.imgur.com/JPdkh.jpg)
(http://i.imgur.com/Vj1s8.jpg)
-
lol forever a bone.
-
I did a proper lol at that when i read it at work earlier.
-
epic pictures lol
-
[youtube]http://www.youtube.com/watch?v=mTiAS7cdsYc[/youtube]
-
[youtube]http://www.youtube.com/watch?v=t3SDwvU22nY&feature=player_embedded[/youtube]
Moo BARBRA STREISAND remix O0
[youtube]http://www.youtube.com/watch?v=kEuZ7qYSQA8&feature=related[/youtube]
:o :o :o :o :o :o :o :o
[youtube]http://www.youtube.com/watch?v=keGsH6C_4CQ[/youtube]
[youtube]http://www.youtube.com/v/phwwrkDfdjk&hl[/youtube]
(http://img145.imageshack.us/img145/8703/15436112780128061461710.jpg)
-
assdre
-
(http://i.imgur.com/pN1Jq.png)
(http://chzmemebase.files.wordpress.com/2011/01/memes-forever-alone-tldr.jpg)
-
lol never ending comics
-
:L
[youtube]http://www.youtube.com/watch?v=Yzbqj-RKwSU[/youtube]
-
lmao that police man :L
-
LOL
[youtube]http://www.youtube.com/watch?v=DA43DS2c12c[/youtube]
-
(http://www.atheistlibrary.com/wp-content/uploads/2009/12/atheist-sex.jpg)
(http://scienceblogs.com/pharyngula/upload/2007/06/bousquet_atheist.jpg)
-
not funny but it's such a classic
[youtube]http://www.youtube.com/watch?v=AKNzu6pLfIM&feature=feedrec_grec_index[/youtube]
-
(http://www.nupxl.com/wp-content/uploads/2010/10/lamebook-volvo.png)
(http://www.nupxl.com/wp-content/uploads/2010/10/2.jpg)
(http://img.photobucket.com/albums/v207/OdDsOcK/61AnyoneSurprised.jpg)
-
(http://i.imgur.com/AIJxV.jpg)
(http://i.imgur.com/vVA7f.jpg)
(http://i.imgur.com/tnz64.jpg)
(http://i.imgur.com/06z3t.jpg)
(http://i.imgur.com/DDbrf.jpg)
(http://i.imgur.com/UgtpB.jpg)
(http://i.imgur.com/HulRc.jpg)
(http://i.imgur.com/GBhZu.jpg)
(http://i.imgur.com/Xn9As.jpg)
(http://i.imgur.com/JYSHu.jpg)
(http://i.imgur.com/9wmNH.jpg)
(http://i.imgur.com/vb9k8.jpg)
(http://i.imgur.com/Rj9lI.jpg)
(http://i.imgur.com/Zvydj.jpg)
(http://i.imgur.com/G4iI0.jpg)
(http://i.imgur.com/7x1uc.jpg)
(http://i.imgur.com/4vCsN.jpg)
(http://i.imgur.com/kbGNY.jpg)
(http://i.imgur.com/AV8jc.jpg)
(http://i.imgur.com/AV8jc.jpg)
(http://i.imgur.com/0Vo9F.jpg)
(http://i.imgur.com/xcx0k.jpg)
(http://i.imgur.com/sUnXC.jpg)
-
[youtube]http://www.youtube.com/watch?v=ZmXswHuxy98[/youtube]
(http://i.imgur.com/dJqFE.jpg)
(http://i.imgur.com/UlZ4L.jpg)
(http://i.imgur.com/6M41S.jpg)
-
(http://cdn.8ball.co.uk/tshirts/fartloading-funnyboxershorts_2_117838_white_l.jpg)
-
:L
-
(http://i56.tinypic.com/2n04oee.jpg)
(http://img.izismile.com/img/img4/20110128/640/cool_american_military_640_66.jpg)
(http://artsyspot.com/img/fun/parenting-fails/parenting-fails18.jpg)
(http://artsyspot.com/img/fun/parenting-fails/parenting-fails28.jpg)
(http://img.izismile.com/img/img4/20110129/640/daily_picdump_603_640_37.jpg)
(http://img.izismile.com/img/img4/20110129/640/daily_picdump_603_640_58.jpg)
(http://img.izismile.com/img/img4/20110129/640/daily_picdump_603_640_73.jpg)
(http://img.izismile.com/img/img4/20110129/640/daily_picdump_603_640_74.jpg)
(http://img.izismile.com/img/img4/20110128/640/daily_picdump_602_640_09.jpg)
(http://img.izismile.com/img/img4/20110128/640/daily_picdump_602_640_10.jpg)
(http://img.izismile.com/img/img4/20110128/640/daily_picdump_602_640_12.jpg)
(http://img.izismile.com/img/img4/20110128/640/daily_picdump_602_640_13.jpg)
(http://img.izismile.com/img/img4/20110128/640/daily_picdump_602_640_17.jpg)
(http://img.izismile.com/img/img4/20110128/640/daily_picdump_602_640_22.jpg)
(http://img.izismile.com/img/img4/20110128/640/daily_picdump_602_640_24.jpg)
(http://img.izismile.com/img/img4/20110128/640/daily_picdump_602_640_31.jpg)
(http://img.izismile.com/img/img4/20110128/640/daily_picdump_602_640_49.jpg)
(http://img.izismile.com/img/img4/20110128/640/daily_picdump_602_640_58.jpg)
(http://img.izismile.com/img/img4/20110128/640/daily_picdump_602_640_77.jpg)
(http://img.izismile.com/img/img4/20110128/640/daily_picdump_602_640_88.jpg)
(http://img.izismile.com/img/img4/20110128/640/daily_picdump_602_640_high_94.jpg)
(http://img.izismile.com/img/img4/20110128/640/daily_picdump_602_640_102.jpg)
(http://img.izismile.com/img/img3/20100519/640/daily_picdump_415_640_09.jpg)
(http://img.izismile.com/img/img3/20100519/640/daily_picdump_415_640_115.jpg)
(http://www.yurock.net/wp-content/gallery/7lol/thumbs/thumbs_13.jpg)
-
lol
-
http://www.lyricsfreak.com/d/darude/sandstorm_20273050.html
-
(http://img.izismile.com/img/img3/20100519/640/daily_picdump_415_640_09.jpg)
Scroll up&down, the balls change colour to red.
-
(http://img.izismile.com/img/img3/20100519/640/daily_picdump_415_640_09.jpg)
Scroll up&down, the balls change colour to red.
True lol
-
for fun...
[youtube]http://www.youtube.com/watch?v=byUr_8jZUgM[/youtube]
-
The media section is where that should be. Also, ain't you banned?
-
banned people should not be able to post :S
-
kinda old but... :L :o :L :L
[youtube]http://www.youtube.com/watch?v=oQ1IJ5Hr43k[/youtube]
[youtube]http://www.youtube.com/watch?v=V0iDmSTID18[/youtube]
[youtube]http://www.youtube.com/watch?v=ms8Zi3IX9D0[/youtube]
[youtube]http://www.youtube.com/watch?v=Z58zCB94KXc[/youtube]
-
The media section is where that should be. Also, ain't you banned?
the media section is for stuff created on the server. some people use it to post things from other games and that's ok too but i don't think this fits.
-
Ah. Anyway my main point was the one about Fetak being banned.
-
[youtube]http://www.youtube.com/watch?v=G2AaMcyFjiQ[/youtube]
Think about get this
-
[youtube]http://www.youtube.com/watch?v=ojAXi9ccHos[/youtube]
ARNOLDDDDDDDDDDDDDDDDDDDDDDDDDD, move it football head!
-
ARNOLDDDDDDDDDDDDDDDDDDDDDDDDDD
(http://26.media.tumblr.com/tumblr_l6v2miNd8s1qc0m6fo1_250.jpg)
-
omfg i never noticed that
-
[youtube]http://www.youtube.com/watch?v=fJuNgBkloFE[/youtube]
-
Aussie humour ftw
-
(http://img20.imageshack.us/img20/6470/1296203266bypetras500.jpg)
-
:o never knew finland had bad trains
-
(http://lolsnaps.com/upload_images/real/2055.png)
(http://lolsnaps.com/upload_images/real/2056.png)
(http://lolsnaps.com/upload_images/real/2062.jpg)
(http://lolsnaps.com/upload_images/real/2067.jpg)
(http://lolsnaps.com/upload_images/real/2068.jpg)
(http://lolsnaps.com/upload_images/real/2078.jpg)
(http://lolsnaps.com/upload_images/real/2071.jpg)
(http://lolsnaps.com/upload_images/real/2077.jpg)
(http://lolsnaps.com/upload_images/real/2081.jpg)
(http://lolsnaps.com/upload_images/real/2097.jpg)
(http://lolsnaps.com/upload_images/real/2100.gif)
(http://lolsnaps.com/upload_images/real/2104.jpg)
-
(http://lolsnaps.com/upload_images/real/2047.jpg)
[youtube]http://www.youtube.com/watch?v=0M-zkvJhJZ0[/youtube]
-
(http://img130.imageshack.us/img130/9602/memesdadhumorthegentlem.jpg)
-
(http://lolsnaps.com/upload_images/real/2104.jpg)
lmao
-
(http://i.imgur.com/PaCWV.png)
(http://i.imgur.com/AYwX5.png)
(http://i.imgur.com/H8YN3.png)
(http://i.imgur.com/ZDyjS.png)
(http://i.imgur.com/D2Pk5.png)
(http://i.imgur.com/bOiLY.png)
(http://i.imgur.com/k8DAb.png)
-
:L :L :L :L :L :L :L
-
(http://a1.twimg.com/profile_background_images/199823251/mail.jpeg)
-
(http://i.imgur.com/UlZ4L.jpg)
-
[youtube]csjsjubYLaI[/youtube]
(http://images.vayagif.com/gifs/2010/11/86c0af9a0160bbd9c5640485dc6b2696.gif)
(http://img715.imageshack.us/img715/5042/1287460222886.gif)
[youtube]i3My4MHr51c[/youtube]
(http://www.uploadimage.com.ar/images/00493048956504575489.jpg)
[youtube]c0nQbqH32X4[/youtube]
-
[youtube]bBBw9E2Q_aY[/youtube] ;D
-
[youtube]http://www.youtube.com/watch?v=s3ni6XExYCs[/youtube]
WHEN I DRUNK VODKA I CAN DRIFT WITH MY CAR
Yamaha R1 05' :)
-
DRIFT
.........
-
zdzichu is an internet-gangster :L :L
-
http://www.break.com/index/how-to-make-a-homemade-sex-toy.html
-
DRIFT
.........
...................
-
[youtube]http://www.youtube.com/watch?v=Ub4YuHsdi0g[/youtube]
-
:L
-
[youtube]gV9Gjyl5kOs[/youtube]
[youtube]9_DLEysEqSM[/youtube]
-
(http://i.imgur.com/5wlEW.jpg)
-
http://thehairpin.com/2011/01/women-laughing-alone-with-salad/
(http://i.imgur.com/ZT5aW.png)
Photoshopped:
(http://29.media.tumblr.com/tumblr_lfyfv2AcCs1qfkbn1o1_400.gif)
-
maybe was before, but owns
(http://obczaj.net/obrazki/134724.jpg)
why Batman had better suit?
(http://obczaj.net/obrazki/134727.jpg)
(http://obczaj.net/obrazki/134728.jpg)
(http://obczaj.net/obrazki/134731.jpg)
(http://obczaj.net/obrazki/134741.jpg)
(http://obczaj.net/obrazki/134742.jpg)
EAT THIS!
(http://obczaj.net/obrazki/134750.jpg)
-
haha
-
(http://obczaj.net/obrazki/134546.jpg)
:L :L :L
Sk race in AX
(http://obczaj.net/obrazki/134343.jpg)
-
(http://thechive.files.wordpress.com/2010/09/743701640.gif)
(http://www.lamebook.com/wp-content/uploads/2010/10/logging-offspring.png)
(http://fc06.deviantart.net/fs71/i/2010/319/1/6/dragonite_by_jhallpokemon-d32xk0n.png)
-
lol
-
(http://thechive.files.wordpress.com/2010/09/743701640.gif)
:L
-
(http://static.funnyjunk.com/pictures/4cd96de1_ada0_8cce.jpg)
-
[youtube]http://www.youtube.com/watch?v=k1JmFo2hliI&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?v=Whj0mA330pQ&feature=topvideos[/youtube]
those guys made me laugh lol. that game looks fun
-
i told you to buy it but noooooo :/
-
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc6/hs071.snc6/168147_142390959151711_100001424238868_265723_4343599_n.jpg)
-
i told you to buy it but noooooo :/
soon :P and get a headset already!
-
lol, i love those vids. Old_Peculiar ftw! I was thinking of getting it as well, but idk lol
-
[youtube]1ZHb8983wMU[/youtube]
-
:L
-
lol, i love those vids. Old_Peculiar ftw! I was thinking of getting it as well, but idk lol
would own lol
-
Bought minecraft!
-
aw :( how much?
-
€15, so around £11 or £12 I'd say.
-
Czech:
http://www.dumpert.nl/mediabase/1349981/ab882941/czechische_politie_en_verkeersregelaars.html
-
hahaha :L
-
'Play' a version of minecraft here for free http://www.minecraft.net/play.jsp
-
nice.
(http://i.imgur.com/Gam3C.png)
i'm glad i don't need to spend £400 on new PC hardware to run it optimally :)
-
Blow up over 100 tnt blocks. :p
Which you can only do on the bought version!
-
[youtube]http://www.youtube.com/watch?v=pCawjbMysBg[/youtube]
-
I played mincraft all night last night lol, wtf? The time flew.
-
it looks boring on first hand..
-
[youtube]http://www.youtube.com/watch?v=aFwVzj1eNG4&feature=aso[/youtube]
funny review guy lol 2:26 and 2:38 lmao 4:02 haha
[youtube]http://www.youtube.com/watch?v=Ws1zaYiVGvMp[/youtube]
-
[youtube]http://www.youtube.com/watch?v=aFwVzj1eNG4&feature=aso[/youtube]
That lady lol i saw her yesterday on the news here lmao :L
-
Stupid move, she could of got battered.They didn't run away because of the granny, they ran away because the windows were shutting and police were coming.
All in all, shes a dumb fuck for trying to piss on them.
+1 i also don't think should would have done that if there weren't any other people around
-
I hate how on the news they say that there aren't any good samaritans anymore. How about I don't fucking feel like getting stabbed or shot.
-
(http://www.funnypictures.com/pictures/chemistry-test-funny.jpg)
-
lol and he still got 100\100
-
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-snc6/hs308.snc6/181617_10150096626414670_36737889669_5954138_2880660_n.jpg)
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-snc6/hs302.snc6/181062_10150096631334670_36737889669_5954283_7178351_n.jpg)
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-snc6/hs253.snc6/180195_10150096631839670_36737889669_5954301_881303_n.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs037.ash2/35227_405933724513_369831754513_4376159_315272_n.jpg)
-
lmao
-
when the news hit home...
(http://obczaj.net/obrazki/135685.jpg)
(http://obczaj.net/obrazki/135561.jpg)
-
CCTV footage released of 'polite robber' hold up
9 February 2011 Last updated at 11:05 Help
A so called 'polite robber', has been filmed on CCTV holding up a petrol station in Seattle.
The robber, who appears to be armed with a gun, asks the cashier, "Could you do me a favour? Empty the till for me please and put it right here. I am robbing you sir."
http://www.bbc.co.uk/news/world-us-canada-12402421
-
:o michael jackson reborn in a BR guy, he doesnt do teh HUEHUEHEUEHUE or USHUSHUSHUSHUSH but he sings as M.J. see it 8)
Jean Walker from Brazil
[youtube]5PA4x9_O4bQ[/youtube]
[youtube]mdAaNb4g0mw[/youtube] --- thump up!
[youtube]XPDZdd1RA0g[/youtube]
[youtube]FC6ao4F_Pw0[/youtube]
[youtube]lagy3rhxmhM[/youtube]
-
Is this the taxi driver posted earlier?
-
(http://i.imgur.com/lLpEX.jpg)
(http://i.imgur.com/NG3qL.jpg)
(http://i.imgur.com/Okzq2.jpg)
(http://i.imgur.com/n1eT7.gif)
(http://i.imgur.com/u4VIr.gif)
(http://i.imgur.com/B41zx.png)
(http://i.imgur.com/H82o1.png)
-
yes, same guy from taxi
for mooman: [youtube]sBGFpy-DYXA[/youtube]
-
(http://obczaj.net/obrazki/136348.jpg)
-
[youtube]SEaYFgWloBU[/youtube]
"What the fuck is a bieber?" :L
[youtube]Tipx5zJEh5w[/youtube]
[youtube]R4xL3AjSLvM[/youtube]
-
CCTV footage released of 'polite robber' hold up
9 February 2011 Last updated at 11:05 Help
A so called 'polite robber', has been filmed on CCTV holding up a petrol station in Seattle.
The robber, who appears to be armed with a gun, asks the cashier, "Could you do me a favour? Empty the till for me please and put it right here. I am robbing you sir."
http://www.bbc.co.uk/news/world-us-canada-12402421
got mine before it was on youtube :P
-
yes, same guy from taxi
for mooman: sBGFpy-DYXA
I like Glee club AND this video. :L
-
(http://i.imgur.com/uIoA4.jpg)
(http://i.imgur.com/yy1Eh.jpg)
-
(http://cdn.buzznet.com/assets/users16/len0re/default/happy-fucking-valentines-day--large-msg-120303141992.jpg)
-
[youtube]KOzxqlzT8Uk[/youtube]
-
mmh wtf spoiler mmh i haven't never seen this spoiler mmh :-*
(http://farm4.static.flickr.com/3379/3277085251_099e8500a2_o.gif)
-
(http://i.imgur.com/uIoA4.jpg)
(http://knowyourmeme.com/i/000/068/972/original/forever_alone_computer.jpg)
-
[youtube]http://www.youtube.com/watch?v=wgTH6a9W_JY[/youtube]
-
How to locate your house in Minecraft(license not mine btw, got to play for a bit :P)
(http://i.imgur.com/xvfms.png)
-
easier to make a compass so you can go further
http://www.minecraftwiki.net/wiki/Compas
-
easier to make a compass so you can go further
http://www.minecraftwiki.net/wiki/Compas
The lighthouse is for getting lost on land and respawning far from it.
-
[youtube]QB-Gg9D48Vk[/youtube]
-
ohh snoopy i found a perfect costume for u bro!
http://www.darceky-eshop.sk/willy-penisnafukovaci-kostym-p-505676.html
-
hilarious :L :L :L :L
now go away :P
-
:L :L :L :L :L :-* :-* :P :P
-
new videos O0
[youtube]http://www.youtube.com/watch?v=EeMYdgIm4KM&feature=feedu[/youtube]
[youtube]http://www.youtube.com/watch?v=Fi6Ddd6eRqM[/youtube]
-
some epic fails
FAIL
(http://obczaj.net/obrazki/136680.jpg)
FAIL
(http://obczaj.net/obrazki/136755.jpg)
-
lmao, how to do that first one lol
-
phobos orbits around mars :L
-
[youtube]http://www.youtube.com/watch?v=RiZvXf4e0Ko[/youtube]
James Doakes the one and only...
-
(http://obczaj.net/obrazki/136927.jpg)
-
[youtube]http://www.youtube.com/watch?v=gWhUqo9Aivs&feature=rec-LGOUT-real_rn-1r-9-HM[/youtube]
-
[youtube]t9vPM1toXF0[/youtube]
-
[youtube]http://www.youtube.com/watch?v=e6kRD0_qTbc[/youtube]
-
(http://www.explosm.net/db/files/Comics/Dave/comicgrinning1.png)
-
(http://www.fugly.com/media/IMAGES/Funny/traction.jpg)
I've actually been to this show before, the last one left in my country infact. It was amazing lol
-
(http://www.fugly.com/media/IMAGES/Funny/traction.jpg)
I've actually been to this show before, the last one left in my country infact. It was amazing lol
What are they doing ?
-
(http://www.explosm.net/db/files/Comics/Dave/comicgrinning1.png)
haha :L
-
[youtube]0ogJtX-Z7Xs[/youtube]
-
They are AWESOME! Catchy song btw :D
[youtube]http://www.youtube.com/watch?v=PD6eQY7yCfw[/youtube]
-
hi gen & company
-
(http://www.fugly.com/media/IMAGES/Funny/traction.jpg)
I've actually been to this show before, the last one left in my country infact. It was amazing lol
What are they doing ?
Well, the walls were totally vertical on the one I went to. Basically, they drive round and build up speed until they can eventually drive around the walls. On the one I saw, some guy stood up on his bike seat while he went round lol, and sat on the handle bars too.
-
[youtube]http://www.youtube.com/watch?v=F_Wri37V-2I[/youtube]
what a prick lol
-
owned lol
-
server needs more admins.. snoopy & mooman to the rescue ;_;
-
[youtube]smETLCCPTVo[/youtube]
-
server needs more admins.. snoopy & mooman to the rescue ;_;
::)
-
[youtube]http://www.youtube.com/watch?v=_CUFEnZeeYw[/youtube]
LOL nascar parody with snails
this parody is epic too LOL
[youtube]http://www.youtube.com/watch?v=gmPeHmBu1yA[/youtube]
-
[youtube]http://www.youtube.com/watch?v=3zb64y6Nvs0&feature=aso[/youtube]
WOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
-
^ seen this already, ,but omfg she's everywhere :L
-
The funny thing is Max, is that the snail version of Nascar is infinitely more enjoyable to watch than the real thing :p
-
[youtube]http://www.youtube.com/watch?v=_CUFEnZeeYw[/youtube]
loool it happens in server when nascar race is loaded ahaha
in this video you can see snails lag ahahah :L :L
-
Make a nascar race with Sweepers :L
-
Mini Oval ^^
-
(http://i.imgur.com/3tYTJ.jpg)
-
[youtube]Q6pbZLiLt30[/youtube]
-
[youtube]http://www.youtube.com/watch?v=Q6pbZLiLt30[/youtube]
-
[youtube]http://www.youtube.com/watch?v=qlicWUDf5MM[/youtube]
[youtube]http://www.youtube.com/watch?v=Z6_awUgbUJs[/youtube]
-
:o wtf!?!
[youtube]http://www.youtube.com/watch?v=oLkOLIjv3pw&feature=player_embedded[/youtube]
-
lol china amazes me :L
-
what about thailand? :L
-
Whatever :P I relate anything that is written with signs like that to China (mrgreen)
-
Literal videos FTW. This is the most random for sure:
[youtube]ovEDhFfgdOo[/youtube]
-
I lol'd
[youtube]http://www.youtube.com/watch?v=Bxd96qRa6wY[/youtube]
-
OH MY GOD. I thought that was a spoof video, but it really is an actual game? WTF!
-
Is that game real? I want to play it with some girls, after that we party along on my bed O0
-
lol owned :L
[Youtube]http://www.youtube.com/watch?v=hp-0EjZelvU&feature=player_embedded[/Youtube]
-
(http://www.bestofforums.se/uploaded/Onenightstand.png)
-
[youtube]http://www.youtube.com/watch?v=RxUbwteSWVk[/youtube]
-
Facebook thing
I don't find that remotely funny, just really uncomfortable reading.
-
[youtube]http://www.youtube.com/watch?feature=iv&v=8HE9OQ4FnkQ[/youtube]
-
this dude is really good lol, he can cound like:
-skyline
-supra
-rx 7
-mustang
and many others
[youtube]http://www.youtube.com/watch?v=iQF_kTGLVWU[/youtube]
-
Where are the mustangs and others ?
-
i lol'd :L
-
Supra Twin Turbo = 0:17-0:27
Nissan 350Z = 0:33-0:46
Intergra Type R = -1:04-1:24
Mustang = 1:35-1:42
Cobra SVT = 2:01-2:07
-
(http://platform.ak.fbcdn.net/www/app_full_proxy.php?app=4949752878&v=1&size=o&cksum=70564d4a3683052365b2d300016df5f1&src=http%3A%2F%2Fimg198.imageshack.us%2Fimg198%2F5458%2F18490620233756977901819.jpg)
-
(http://i.imgur.com/ktfyo.jpg)
-
(http://i.imgur.com/ktfyo.jpg)
funnyjunk? :D
-
yeah :L
-
lol @ "uncrop" :L
[youtube]http://www.youtube.com/watch?v=KUFkb0d1kbU[/youtube]
-
(http://obczaj.net/obrazki/137853.jpg)
(http://obczaj.net/obrazki/137855.jpg)
(http://obczaj.net/obrazki/137808.jpg)
(http://obczaj.net/obrazki/137818.jpg)
(http://obczaj.net/obrazki/137825.jpg)
-
AX helmet : (http://www.avenue-du-motard.com/th_avdm/medias/20100414lan_qY4r5tfa6z.jpg)
-
it isn't funny, but it's a great short horror cartoon
http://www.newgrounds.com/portal/view/562882
-
[YOUTUBE]http://www.youtube.com/watch?v=RP4abiHdQpc&feature=player_embedded#at=56[/youtube]
-
nice laugh you have krissi :L
-
krissi looks so cute :L
-
:L
-
[YOUTUBE]http://www.youtube.com/watch?v=mS-5yzehmU4[/youtube]
-
hmm? where to go....
(http://obczaj.net/obrazki/138051.jpg)
epic....
(http://obczaj.net/obrazki/138052.jpg)
-
Charlie Sheen is mental:
[youtube]jvRri4toSW8[/youtube]
-
what a nutter :L
-
Oh there is more:
[youtube]h5aSa4tmVNM[/youtube]
WINNING!
-
oh god lol
-
He is definitely Bi-Winning!
-
Some more: http://twitter.com/charliesheen (http://twitter.com/charliesheen)
Bio Born Small... Now Huge... Winning... Bring it..! (unemployed winner...)
-
He's cool :L
-
[youtube]http://www.youtube.com/watch?v=VokT65Xy7l0[/youtube]
Hard Gay Hooooooooooooooooooo!
-
[youtube]http://www.youtube.com/watch?v=MffUPtDlmbs[/youtube]
:L :L :L
-
:L
-
[youtube]http://www.youtube.com/watch?v=J__YwpUgkRk[/youtube]
-
hahahahahah ftw
-
lol
-
[youtube]http://www.youtube.com/watch?v=nUJOlTUe034[/youtube]
-
LOL moo's vid
HAHA mehlol's vid
:L
-
(http://i.imgur.com/jimyG.jpg)
-
loooool Snoopy. :L
(http://img.photobucket.com/albums/v207/OdDsOcK/whatcha-thinkin-bout-20809-1286070418-34.jpg)
(http://i.imgur.com/Of5wQ.jpg)
(http://img689.imageshack.us/img689/3442/foreveraloneb.jpg)
(http://failblog.files.wordpress.com/2011/03/74630b30-e1ad-498c-bc14-2f8a2b652690.jpg)
(http://i.imgur.com/MdJG8.jpg)
(http://i.imgur.com/kPbnz.jpg)
(http://i.imgur.com/Lh0g6.jpg)
(http://chzemokid.files.wordpress.com/2011/02/emo-scene-hipster-nobody-likes-mimes-nobody.jpg)
(http://failblog.files.wordpress.com/2011/03/ac79bd07-a8e2-4110-84f9-bdc7eafc89dc.jpg)
(http://i.imgur.com/6nCGz.jpg)
(http://i53.tinypic.com/28i92k6.jpg)
(http://i527.photobucket.com/albums/cc359/Jason7641/63550ec1_fb99_3eb2.jpg)
(http://i.imgur.com/DfiHm.jpg)
(http://i.imgur.com/q6eqh.jpg)
(http://img199.imageshack.us/img199/8884/60261c4ae5f5d6f6.jpg)
(http://img641.imageshack.us/img641/7373/1297953729939.jpg)
(http://img9.imageshack.us/img9/8771/1297954414144.jpg)
(http://i.imgur.com/GqwvJ.jpg)
(http://cache.gawker.com/assets/images/comment/9/2010/12/6614cec6b3cfd1e8c8d2210a7eafe9c5/340x.jpg)
(http://img812.imageshack.us/img812/5954/60261c4ae80b6d38.jpg)
(http://i.imgur.com/r30xV.jpg)
(http://www.aaideas.com/wp-content/uploads/2010/08/piracyNotTheft2.png)
(http://img265.imageshack.us/img265/6581/hidedildo.jpg)
-
(http://i.imgur.com/6nCGz.jpg)
so true :L :L :L
-
loooool Snoopy. :L
(http://img9.imageshack.us/img9/8771/1297954414144.jpg)
(http://staticrps.komixxy.pl/uimages/201008/1281361640_by_iwangrozny_500.jpg)
-
lmao :L
-
Hahahahaha Max. :L
-
http://www.dumpert.nl/mediabase/1390931/dbc03711/pimp_my_ride_nl.html
-
(http://i.imgur.com/LXR0L.jpg)
-
(http://obczaj.net/obrazki/139094.jpg)
-
(http://static.gamesradar.com/images/mb/GamesRadar/us/Features/2009/02/Game%20peripherals%20stupid/the_voice--article_image.jpg)
-
[youtube]http://www.youtube.com/watch?v=0vqUdC-8nFY&feature=player_embedded#at=102[/youtube]
-
:L :L
-
:D
-
I don't want to be a member of SU!!
+1
-
[youtube]http://www.youtube.com/watch?v=0vqUdC-8nFY&feature=player_embedded#at=102[/youtube]
Thats icelandic :)
-
it isn't funny, but it's a great short horror cartoon
http://www.newgrounds.com/portal/view/562882
Nice find. :)
-
:D
-
lol Firefox bug
http://img4.hostingpics.net/pics/979124Untitled.png
where Minimize Maximize Close buttons? :L
-
lol Firebox rug
(http://blogs.channel4.com/4homes/files/2009/10/motorclub-rug.jpg)
-
lol Firebox rug
(http://blogs.channel4.com/4homes/files/2009/10/motorclub-rug.jpg)
nice rug :P
-
[youtube]http://www.youtube.com/watch?v=ZLnR0VpEKJE[/youtube]
[youtube]http://www.youtube.com/watch?v=WuonIba2E1A[/youtube]
[youtube]http://www.youtube.com/watch?v=ubuytNCrp0E[/youtube]
-
epic fail :L
-
(http://i54.tinypic.com/dz70wl.jpg)
(http://i52.tinypic.com/dpkchv.jpg)
(http://i54.tinypic.com/ogkxdu.jpg)
(http://i54.tinypic.com/iop268.jpg)
(http://i56.tinypic.com/ig93xw.jpg)
-
(http://i56.tinypic.com/ig93xw.jpg)
OMG LOOK IT'S MADMAX :L :L :L :L :L :L :L :L :L :L :L :L
(no offence to MadMax ofcourse)
-
don't worry, this also made me LOL, anyway i have sense of humor and can laugh even from myself
-
(http://bestuff.com/images/images_of_stuff/210x600/oo-167433.jpg?1225038323)
-
(http://i54.tinypic.com/iop268.jpg)
ROFL
:L :L :L
-
^LOL amazing.
-
(http://www.toy-tma.com/wp-content/uploads/2010/01/Majin-Buu-is-Happy.png)
-
^ hahahahaaha :L :L :L
-
bu buu ftw
-
(http://i56.tinypic.com/ig93xw.jpg)
OMG LOOK IT'S MADMAX :L :L :L :L :L :L :L :L :L :L :L :L
(no offence to MadMax ofcourse)
haha
-
http://www.youtube.com/watch?v=7UmotTE-VlY&feature=mfu_in_order&list=UL
-
strange place for plane, but ok, if Rockstar Games designed it like that...
(http://img853.imageshack.us/img853/7065/gallery125x.jpg)
(http://img291.imageshack.us/img291/3/beaglehmmparkedlol2.jpg)
-
http://img143.imageshack.us/i/osg.mp4/
bully deserved it :L
-
http://img143.imageshack.us/i/osg.mp4/
bully deserved it :L
Damn that was nice. :L
-
Haha, owned :L
-
noob pwned
he deserved it
-
lol smackedout :P
-
PWND with his noob cap and thinking he's cool boy
deserved it. O0
-
He did get owned. How satisfying to watch :)
-
hahahahahahahahahahhahah
:L :L :L :L :L :L :L :L
I fuckin' can't stop laugh LOL :L :L :L :L
amazing LOL...
hahahahhaha so funny...
ok here it is...
(http://bizarroroby.files.wordpress.com/2009/07/cyborg-pirate-ninja-jesus-bizarro-roby.jpg)
no, sorry wrong image...
i meant this...
(http://wd2.photoblog.pl/np1/201012/9A/83131111.jpg)
LOL
cat with cheese on head :L :L :L :L :L :L :L
-
I don't fucking know why, but it made me laugh too :L :L :L
-
:L
-
loooooooooooooooooool
-
http://img143.imageshack.us/i/osg.mp4/
bully deserved it :L
im proud of you gen
-
(http://img291.imageshack.us/img291/153/51435286.png)
-
loooooool cat :L :L
-
LMAO gg cat.
-
http://img143.imageshack.us/i/osg.mp4/
bully deserved it :L
im proud of you gen
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
-
???
-
http://www.facebook.com/home.php?sk=group_170530126329598
-
[youtube]http://www.youtube.com/watch?v=SMWi7CLoZ2Q[/youtube]
-
(http://obczaj.net/obrazki/139786.jpg)
for SLAYER fans
(http://obczaj.net/obrazki/139795.jpg)
-
[19:50:27] *** {0AFF0A}Polejeke{00FF00} (Argentina) has joined the server 190.229.7.237
[19:51:56] Polejeke [63]:{ffffff} I'm a SA-MP Operator, i need to talk with an administrator.
[19:52:46] Polejeke [63]:{ffffff} @Owner of AdrenalineX: The server's name isn't allowed because there's already a AdrenalineX up on samp
[19:53:11] Polejeke [63]:{ffffff} This server will close in arounds 24-48 hours.
[19:53:32] Polejeke [63]:{ffffff} If you wanna cancel this closement, send some money to eljeed@paypal.com
[19:53:52] Polejeke has been banned by [AK47]skunk ({FF0000}Unreported:speed{AFAFAF}) 190.229.7.237
:L
-
haha
-
lol
-
epic
-
lol closement
-
Hahaha lol'd
:L
-
nice try :L :L :L
-
whaha ":L
-
loled
:L
-
(http://img820.imageshack.us/img820/3710/3458589.jpg)
(http://i.imgur.com/cGsC8.jpg)
(http://static.pyzam.com/img/funnypics/1/santaout.jpg)
(http://static.pyzam.com/img/funnypics/e/ownedbyqueen.jpg)
(http://i.imgur.com/IjmAq.jpg)
(http://i55.tinypic.com/scs8ys.png)
(http://i.imgur.com/i8hhD.jpg)
(http://i.imgur.com/stCa8.jpg)
(http://i.imgur.com/x1TvX.jpg)
(http://i.imgur.com/AmySs.png)
(http://i.imgur.com/gPNeH.jpg)
(http://i.imgur.com/Uah0S.jpg)
(http://i.imgur.com/6bTQo.png)
(http://i.imgur.com/20fWg.jpg)
(http://i.imgur.com/opKYU.jpg)
(http://i.imgur.com/86n2B.png)
(http://i.imgur.com/5xkuy.jpg)
(http://i.imgur.com/ikgGv.jpg)
(http://i.imgur.com/9Ul5u.jpg)
(http://www.damnlol.com/pics/422/65629a72cbc958e509140a6454367d3a.jpg)
(http://i.imgur.com/pYWMu.jpg)
(http://cheezfailbooking.files.wordpress.com/2011/03/funny-facebook-fails-busted-in-class.jpg)
(http://i.imgur.com/W1AtP.jpg)
(http://i.imgur.com/BRTdA.jpg)
(http://i.imgur.com/SbX3R.jpg)
(http://img.photobucket.com/albums/v207/OdDsOcK/bus.jpg)
(http://img.photobucket.com/albums/v207/OdDsOcK/4228.jpg)
(http://img851.imageshack.us/img851/8866/funnypicture5.jpg)
(http://pics.kuvaton.com/kuvei/inception.jpg)
(http://www.shrani.si/f/X/Dm/4SOkE8iD/42cb1f382dec02750.jpg)
(http://i.imgur.com/Y0lfg.png)
(http://www.meh.ro/wp-content/uploads/2011/03/meh.ro6827-455x423.jpg)
(http://i.imgur.com/Z6245.png)
(http://27.media.tumblr.com/tumblr_lhca8xTMwf1qehv22o1_500.png)
-
(http://img96.imageshack.us/img96/5125/bbbap.png)
(http://img857.imageshack.us/img857/5927/aaan.png)
-
wow a lot of funny pictures, epoxi. nice :L
-
(http://i.imgur.com/YFySJ.jpg)
-
^-^
[youtube]http://www.youtube.com/watch?v=CD2LRROpph0[/youtube]
-
i pray to god that that is some kind of pardody/joke... :/
bring back the 90s!!
-
15mil views in 1 month ????
-
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-snc6/189748_10150110929136630_78933666629_7040945_5098166_n.jpg)
:o :o nutella has copied AdrenalineX write style loool iMAO :L :L
(http://adrenalinex.co.uk/smalllogo.jpg)
-
^-^
[youtube]http://www.youtube.com/watch?v=CD2LRROpph0[/youtube]
what shit song is it ???
-
15mil views in 1 month ????
never thought it would come to this but....
justin bieber > rebecca black
-
mmmh it's the original o.O"
[youtube]http://www.youtube.com/watch?v=5n041M5FnqA&feature=related[/youtube]
-
Wow, at least Justin Bieber could actually sing, that's why I never hated on him. But this is just...
Also, shockingly bad make-up at 2:43. ???
-
look at the girl's acting in the pink starting at 1:13.. terrible and cheesy as fuck she HAS BRACES FOR HEAVEN'S SAKE!
and wtf, we lose legends like MJ and Nate Dogg over people like bieber and rebecca black.. EXPLAIN THIS TO SHIT ME FFS
she can't act, she can't dance... and neither can her retarded "friends" in that video ARGHHHHH ANGRY
-
(http://static.funnyjunk.com/pictures/4aa6fcc2_3be8_9de0.jpg)
(http://static.funnyjunk.com/pictures/4840b734_65ab_4571.jpg)
(http://d3uwin5q170wpc.cloudfront.net/photo/91157_700b_v1.jpg)
-
lmao :L
-
(http://d3uwin5q170wpc.cloudfront.net/photo/91157_700b_v1.jpg)
Haha :L
When a friend sent me a link to that video, I was like WTF is that shit :L
the music sucks, the lyrics suck the video sucks, everything you can see and hear just sucks ::) :L
-
(http://img156.imageshack.us/img156/5787/ehehheq.png)
:L :L
-
That song's lyrics are so meaningful :L
-
7am, waking up in the morning
Gotta be fresh, gotta go downstairs
Gotta have my bowl, gotta have cereal
Seein’ everything, the time is goin’
Tickin’ on and on, everybody’s rushin’
Gotta get down to the bus stop
Gotta catch my bus, I see my friends (My friends)
Kickin’ in the front seat
Sittin’ in the back seat
Gotta make my mind up
Which seat can I take?
It’s Friday, Friday
Gotta get down on Friday
Everybody’s lookin’ forward to the weekend, weekend
Friday, Friday
Gettin’ down on Friday
Everybody’s lookin’ forward to the weekend
Partyin’, partyin’ (Yeah)
Partyin’, partyin’ (Yeah)
Fun, fun, fun, fun
Lookin’ forward to the weekend
-
PARTY CAT!
(http://nedroid.com/imagesb/partycat01.gif)
(http://nedroid.com/imagesb/partycat02.gif)
(http://nedroid.com/imagesb/partycat03.gif)
(http://nedroid.com/imagesb/partycat04.gif)
(http://nedroid.com/imagesb/partycat05.jpg)
(http://nedroid.com/imagesb/partycat06.gif)
-
PARTY DOG, noooooooes! :(
-
Hahahah... party dog came :L
-
I freaking love party cat.
-
I luv it :D
-
[youtube]HQsZgIOFj74[/youtube]
-
20 + minutes?
This is better:
[youtube]vwIEqNWykzM[/youtube]
-
its not how fast he finished it its just funny
-
(http://static.funnyjunk.com/pictures/47eef694_1cf5_3432.jpg)
-
[youtube]VABSoHYQr6k[/youtube]
-
Haha, I don't even need to play the video to find it funny. :L
-
Haha, I don't even need to play the video to find it funny. :L
innit :L
-
[youtube]VABSoHYQr6k[/youtube]
haha it all started so seriously too
-
(http://i.imgur.com/Sp4LV.jpg)
-
[youtube]LOLexb3sqZU[/youtube]
[youtube]8_uh0ozOf5c[/youtube]
-
[youtube]http://www.youtube.com/watch?v=1NTFbI3sI7k&feature=player_embedded[/youtube]
-
(http://i.imgur.com/1IGZK.jpg)
-
:L :L
-
hahahahahaha :L :L
-
Just watched that Rebecca Black video, and it has to be the second worst piece of shit I've ever had the misfortune to hear (it doesn't take much figuring out to guess what is worse). I'm not worried about the future of music for this though. After all, her fame comes from the video going viral. And why did it go viral? Purely because of how shit it is. It's people like Bieber that are killing music, mainly because people actually like it. Rebecca won't get far because she won't have all the retarded fan girls on her side, but it still fails epically.
/me acknowledges that this is not the rant thread, but believes it must be said.
-
(http://www.bofunk.com/photoalbum/31.jpg)
(http://www.bofunk.com/photoalbum/27.jpg)
(http://www.bofunk.com/photoalbum/74.jpg)
(http://www.bofunk.com/photoalbum/97.jpg)
-
best shirt ever, not the topic for that but best avatar ever XD
-
another intresting t-shirts
(http://2.bp.blogspot.com/_DmeuenWvPTs/TIdOIuZKIsI/AAAAAAAAAMg/7w55iyJ2UK8/s1600/girls_tshirt_signs_23.jpg)
(http://fhm.com.my.ns54.small-dns.net/wp-content/uploads/2010/09/xboxtshirt.jpg)
-
(http://obczaj.net/obrazki/140280.jpg)
(http://obczaj.net/obrazki/140288.jpg)
(http://obczaj.net/obrazki/140291.jpg)
(http://obczaj.net/obrazki/140292.jpg)
-
[youtube]http://www.youtube.com/watch?v=ZwCeQ0i3zlY[/youtube]
-
:L
-
[youtube]http://www.youtube.com/watch?v=aagP2USp4J8&NR=1[/youtube]
-
[youtube]http://www.youtube.com/watch?v=UsZLEeTa2rg&feature=related[/youtube]
-
botch! and that's not shawn michaels!
-
[youtube]http://www.youtube.com/watch?v=aiww4OTA194[/youtube]
-
Thats the best way to solve RRoD in x360 :L
[youtube]http://www.youtube.com/watch?v=RWtxs5rl7jk&feature=player_embedded[/youtube]
-
[youtube]http://www.youtube.com/watch?v=jBqtQjJqSQw&feature=related[/youtube]
-
lol not enough vodka!
-
[youtube]http://www.youtube.com/watch?v=wCgx8zM3woQ&feature=topvideos[/youtube]
-
This one's good too :L
[youtube]http://www.youtube.com/watch?v=IoVb6-s-wEA&feature=relmfu[/youtube]
-
catchy :L
-
:P
-
[youtube]http://www.youtube.com/watch?v=NR-ofePXj9E[/youtube]
haha :L
-
(http://d3uwin5q170wpc.cloudfront.net/photo/91157_700b_v1.jpg)
NSFW: http://i.imgur.com/NRwDm.jpg
-
[youtube]http://www.youtube.com/watch?v=blYvzbd_y7I[/youtube]
-
[youtube]3uDCR3IIIJo[/youtube]
:L
-
lol
epic
-
NSFW: http://i.imgur.com/NRwDm.jpg
Moo, that's not a real person, it is a work of art.
-
omg i thought those people were just dwarves :O lol honestly though, i only edited it cos from far away it could like a real person and tbh if i was at school i wouldn't really want to say no teacher look at this it's actually a work of art
-
people shouldn't be on here when at school or college, this PG bs is OTT
-
:o i've only edited like 2 links in the past few months, all in the last week though.
-
:L
-
just wait til you get a job at an office, you'll thank me :L
-
good job i didn't get my admin placement then haha
-
/givexadmin mehlol 0
-
blah lol
i almost got attacked by a drunken tramp outside tk maxx when i was waiting to go for my interview.. like literally 5 footsteps away.. what a good impression that almost made :@
-
maybe if you hadn't been drunk you would've noticed it was a mirror :(
-
[size=pt1]:o[/size]
-
[size=pt1]:o[/size]
(http://i.imgur.com/NG05R.jpg)
-
loooooooooooooooooooooooooooooooooooooooooooooool
-
[youtube]http://www.youtube.com/watch?v=AQ4JD6DaA7Y[/youtube]
-
haha nice
that has to be the most remixable song ever
http://matrixprince.ytmnd.com/
-
(http://i.imgur.com/aucBS.gif)
-
(http://www.shrani.si/f/V/8D/3HZlNRJB/797292115.gif)
-
omg ^ hahahahahahaha
-
lol
-
Lol'd ^ :L
-
Ha ha.
(Although the footage of that car ploughing through those people on bikes is grim)
-
not funny but ftw
[youtube]http://www.youtube.com/watch?v=4TshFWSsrn8[/youtube]
-
hehe NASCAR...
(http://obczaj.net/obrazki/140820.jpg)
take a close look at last picture in this set
(http://obczaj.net/obrazki/140827.jpg)
famous scene from "Dark Knight"
http://www.youtube.com/watch?v=2KX3OriDpgg
(http://obczaj.net/obrazki/140833.jpg)
(http://obczaj.net/obrazki/140836.jpg)
(http://obczaj.net/obrazki/140844.jpg)
(http://obczaj.net/obrazki/140706.jpg)
-
haha paper beats rock? XD
:L :L :L
-
(http://www.damnlol.com/pics/230/41ec961b70d30eb67ed305e2148c6670.jpg)
(http://www.damnlol.com/pics/277/bd5f831341b59e6800c51b7efcfc3a76.gif)
(http://www.damnlol.com/pics/496/3c590cf4a40f2bb821cf1377d5ea0e02.jpg)
(http://www.damnlol.com/pics/778/187bd7fadbaa283352009949b2ccdc11.gif)
(http://www.damnlol.com/pics/5/d9ef445f0ee85aa77c4a5e30f897f751.gif)
(http://www.damnlol.com/pics/202/0e6c173a62715b0fe08fc9bb50f7031a.jpg)
(http://www.damnlol.com/pics/546/90e0050a5cea30f30633c5b1a0805a2a.gif)
(http://www.damnlol.com/pics/441/a8f79bcbad2445d69b5e0ba2dcfc50a7.gif)
(http://www.damnlol.com/pics/936/87fd66ffb3977d7fbad4445862e2bfb9.gif)
(http://www.damnlol.com/pics/937/4de05ae9770772917a820c4deda35441.jpg)
(http://www.damnlol.com/pics/444/380c0ec76b525ef04a48cd9d84985f0e.jpg)
(http://www.damnlol.com/pics/224/399418479b53c9a1571e9147dce24e8a.jpg)
(http://www.damnlol.com/pics/982/cf18bd19300202884babaec9f267066c.gif)
-
:L
-
(http://i.imgur.com/iGezg.jpg)
-
replace watch?v= with v/ to get past that btw lol
-
http://i.imgur.com/iGezg.jpg
ya trueeeeeeeeeee
-
replace watch?v= with v/ to get past that btw lol
I don't get it?
-
me either, it wasn't working. is it for every video with ads?
-
It's simple. When you find a video in youtube that requires you to login to verify your (adult)age and you just cba to login do this:
1- Copy the link of the video.
2- Paste it in the address bar (NeedForSpeedMostWanted: http://www.youtube.com/watch?v=6CJnb6dAcC4)
3- Edit the url; delete the " watch?_= " part, leave the "v" and add a " / " after the "v"
It should look like this: http://www.youtube.com/v/6CJnb6dAcC4
4- Press Enter and the video will appear.
btw here's a funny short film. Maybe it was posted already since its kinnda old but I found it until couple of weeks ago.
Anyway, here...
[youtube]http://www.youtube.com/watch?v=9VDvgL58h_Y[/youtube]
-
[youtube]ilNZl3hk4rw[/youtube]
-
idiot!
[youtube]http://www.youtube.com/watch?v=pXQNpGmK5Qs&feature=player_embedded[/youtube]
-
Haha :L
-
well done 8) muahuahu
-
Russian drivers are the best.
-
Russian drivers are the best.
yeah
(http://news.bbcimg.co.uk/media/images/47407000/jpg/_47407420_petrov466.jpg)
-
idiot!
[youtube]http://www.youtube.com/watch?v=pXQNpGmK5Qs&feature=player_embedded[/youtube]
whats it?
Porshe?
-
yeh Porsche Cayenne
-
lol what an ugly car
-
What a retard driver.
Do they drink 'stupid-water' or something?
-
After watching that Lil' Wayne video, I looked up how old Tim Westwood is, and I didn't realise he's FIFTY THREE. :o
-
After watching that Lil' Wayne video, I looked up how old Tim Westwood is, and I didn't realise he's FIFTY THREE. :o
Tim Westwood's a fag.
-
[youtube]QG62pu38twg[/youtube]
You would think this is a piss take, but alas not.
He is funny, even if he doesn't mean to be.
-
modest :L
-
he was in this game hole life
he was there from day 1 :L
he`s just a pathetic dj
maybe he`s d.j.-ing for retards
[youtube]http://www.youtube.com/watch?v=21OH0wlkfbc[/youtube]
-
I like him because he proves hip-hop is for everyone, even ageing white middle-class sons of the Anglican Bishop of Peterborough. ;)
-
"He`s playing hip-hop all his life
He`s talking about:
-New York RAP LOL
-West Coast LOL
-Dirty South LOL
-UK Hip-Hop OK
-Gangsta RAP LOL
-RNB OK
He`s a light hip-hop + rnb,
he cant say he`s playing RAP all he`s life
this is bullshit.
New York RAP, West Coast, Dirty South and Gangster RAP
NY RAP
[youtube]http://www.youtube.com/watch?v=vKl-hLYvd8I[/youtube]
WEST COAST
[youtube]http://www.youtube.com/watch?v=L3logOjUNoA[/youtube]
Dirty South
[youtube]http://www.youtube.com/watch?v=MaE_dAiajM0[/youtube]
Gangsta RAP
[youtube]http://www.youtube.com/watch?v=_-afioLMcEc[/youtube]
[youtube]QG62pu38twg[/youtube]
(http://img707.imageshack.us/img707/2941/capturentv.png)
You would think this is a piss take, but alas not.
He is funny, even if he doesn't mean to be.
1:40-1:46
"And you can listen to me RIGHT NOW!
what you have to is get the mouse
and click on the bottom,
its down hire somewhere!" :L
i got no problems with the guy, but he`s bullshiting ppl with that rap thing
also saying mp3 is future...
-
[youtube]hl0qIqGqzmQ[/youtube]
-
[youtube]hl0qIqGqzmQ[/youtube]
LOL WDF HAHA.
-
That is a great kill :D
-
haha too funny
-
freaking awesome
-
awesome freaking
:L :L
-
(http://obczaj.net/obrazki/141174.jpg)
(http://obczaj.net/obrazki/141206.jpg)
(http://obczaj.net/obrazki/141122.jpg)
(http://obczaj.net/obrazki/141161.jpg)
and as a special bonus...
DoubleYou(r)
(http://obczaj.net/obrazki/141189.jpg)
-
[youtube]http://www.youtube.com/watch?v=hSVNbxjdvv8[/youtube]
-
(http://obczaj.net/obrazki/141122.jpg)
haha :L
-
Ha ha, brilliant
[youtube]e7ReCtipPac[/youtube]
-
Hahah :L
-
this is funny :L :L :L
[youtube]http://www.youtube.com/watch?v=KxaWvJ-ziXA&feature=player_embedded[/youtube]
-
so useless :L :L
-
[youtube]vKb572Yo2aM&feature=player_embedded[/YOUTUBE]
-
spitting everywhere lol
-
this dude is still better
this dude is really good lol, he can cound like:
-skyline
-supra
-rx 7
-mustang
[youtube]http://www.youtube.com/watch?v=iQF_kTGLVWU[/youtube]
-
(http://www.chilloutpoint.com/images/2010/11/funny-girls-gone-wild/funny-girls-gone-wild-08.jpg)
(http://www.chilloutpoint.com/images/2010/11/funny-girls-gone-wild/funny-girls-gone-wild-02.jpg)
(http://www.bezbrige.com/images/stories/galerija/09/exams/10.jpg)
(http://www.odditieszone.com/wp-content/uploads/2010/05/photos-wtf-02.jpg)
(http://www.odditieszone.com/wp-content/uploads/2010/05/photos-wtf-06.jpg)
(http://www.odditieszone.com/wp-content/uploads/2010/05/photos-wtf-08.jpg)
-
Great analysis :L
[youtube]http://www.youtube.com/watch?v=cqhiRRJ1vOk[/youtube]
-
[youtube]http://www.youtube.com/watch?v=cqhiRRJ1vOk&feature=related[/youtube]
-
WTF LOOOOOL
[youtube]http://www.youtube.com/watch?v=LE-JN7_rxtE&feature=related[/youtube]
-
LooooooooooL
-
even better:
[youtube]http://www.youtube.com/watch?v=cqGF-Eo619w&feature=relmfu[/youtube]
-
lmao lol
-
[youtube]http://www.youtube.com/watch?v=dNkLL6P2t4w[/youtube]
-
[youtube]3l45ILYWLAo[/youtube]
-
WTF LOOOOOL
[youtube]http://www.youtube.com/watch?v=LE-JN7_rxtE&feature=related[/youtube]
epic :L :L
-
[youtube]http://www.youtube.com/watch?v=GEXqMH8I3_w[/youtube]
EDIT:
nothing funny about this:
[youtube]http://www.youtube.com/watch?v=Md5LlI1f6tc&feature=player_embedded[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=tlckXq5eOSk[/youtube]
Only in Lithuania...
-
(http://mindhacks.org/category/files/WakingFromAComa_F25B/image0_thumb1.png)
Jan Grzebski wakes from coma after 19 years
A Polish guy, Jan Grzebski was hit by a train in 1988 and sent into a deep coma . . . Imagine waking from a coma to find that:
1989 - The Iron Curtain Came Down, the fall of the Berlin Wall
1991 - The Soviet Union Collapsed
2004 - Poland joins the EU
-
^ I think I had heard about that lol... kind of the same scenario than "goodbye lenin", in case you've seen that movie.
-
lol my birth year 1988 :L
-
pro
http://youtu.be/_PF8A11AWTY
-
(http://mindhacks.org/category/files/WakingFromAComa_F25B/image0_thumb1.png)
Jan Grzebski wakes from coma after 19 years
A Polish guy, Jan Grzebski was hit by a train in 1988 and sent into a deep coma . . . Imagine waking from a coma to find that:
1989 - The Iron Curtain Came Down, the fall of the Berlin Wall
1991 - The Soviet Union Collapsed
2004 - Poland joins the EU
He woke up in 2007 and died in 2008. Kinda sucks lol
-
Jan Grzebski wakes from coma after 19 years
A Polish guy, Jan Grzebski was hit by a train in 1988 and sent into a deep coma . . . Imagine waking from a coma to find that:
1989 - The Iron Curtain Came Down, the fall of the Berlin Wall
1991 - The Soviet Union Collapsed
2004 - Poland joins the EU
He woke up in 2007 and died in 2008. Kinda sucks lol
Omg so disappointed lol.
-
[youtube]http://www.youtube.com/watch?v=1vlllcGdoUE&feature=player_embedded[/youtube]
XD
-
[youtube]http://www.youtube.com/watch?v=ahdlyfsEPcE&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=hM5GjvojZzY&feature=player_embedded[/youtube]
-
[youtube]http://www.youtube.com/watch?v=IU9nF4z1vxk&feature=player_embedded[/youtube]
-
This is hilariously awkward. ha ha
http://www.bbc.co.uk/programmes/p00g4j0c
-
[youtube]http://www.youtube.com/watch?v=xC03hmS1Brk[/youtube]
:L
-
LOL
-
[youtube]http://www.youtube.com/watch?v=iCB3fnXDzew[/youtube]
dont talk :-X :-X
-
[youtube]http://www.youtube.com/watch?v=7iMATYbejXM[/youtube]
:L :L
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=OKKEoPZiM-I[/youtube]
-
lol pwnt!
-
i know , winter is finish but it could be usefull when cold days will come back :L :L :L :L :L
(http://fr.oshims.com/uploads/testicules-300x209.jpg)
-
(http://media.tumblr.com/tumblr_ldc6alh2ns1qdzdzs.gif)
-
I'm seriously hoping this is a parody right now:
[youtube]http://www.youtube.com/watch?v=CsocXXe1KSw[/youtube]
If not, music has officially died.
-
well, good to know it's official lol. better uninstall winamp
-
(http://www.damnlol.com/pics/411/c2258b076718d39087ff95986855e08a.jpg)
Virgins never touch
(http://looneyfun.com/img/do-not-touch/do-not-touch19.jpg)
(http://looneyfun.com/img/do-not-touch/do-not-touch01.jpg)
(http://looneyfun.com/img/do-not-touch/do-not-touch02.jpg)
(http://looneyfun.com/img/do-not-touch/do-not-touch03.jpg)
(http://looneyfun.com/img/do-not-touch/do-not-touch04.jpg)
(http://looneyfun.com/img/do-not-touch/do-not-touch05.jpg)
(http://looneyfun.com/img/do-not-touch/do-not-touch06.jpg)
(http://looneyfun.com/img/do-not-touch/do-not-touch07.jpg)
(http://looneyfun.com/img/do-not-touch/do-not-touch08.jpg)
(http://looneyfun.com/img/do-not-touch/do-not-touch09.jpg)
(http://looneyfun.com/img/do-not-touch/do-not-touch10.jpg)
(http://looneyfun.com/img/do-not-touch/do-not-touch11.jpg)
(http://looneyfun.com/img/do-not-touch/do-not-touch12.jpg)
(http://looneyfun.com/img/do-not-touch/do-not-touch14.jpg)
(http://looneyfun.com/img/do-not-touch/do-not-touch15.jpg)
(http://looneyfun.com/img/do-not-touch/do-not-touch16.jpg)
(http://looneyfun.com/img/do-not-touch/do-not-touch17.jpg)
Barbie got old
(http://bored-space.com/Pics/Barbie/Barbie001.jpg)
(http://bored-space.com/Pics/Barbie/Barbie002.jpg)
(http://bored-space.com/Pics/Barbie/Barbie003.jpg)
(http://bored-space.com/Pics/Barbie/Barbie004.jpg)
(http://bored-space.com/Pics/Barbie/Barbie005.jpg)
(http://bored-space.com/Pics/Barbie/Barbie006.jpg)
(http://bored-space.com/Pics/Barbie/Barbie007.jpg)
(http://bored-space.com/Pics/Barbie/Barbie008.jpg)
(http://bored-space.com/Pics/Barbie/Barbie009.jpg)
-
omg :L
-
lol pink 'Vette'
-
lol this:
http://gobarbra.com/hit/new-72ab629b8fdee2167400deddaf9b723f
-
sick banking (51)
(http://motocross.transworld.net/files/2010/09/gym3_part2-01.jpg)
-
(http://lolsnaps.com/upload_pic/2601.jpg)
(http://www.damnlol.com/pics/897/3179952bccf3b9f8b4fa5d512e400793.jpg)
(http://lolsnaps.com/upload_pic/2603.gif)
(http://i.imgur.com/kavFN.jpg)
(http://lh5.ggpht.com/_AIYzC5_syVE/TYxiqZQTcKI/AAAAAAAAE2g/jYHHBXHTfW4/s512/motivationalposters03.jpg)
(http://lh6.ggpht.com/_AIYzC5_syVE/TYxirp97p7I/AAAAAAAAE2o/Ixu5slWgqQ0/s512/motivationalposters07.jpg)
(http://lh5.ggpht.com/_AIYzC5_syVE/TYxitbwz6hI/AAAAAAAAE3E/PIZ1E3iS4Pw/s512/motivationalposters12.jpg)
(http://dailypicdump.com/data/images/2010/08/20/310fc7.jpg)
-
sick banking (51)
(http://motocross.transworld.net/files/2010/09/gym3_part2-01.jpg)
;_;
-
(http://dailypicdump.com/data/images/2010/08/20/310fc7.jpg)
hahahaha i love with that kind of picture
(http://dailypicdump.com/data/images/2011/04/07/9963f6.jpg)
-
LMFAO !
-
(http://i.imgur.com/FU8aU.jpg)
-
Rofl :L :L :L :L :L :L :L
-
Lold well :L :L
-
(http://25.media.tumblr.com/tumblr_leq6lxcmLP1qc438to1_400.gif)
-
(http://i.imgur.com/BYMi3.jpg)
-
wtf :L
though sometimes i experience the same problem with counting too :L
-
[youtube]http://www.youtube.com/watch?v=i8qYd4Os0jM[/youtube]
-
lol wtf
-
nuclear diseases !!!
-
(http://obczaj.net/obrazki/142171.jpg)
(http://obczaj.net/obrazki/142060.jpg)
M4s rabbit
(http://obczaj.net/obrazki/142061.jpg)
(http://obczaj.net/obrazki/142066.jpg)
(http://obczaj.net/obrazki/142067.jpg)
(http://obczaj.net/obrazki/142088.jpg)
-
(http://artoftrolling.files.wordpress.com/2011/04/chatroulette-trolling-brides.jpg)
-
[youtube]http://www.youtube.com/watch?v=9QtSyr6yW9U&feature=topvideos[/youtube]
-
Hahah great Fail :P
-
Bon appetite!
[youtube]http://www.youtube.com/watch?v=ZGw5ip2EokY[/youtube]
-
meeeeeat!!
-
Yaaaaaaaaay O0
-
(http://artoftrolling.files.wordpress.com/2011/04/chatroulette-trolling-hate-that.jpg)
-
Hi There >:D
http://www.youtube.com/watch?v=_AvRTS7Kt-k :L :L
---> [O_o]N36471V3[o_O]
-
Well, I watched it so many times and i was laughing so hard. I thought why don't i share it with you guys.
[youtube]http://www.youtube.com/watch?v=jrK7CZos404&feature=relmfu[/youtube]
-
Welcome to the forums..
http://forum.adrenalinex.co.uk/index.php/topic,362.0.html
-
returned normal title topik
THANKS MOOMAN
:L
-
^
-
[youtube]http://www.youtube.com/watch?v=qqhlfz9GQPE&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=MJzOtDOI8Ws[/youtube]
-
loooool
[youtube]http://www.youtube.com/watch?v=IR5ISm0_Y5k&feature=related[/youtube]
-
(http://www.worldofmolecules.com/drugs/adrenaline.gif)
-
OMG
its worse than Friday...
[youtube]http://www.youtube.com/watch?v=j67C-w8Uxu4&feature=related[/youtube]
-
Poor guy :L
[youtube]http://www.youtube.com/watch?v=qa0jvHOhWBc&feature=related[/youtube]
-
wow :L :L
-
(http://i.imgur.com/esjVI.jpg)
-
LMFAO :L :L ;D ;D
-
[youtube]http://www.youtube.com/watch?v=moY4mMlNOe4[/youtube]
:L :L
-
jaki debil!
-
jaki debil!
to nie jest polskie tylko ruskie!
-
This is not the only Russian Polish!
-
This is not the only Russian Polish!
you used bad translator ;_;
correct is:
This isnt Polish but Russian!
-
[youtube]http://www.youtube.com/watch?v=NM4fzcU8xJE[/youtube]
[youtube]http://www.youtube.com/watch?v=7Uc9fkLQqz4[/youtube]
-
Hahaha Epic Goal :D
-
[youtube]http://www.youtube.com/watch?v=9QtSyr6yW9U&feature=topvideos[/youtube]
Fair play to her, she carried on.
-
[youtube]http://www.youtube.com/watch?v=6OC-Sjeeqo4[/youtube]
lol
-
[youtube]http://www.youtube.com/watch?v=9QtSyr6yW9U&feature=topvideos[/youtube]
Fair play to her, she carried on.
he/she`s insane
-
[youtube]http://www.youtube.com/watch?v=NM4fzcU8xJE[/youtube]
heh, epic goal :L
-
(http://i.imgur.com/0OB4J.jpg)
-
1st some tasty opener...
(http://obczaj.net/obrazki/142502.jpg)
and then continue...
(http://obczaj.net/obrazki/142482.jpg)
(http://obczaj.net/obrazki/142510.jpg)
(http://obczaj.net/obrazki/142523.jpg)
(http://obczaj.net/obrazki/142524.jpg)
(http://obczaj.net/obrazki/142556.jpg)
-
hahaha learn to fly :P
-
LOL at Baron's sig, he is like a pokemon.
-
big sigs :(
-
Signature Limits Mod (http://custom.simplemachines.org/mods/index.php?mod=528)
nCode Image Resizer (http://custom.simplemachines.org/mods/index.php?mod=1197)
-
nsfw: http://img857.imageshack.us/img857/3715/2011041700007.jpg
-
(http://media.tumblr.com/tumblr_ljbx8nWmKt1qexvtu.gif)
-
:L :L :L
-
ROFL
-
[youtube]http://www.youtube.com/watch?v=QYkvNoyffQg[/youtube]
This man is a genius. Anyone want to make an Adrenaline X micro-nation?
-
The Republic of Molossia has claimed that it is fighting a war with East Germany[9] and it has issued war bonds to stop the war.[10] It claims that is has been fighting it since November 2, 1987.[9]
-
what's so funny about that video? i guess i forgot to laugh
-
The guy in the video is also autistic. :L
-
(http://29.media.tumblr.com/tumblr_ljtkofwaZ11qf087qo1_500.png)
-
[youtube]http://www.youtube.com/watch?v=VAGiQ3AWKqI[/youtube]
-
Haha. I think the moral of the story is to talk to girls that aren't in a position to run away easily. :L
-
(http://obczaj.net/obrazki/142732.jpg)
(http://obczaj.net/obrazki/142678.jpg)
-
This is a very upsetting story, but don't skip to the end, start from the beginning and read the whole thing in order.
(http://i.imgur.com/ma7lm.jpg)
-
and that is why i always read the last line first :(
-
i don't get it?
everybody walk the dinosaur?
(http://i.imgur.com/zl07R.gif)
-
everybody walk the dinosaur?
[youtube]http://www.youtube.com/watch?v=733O0xJDx8o[/youtube]
(http://i.imgur.com/mRdKv.jpg)
-
(http://farm6.static.flickr.com/5109/5629968940_2e8c677e48_z.jpg)
-
^ lol
(http://i.imgur.com/9yjx1.png)
-
At least it has over 2 mil. dislikes :D
-
(http://obczaj.net/obrazki/142742.jpg)
-
(http://i.imgur.com/kqiOU.jpg)
-
(http://img696.imageshack.us/img696/4418/lilwayneuq.jpg)
-
ROFL ! :L
-
(http://i.imgur.com/kqiOU.jpg)
hahaha
-
(http://i.imgur.com/SvTQF.jpg)
-
lol
[youtube]http://www.youtube.com/watch?v=8l7ETGztFis[/youtube]
-
[youtube]http://www.youtube.com/watch?v=jrNEsA5f8no[/youtube]
lolol, videogames with memes included
[youtube]http://www.youtube.com/watch?v=e4OjDcDlzAw[/youtube]
-
(http://img641.imageshack.us/img641/6131/comiccomp.jpg)
-
omg best pictures ever lol
-
Sensu shake ftw. :L
-
(http://profile.ak.fbcdn.net/hprofile-ak-snc4/174856_203714772994515_5212442_n.jpg)
-
(http://ejournal.eumind.net/schooldaze/index.php?action%5B%5D=IArticleShow::showArticle('29205'))
HI mooman.
-
its borring, pls put some gay porn on runty`s avatar :L
-
try again runty lol
-
oops fail, put it as an image lol
http://ejournal.eumind.net/schooldaze/index.php?action%5B%5D=IArticleShow::showArticle('29205') (http://ejournal.eumind.net/schooldaze/index.php?action%5B%5D=IArticleShow::showArticle('29205'))
-
oops fail, put it as an image lol
http://ejournal.eumind.net/schooldaze/index.php?action%5B%5D=IArticleShow::showArticle('29205') (http://ejournal.eumind.net/schooldaze/index.php?action%5B%5D=IArticleShow::showArticle('29205'))
(http://ejournal.eumind.net/schooldaze/media/Schooldaze India/ARTICLES - STUDENTS/Tabish.JPG)
Hi,
I am Tabish mooman and I am 14 years old. I live in Mumbai. I like to play all types of games and I even like P. C. games and my favorite sport is wrestling. I have only one real sister and no brother. I do not have any pet but I would love to keep one. My favorite colour is yellow. I love Indian food the most. I love music epically, hip-hop and rock.
haha
k, another one
(http://i.imgur.com/rIM6r.jpg)
-
(http://chzmemebase.files.wordpress.com/2011/04/memes-untitled14.jpg)
-
[youtube]http://www.youtube.com/watch?v=jqw0CASqixA&feature=grec_index[/youtube]
-
(http://obczaj.net/obrazki/142870.jpg)
(http://obczaj.net/obrazki/142847.jpg)
(http://obczaj.net/obrazki/142964.jpg)
(http://obczaj.net/obrazki/142950.jpg)
(http://obczaj.net/obrazki/142983.jpg)
(http://obczaj.net/obrazki/143229.jpg)
-
skills 8)
[youtube]http://www.youtube.com/watch?v=sZGhGbfzCSU[/youtube]
-
WOW ! :o
-
[youtube]gV3cDlQpTVs[/youtube]
-
haha. for anyone curious, here's the real story: http://www.reddit.com/comments/guw36/the_guy_in_the_valve_splash_screen/
-
some random collection
(http://i55.tinypic.com/v3oj2o.png)
(http://i52.tinypic.com/jgjsc6.png)
(http://i56.tinypic.com/2z5ulj4.png)
-
(http://i55.tinypic.com/v3oj2o.png)
mooman ftw.
-
[youtube]http://www.youtube.com/watch?v=R3Mt2E1M6dU[/youtube]
-
[youtube]http://www.youtube.com/watch?v=z62zrqaqVbY[/youtube]
-
[youtube]http://www.youtube.com/watch?v=2GE2V1qyYFE[/youtube]
-
wtf...
-
[youtube]http://www.youtube.com/watch?v=0E34lxrf2oA&feature=relmfu[/youtube]
-
[youtube]http://www.youtube.com/watch?v=hAiQdgQXmT4[/youtube]
-
(http://obczaj.net/obrazki/143333.jpg)
(http://obczaj.net/obrazki/143335.jpg)
(http://obczaj.net/obrazki/143337.jpg)
-
(http://a.yfrog.com/img839/8169/h73e.jpg)
(http://a.yfrog.com/img168/3258/knx.jpg)
-
[youtube]http://www.youtube.com/watch?v=lb1awXgoyQE&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=J1hubf2zam8&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=1CQz2nFn6uc&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=CmrxkxLX_Yk[/youtube]
[youtube]http://www.youtube.com/watch?v=do-GBnrU-NI&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?v=I84X2MSL-o8&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=QRJBgIO--rE[/youtube]
-
:L
-
(http://www.damnlol.com/pics/864/a83d838e2c6329001e92f0695465e02b.jpg)
-
ahhhh fuck off with that lol
-
(http://i.imgur.com/utkhR.jpg)
-
:L
-
[youtube]http://www.youtube.com/watch?v=OiYi6458wig[/youtube]
[youtube]http://www.youtube.com/watch?v=XeJeof-yAUM[/youtube]
and lol this v
[youtube]http://www.youtube.com/watch?v=gX4MJqlq6aI[/youtube]
-
[youtube]http://www.youtube.com/watch?v=OiYi6458wig[/youtube]
[youtube]http://www.youtube.com/watch?v=XeJeof-yAUM[/youtube]
:L
-
[youtube]http://www.youtube.com/watch?v=yYMxGL9hrnY&feature=feedu[/youtube]
-
rofl :L
-
(http://i52.tinypic.com/24cs504.jpg)
(http://i55.tinypic.com/av1r0o.jpg)
(http://i56.tinypic.com/ddpa8n.jpg)
(http://i52.tinypic.com/4vpous.jpg)
(http://i54.tinypic.com/2qkjssi.jpg)
(http://i52.tinypic.com/2m49635.jpg)
(http://i55.tinypic.com/ac4r5w.jpg)
(http://i54.tinypic.com/jrzcc3.jpg)
-
http://www.youtube.com/watch?v=INKHsm-Pmkk&feature=player_embedded#at=83
And of course the website is down series:
http://www.youtube.com/watch?v=qAuLqaLGvZU
http://www.youtube.com/watch?v=1SNxaJlicEU&feature=related
http://www.youtube.com/watch?v=1XjKnxOcaO0&feature=related
http://www.youtube.com/watch?v=RAJPeazbMYw&feature=related
-
I made another one lol
[youtube]http://www.youtube.com/watch?v=q5ymJ75nQCw[/youtube]
-
(http://i.imgur.com/2edYg.jpg)
-
:L ^
(http://i.imgur.com/taIMh.jpg)
-
:L
-
^LOL at Bin Laden.
Something about this guy seems awfully familiar... :L
[youtube]http://www.youtube.com/watch?v=WhNGrwlwMIA[/youtube]
-
(http://obczaj.net/obrazki/143827.jpg)
(http://obczaj.net/obrazki/143826.jpg)
(http://obczaj.net/obrazki/143831.jpg)
-
Something about this guy seems awfully familiar... :L
[youtube]http://www.youtube.com/watch?v=WhNGrwlwMIA[/youtube]
Yeah :L
He missed the "GSF fo' life" part though.
I would like that lamp post mod for SA.
-
Watch it all:
http://www.joemonster.org/filmy/8648/Reklama_ktora_powinienes_zobaczyc_do_konca
-
http://www.noob.us/humor/baby-laughing-at-half-speed/
-
[YOUTUBE]http://www.youtube.com/watch?v=3kEtWlE4qFg[/YOUTUBE]
ahahahahahhaha
(http://external.ak.fbcdn.net/safe_image.php?d=890125ff3123ef0a701fde4a40ae2814&url=http%3A%2F%2Fimages1.wikia.nocookie.net%2F__cb20101208214232%2Fnonciclopedia%2Fimages%2F3%2F30%2FBerlusconi_Trollface.jpg)
-
LMFAO :L :L :L :L :L :L :L
[youtube]http://www.youtube.com/watch?v=ikD-Uugb0zo[/youtube]
-
LOL :L :L :L
-
[youtube]http://www.youtube.com/watch?v=GGPIQ72-2Vg[/youtube]
-
http://www.youtube.com/watch?v=zDGo7FyLGwI&feature=player_embedded
-
not funny, but this is epic :o
[youtube]http://www.youtube.com/watch?v=mgriJn0N5c0&feature=related[/youtube]
-
^Wibble Wobble wibble wobble cool avatar bro.
-
cheers homie.
-
Macedonians parkour fails
http://www.youtube.com/watch?v=oQAjPd2oNvs
-
FAaaaaaaaaiiiL :D
: http://www.facebook.com/l.php?u=http%3A%2F%2Fwww.youtube.com%2Fwatch%3Fv%3DECo5rjYCsGk%26feature%3Dshare&h=6b50a
Never do that at home :L :L
-
[youtube]http://www.youtube.com/watch?v=EkFo9DiJSOY&feature=feedrec_grec_index[/youtube]
-
^ lol, reminds me of this:
[youtube]http://www.youtube.com/watch?v=1dF2ZLq7oBk[/youtube]
-
oh god ##
-
[youtube]http://www.youtube.com/watch?v=pSE9Gh4ULgw[/youtube]
-
(http://images.newstatesman.com/articles/2010//20100723_gta_rothbury_w.jpg)
troll'd
-
[youtube]http://www.youtube.com/watch?v=UFsXi9VNRJY[/youtube]
-
What sort of paper does it need to be to work?
-
maybe A4
-
ahaha
-
lol nice video.
-
ENJOY!
[youtube]http://www.youtube.com/watch?v=xzEs4Iv1S0A[/youtube]
[youtube]http://www.youtube.com/watch?v=1TMI2IAcVmU[/youtube]
Remember my old avatar? :D :
[youtube]http://www.youtube.com/watch?v=DTAn0ME1Ob0[/youtube]
[youtube]http://www.youtube.com/watch?v=iO_GHTbJW08[/youtube]
[youtube]http://www.youtube.com/watch?v=Czxi4Y5z6a8[/youtube]
[youtube]http://www.youtube.com/watch?v=a56Se27v0aE[/youtube]
[youtube]http://www.youtube.com/watch?v=Yx5gy-SQLdk[/youtube]
[youtube]http://www.youtube.com/watch?v=Sggms3yed0c[/youtube]
-
[youtube]http://www.youtube.com/watch?v=a56Se27v0aE[/youtube]
lmao :L :L
-
Colin McRae Dirt: Polish Edition :L
Phobos, maybe you will understand this
[youtube]http://www.youtube.com/watch?v=zv3S_g5JW9Q[/youtube]
-
no :L
-
LMAO!!
[YOUTUBE]http://www.youtube.com/watch?v=EpR_DpGGxig[/youtube]
-
LMAO!!
[YOUTUBE]http://www.youtube.com/watch?v=EpR_DpGGxig[/youtube]
LOL this cracks me up.
-
(http://obczaj.net/obrazki/144123.jpg)
(http://obczaj.net/obrazki/144130.jpg)
(http://obczaj.net/obrazki/144160.jpg)
(http://obczaj.net/obrazki/144163.jpg)
(http://obczaj.net/obrazki/144164.jpg)
-
I had a random moment and typed in "ali jizz"(ali G mocking) on youtube, 3rd video down was this, had to click it because of the thumbnail, then found the original which is what I posted here ;D
-
(http://obczaj.net/obrazki/144130.jpg)
' >:(
-
(http://obczaj.net/obrazki/144163.jpg)
Now i know why Hitler was alive for so long :L
ontopic:
[youtube]http://www.youtube.com/watch?v=Czxi4Y5z6a8[/youtube]
-
(http://chzmemebase.files.wordpress.com/2011/05/memes-untitled13.jpg)
-
Fail Complications
http://www.youtube.com/watch?v=t5c_MYLDV-w
-
^ Brilliant.
-
Hahah great well here's March:
[youtube]http://www.youtube.com/watch?v=nwVUSM5HHcg[/youtube]
-
(http://i.imgur.com/Kqla9.jpg)
(http://images.cheezburger.com/completestore/2011/4/19/5bbd653c-f5dd-4a4b-b1f2-358ee764d33a.jpg)
-
Haha at finalcut. :L
-
Epoxi song for you lol
[youtube]http://www.youtube.com/watch?v=yvSYJnEYr1E[/youtube]
you only know the italian and boots lol :L :L
-
[youtube]yVkdfJ9PkRQ[/youtube]
-
[youtube]http://www.youtube.com/watch?v=nGeKSiCQkPw&feature=aso[/youtube]
-
[youtube]http://www.youtube.com/watch?v=nGeKSiCQkPw&feature=aso[/youtube]
y u post so old videos
-
[youtube]http://www.youtube.com/watch?v=xLmBiBGOPJs&feature=fvwrel[/youtube]
lmao
-
^lol scorpion. :L
(http://i.imgur.com/NLLKc.jpg)
-
Portal 2 cube throwing
[youtube]oNH0s_Dv38Q[/youtube]
-
^ Insane lol
-
The ones at the end were amaaazing.
-
^lol scorpion. :L
^^
-
(http://i.imgur.com/NLLKc.jpg)
(http://i1044.photobucket.com/albums/b444/marcuz86/foto.png)
-
Wow, nice debunking ivanduk, I had no idea. :L
(http://i54.tinypic.com/im5umw.jpg)
-
lmao :L
-
[youtube]http://www.youtube.com/watch?v=TdS9ZJ_Wf4k[/youtube]
[youtube]http://www.youtube.com/watch?v=ocVNK7la4Uc[/youtube]
-
Portal 2 cube throwing
[youtube]oNH0s_Dv38Q[/youtube]
holy shit
-
(http://i.imgur.com/zkI9w.png)
-
lol'd
-
holy shit
The last one is simply amazing.
-
(http://i.imgur.com/zkI9w.png)
(http://i.imgur.com/UNp8L.png)
-
[youtube]http://www.youtube.com/watch?v=xLmBiBGOPJs&feature=fvwrel[/youtube]
lmao
:L
-
(http://i.imgur.com/nsSsw.jpg)
-
no shit? :L
-
(http://i.imgur.com/nsSsw.jpg)
panaotizzz is such an ass lol
-
ARHAHRGHARHARGH I was about to post that forever alone thing lol.
-
(http://i.imgur.com/kFdNO.png)
-
bb streak
-
look sig. Pic says its 3 ;)
-
your time will come ;_;
-
wow! 3 win streak. I can't even accomplish a 2 win streak because I timeout every 30 seconds :L / :(
anyway...
I went into here: NSFW http://www.lememe.com
It has a big load of pics/videos/memes to waste time and laugh at for (quite) a while.
WARNING! Lots of images and stuff, some of them even NSFW so I guess I'll add note to the line above right now.
-
haha what a cool website :L
crazy pictures lol
-
I went into here: http://www.lememe.com
That layout reminds me of Yvette's Wedding Dresses Panama City.
http://yvettesbridalformal.com/
Yvette's Location right in the Center
of Beautiful Panama City on
Highway 98 !! ~*
Yvette's Address:
Lincoln Center Plaza
237C West 15th Street(Hwy 98)
Panama City, Florida 32401 ~*
~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*
please call (850)~871~3000 !! ~*~*~*~*~*~*~*
Yvette's Thanks YOU! for being
with us !! ~*~*~*~*~*~*~*~*~*~*~*
YOU! are the reason we are here !! ~*
~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*~*
(http://www.yvettesbridalformal.com/sitebuilder/images/VetteMap3-934x663.png)
-
(http://i.imgur.com/Vow32.jpg)
-
^
lmao
-
Not funny, just very, very cool:
[youtube]http://www.youtube.com/watch?v=lB2qsj4Tzm0[/youtube]
[youtube]http://www.youtube.com/watch?v=hgILyWh1lEY[/youtube]
1st video from Arabia, 2nd from China (Hong Kong). More Chinese videos here http://uk.jalopnik.com/5802636/chinese-street-racing-is-the-closest-youll-get-to-a-real+life-video-game/gallery/
-
/ban id Reason: cheaters speedboost :L
but isn't funny :/
-
Not funny, just very, very cool
-
(http://i.imgur.com/wyJs9.jpg)
even the captcha wants tma
-
(http://i.imgur.com/wyJs9.jpg)
even the captcha wants tma
:L
-
http://www.youtube.com/watch?v=V0sM0AbldMU
-
Amazing horse FTW!! :L :D :L
-
[youtube]http://www.youtube.com/watch?v=nFz_BGqSeyc[/youtube]
-
lol wtf
-
madmax was driving that after getting bored of desert_bus
-
LMAO!
[youtube]http://www.youtube.com/watch?v=wDygJR56Ct8[/youtube]
-
Crazy russians :L
-
Wish i had one like this, the Tv i mean haha :P
http://www.youtube.com/watch?v=2scUBbLjKF4&feature=player_embedded
-
what a cock tease lol
-
(http://i.imgur.com/qmz0V.jpg)
-
hahahahahahaha so true though
-
LMAO!
[youtube]http://www.youtube.com/watch?v=wDygJR56Ct8[/youtube]
Fake. Look at the box, it has been put on afterwards. Look at the way the bloke at the top holds it too.
-
http://www.youtube.com/watch?v=j0g_DSvelgc&feature=player_detailpage
-
omg is it ok
-
:L oh god I can't stop laughing on that one, poor baby xD
-
(http://i.imgur.com/ctN4y.jpg)
(http://i.imgur.com/nsd63.jpg)
(http://i.imgur.com/f2rOE.jpg)
-
wtf haha :L
-
:L
-
[youtube]8grzRgQ_AWY[/youtube]
-
(http://img696.imageshack.us/img696/9637/dsc00084kl.jpg) (http://imageshack.us/photo/my-images/696/dsc00084kl.jpg/)
-
^ lolol :L
-
[youtube]gG1ex0AAU5c[/youtube]
-
[youtube]http://www.youtube.com/watch?v=G0NRnWjHfWg[/youtube]
-
Shuffling Zombies + lol @ jesus.
[youtube]KQ6zr6kCPj8[/youtube]
Original footage video Simon + Ironman and eir frenz
[youtube]QuQIwHSbmC4[/youtube]
-
lol you ¬¬
-
^Max, what car is in the video above (el mejor video de internet)? Subaru Leone?
(http://www.randompics.net/wp-content/main/2011_02/vHcWv.jpg)
This picture is funny but makes me sad. :(
-
2 hours
.....ago?
-
2 hours
.....ago?
That's what I thought too.
-
http://www.facebook.com/l.php?u=http%3A%2F%2Fbit.ly%2FlBkKdF&h=af1fc
[/size][/font] :D O0 :L
-
http://www.facebook.com/l.php?u=http%3A%2F%2Fbit.ly%2FlBkKdF&h=af1fc
[/size][/font] :D O0 :L
nice
-
(http://i.imgur.com/qJYJS.png)
-
http://www.facebook.com/l.php?u=http%3A%2F%2Fbit.ly%2FkpeRI2&h=6ffa8
-
Finnex, can't you just post the link, rather than the facebook bastardised version?
-
(http://i.imgur.com/qJYJS.png)
:L :L
-
[youtube]http://www.youtube.com/watch?v=zc0s358b3Ys&feature=topvideos_entertainment[/youtube]
-
haha :L
-
Ha ha, that Doomsday tune is ace.
How about this:
[youtube]mSvJwUFI_es[/youtube]
-
haha
-
(http://cdn1.diggstatic.com/story/my_trip_to_ireland_pic/o.png)
-
:L
-
lol
-
Haha nice.
(http://www.shrani.si/f/V/8D/3HZlNRJB/797292115.gif)
http://www.youtube.com/watch?v=xxj81deO1Z0
-
haha that's so cool
-
(http://i.imgur.com/2YgmE.jpg)
-
for madmax ahahah
[youtube]http://www.youtube.com/watch?v=4EGq_yKp2-A&feature=player_embedded[/youtube]
just NOOOOOOOOOOOB
:L :L
-
I watched that live, great finish.
-
you were at Indy 500?
-
No, I watched it on TV.
-
you were at Indy 500?
i was
-
(http://obczaj.net/obrazki/145598.jpg)
(http://obczaj.net/obrazki/145603.jpg)
(http://obczaj.net/obrazki/145469.jpg)
-
[youtube]http://www.youtube.com/watch?v=CD2LRROpph0&NR=1&feature=fvwp[/youtube]
-
HEY THERE'S MY FRIENDS!
-
Adding comments has been disabled for this video. :'(
-
lol @ the dislikes
-
lol I loved arguing with people on auto update comments :L
-
i wouldn't put it past you
-
(http://i.imgur.com/DNmCi.png)
-
Haha :L
-
[youtube]http://www.youtube.com/watch?v=JfGOlEizUUs[/youtube]
-
:L wish my dog would do that
-
Cucumber Killer
[youtube]http://www.youtube.com/watch?v=9bIKLSV7xCI[/youtube]
-
(http://media.moronail.net/images/stories/dg_pictures/1105/245A6855015C-1.jpg)
(http://media.moronail.net/images/stories/dg_pictures/1012/F1D024B8E49D-1.jpg)
(http://media.moronail.net/images/stories/dg_pictures/1104/4BCE985C0297-1.jpg)
(http://media.moronail.net/images/stories/dg_pictures/1105/6FC79A4394A7-1.jpg)
(http://media.moronail.net/images/stories/dg_pictures/1105/C58ACE196EC6-1.jpg)
(http://media.moronail.net/images/stories/dg_pictures/1105/E5CE65B8CCB6-1.jpg)
(http://media.moronail.net/images/stories/dg_pictures/1105/2EAD5D1DF131-1.jpg)
(http://media.moronail.net/images/stories/dg_pictures/1105/655EC75D9771-1.jpg)
-
(http://i.imgur.com/oXZab.jpg)
-
(http://files.sharenator.com/BLMZr_FFFFFUUUUUUUUU-s580x2284-25155-580.png)
-
[youtube]http://www.youtube.com/watch?v=RuGXhhqc0Xk&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=UVOpE37VQ6o[/youtube]
[youtube]http://www.youtube.com/watch?v=zrzF3SJBkpI[/youtube]
[youtube]http://www.youtube.com/watch?v=pJmiGmGyInc&feature=related[/youtube]
(http://26.media.tumblr.com/tumblr_ljty4xpBne1qgk751o1_500.jpg)
(http://30.media.tumblr.com/tumblr_lkhkbjRI5W1qha09qo1_500.png)
(http://24.media.tumblr.com/tumblr_lll5fuBNd51qax0imo1_500.jpg)
(http://28.media.tumblr.com/tumblr_lf6wt07CWu1qeo4wpo1_500.jpg)
-
[youtube]http://www.youtube.com/watch?v=UPImlZ7ML3Y[/youtube]
-
I love Jersey Shore, and this is such a good game lolz
-
[youtube]http://www.youtube.com/watch?v=iheOMq8UkN4&feature=channel_video_title[/youtube]
-
^ haha that one was on raywilliamjohnson's video too ;D
-
Nice drifting Baron lol.
(http://i.imgur.com/EmRpP.jpg)
(http://t.naurunappula.com/screen/0596/0596723.png)
-
lol probably NSFW: http://i.imgur.com/bQnWA.jpg
-
lol probably NSFW: http://i.imgur.com/bQnWA.jpg
Baby hands = NSFW?
-
wouldn't want someone to only have the first picture on their screen and get fired lol. i saw people moaning about it on the website i got it from
-
it looks strange anyway, why would someone do this with baby's hand? :L
-
my guess is it had cake on it
-
(http://img263.imageshack.us/img263/9514/fp12.jpg)
-
[youtube]http://www.youtube.com/watch?v=zc0s358b3Ys[/youtube]
Best parody :L
-
[youtube]http://www.youtube.com/watch?v=zc0s358b3Ys&feature=topvideos_entertainment[/youtube]
already been done, driver :P
-
Don't know if this should be marked as NSFW but it's damn funny :L
[youtube]http://www.youtube.com/watch?v=bZOIFng7ic8[/youtube]
-
lol kid at end is like: wtf is this? :L
-
(http://i40.tinypic.com/bzpn6.jpg)
-
.___________________________________________________________________________________________________.""
-
.___________________________________________________________________________________________________.""
...?
-
(http://i40.tinypic.com/bzpn6.jpg)
:L :L :L
-
[youtube]ambm6D3H7rI&feature=related[/youtube]
[youtube]un3f6orOGPo&feature=related[/youtube]
[youtube]tcg3OmdwC0o&feature=related[/youtube]
-
What on Earth did I just watch? ???
-
nice ava epoxi
-
.___________________________________________________________________________________________________.""
...?
did not make me laugh at the image ::)
-
ok...
-
nice ava epoxi
Thanks bro.
http://niketalk.yuku.com/topic/263856#.Te3NKluO62A
http://boards.ign.com/teh_vestibule/b5296/188475119/p1/
http://boards.ign.com/teh_vestibule/b5296/194425888/r196896861/
Just Google "jersey shore gifs" for teh lulz.
(http://www.fohguild.org/forums/attachments/millies-tv-house/148980d1282374620-jersey-shore-season-2-mia-bitches-ronniedrunk.gif)
(http://24.media.tumblr.com/tumblr_lisuen1EMY1qbjokwo1_500.gif)
-
[youtube]http://www.youtube.com/watch?v=OitBl-QC5vY[/youtube]
-
Don't know if this has already been posted before but still, pretty awesome video :) (watch in 720p)
[youtube]http://www.youtube.com/watch?v=Rpvaicl_9PQ&hd=1[/youtube]
-
ahahahahah :L very cooollll
-
[youtube]xjKKyczTPCc[/youtube]
(http://28.media.tumblr.com/tumblr_l0knjpjVRQ1qbylvso1_500.jpg)
(http://26.media.tumblr.com/tumblr_kw7tphtLaE1qa09ulo1_400.gif)
(http://images4.wikia.nocookie.net/inciclopedia/images/0/08/ChuckApproves.gif)
-
Don't know if this has already been posted before but still, pretty awesome video :) (watch in 720p)
[youtube]http://www.youtube.com/watch?v=Rpvaicl_9PQ&hd=1[/youtube]
haha that reminds me of the unlockable video in Syphon Filter 2 with all the game characters dancing at the disco.
[youtube]http://www.youtube.com/watch?v=q6rZ7vs0IEo[/youtube]
I love that game.
-
for mooman
[youtube]1aodpb3vFU0[/youtube]
[youtube]qBjLW5_dGAM[/youtube]
[youtube]Ovvk7T8QUIU[/youtube]
[youtube]_5IqwECL6bo[/youtube]
-
I was looking for some online flowchart maker; found one and this is the premade example :L
(http://www.gliffy.com/pubdoc/2736964/L.png)
:L :L :L lol'd so much.
-
(http://i.imgur.com/jQFWc.jpg)
(http://i398.photobucket.com/albums/pp63/mrcarson2/advice-1.jpg)
-
haha, epic :L
-
[youtube]http://www.youtube.com/watch?v=dsU3B0W3TMs&feature=player_embedded[/youtube]
-
(http://i.imgur.com/YTmp0.png)
http://www.europeanhitradio.com/topi/Top10
-
[youtube]http://www.youtube.com/watch?v=Cl5Pfc5TyO0[/youtube]
-
Might have already been posted:
[youtube]QNKqJiMfkUs[/youtube]
Apple juice!
-
(http://img232.imageshack.us/img232/9355/137966700b1307644041.jpg)
-
I always estimate the toaster lol, and when the kettle goes click. When you get it right you feel like a fucking legend O0 O0
-
http://i.imgur.com/jQFWc.jpg
lol i wouldn't have bothered with the scissors. biting + cutting takes more time than just biting :L although i guess if you need scissors in the future, it'd mean less biting to do it as soon as possible..
-
[youtube]http://www.youtube.com/watch?v=Cl5Pfc5TyO0[/youtube]
-
loool someone wants a comment :P
I can imitate that sound the cat is making :L
-
(http://9gag.com/gag/137129/)
-
(http://img857.imageshack.us/img857/4486/tensom.jpg)
-
:L
-
lol
-
took me a while to figure out what you were zooming in on :L
-
same lol
-
(http://24.media.tumblr.com/tumblr_l3ctuwiOju1qc6wbvo1_500.jpg)
(http://img803.imageshack.us/img803/9599/fart.jpg)
(http://3.bp.blogspot.com/_n8BRadUCK8g/SlpSBoTYnCI/AAAAAAAAAhE/xMfrsvy5RL0/s400/12426090.jpg)
(http://2.bp.blogspot.com/_l1WyqtcRhYE/Szbc-7Y28QI/AAAAAAAABXc/DmJCZFvZf80/s400/fuuu-ronaldo.jpg)
(http://knowyourmeme.com/i/5898/original/mess_with_original_rage.JPG?1248289167)
-
(http://i.imgur.com/eyahQ.jpg)
-
hahaha :L
-
(http://i.imgur.com/eyahQ.jpg)
(http://i.imgur.com/833EI.jpg)(http://i.imgur.com/833EI.jpg)
:D one for you one for me :D
-
(http://d3uwin5q170wpc.cloudfront.net/photo/137129_700b_v1.jpg)
-
[youtube]http://www.youtube.com/watch?v=2HTVHSTC6ZQ&feature=related[/youtube]
-
(http://i.imgur.com/eyahQ.jpg)
(http://i.imgur.com/833EI.jpg)(http://i.imgur.com/833EI.jpg)
:D one for you one for me :D
without milk it isn't so good
-
(http://obczaj.net/obrazki/146783.jpg)
(http://obczaj.net/obrazki/146784.jpg)
-
(http://img691.imageshack.us/img691/297/tumblrlmbz76urps1qf087q.png) (http://imageshack.us/photo/my-images/691/tumblrlmbz76urps1qf087q.png/)
-
(http://chzragecomics.files.wordpress.com/2011/06/rage-comics-theyre-like-water-lazers-pew-pew-pew-pew.jpg)
(http://chzragecomics.files.wordpress.com/2011/06/rage-comics-untitled5.jpg)
(http://chzragecomics.files.wordpress.com/2011/06/rage-comics-ill-never-grow-up.jpg)
(http://chzragecomics.files.wordpress.com/2011/06/rage-comics-ill-be-back.jpg)
-
:L look at the guy in black:
[youtube]http://www.youtube.com/watch?v=4MhrExzbkDM&feature=aso[/youtube]
-
[youtube]http://www.youtube.com/watch?v=LW7eNYnpZ4w[/youtube]
LOL 0:23
-
bad weekend for marshals
-
http://rapdose.com/2011/06/14/eminem-royce-da-59-answer-fans-questions-live-stream-recording
-
(http://i.imgur.com/hoYLs.png)
(http://i.imgur.com/pREqr.gif)
(http://i.imgur.com/21nlY.jpg)
-
:L
-
haha, the last one is epic :L
-
(http://i.imgur.com/uJ1bL.png)
-
[youtube]http://www.youtube.com/watch?v=KwJsEuImMy4[/youtube]
guy from above ended like luke perry...........
(http://mmmsimpsons.tumblr.com/photo/1280/3710356576/1/tumblr_lh9ab5zdtl1qhqqmt)
[youtube]http://www.youtube.com/watch?v=ZwqN_nT9beA[/youtube]
_______________________________________________________________
btw, why this thread has now 450+ pages? ???
we were at page 302 or 303 more or less... did someone merge it with another thread?
-
(http://i.imgur.com/uJ1bL.png)
YESSS
-
104 now :D
-
http://www.youtube.com/watch?v=iibfx_ogb6k
Snake knows what is good.
-
(http://chzragecomics.files.wordpress.com/2011/06/rage-comics-a-real-education.jpg)
-
(http://obczaj.net/obrazki/146982.jpg)
(http://obczaj.net/obrazki/147009.jpg)
-
(http://obczaj.net/obrazki/146982.jpg)
is Inler player of Udinese Soccer ,S.S.C Naples interested in buying the player :L
-
[youtube]http://www.youtube.com/watch?v=xIlRdKQFDlk[/youtube]
[youtube]http://www.youtube.com/watch?v=PcV4LVhSRLg[/youtube]
-
[youtube]http://www.youtube.com/watch?v=E0fNKKYSO84&feature=feedu[/youtube]
-
^ check this
http://forum.adrenalinex.co.uk/index.php/topic,3329.0.html
-
Maybe this is not funny , but i post this for Max :D
http://www.motika.com.mk/index.php?option=com_content&view=article&id=24973:-mad-max&catid=8:2011-03-26-19-23-19&Itemid=23
Kamion Mad Max = Truck Mad Max ;)
-
(http://i187.photobucket.com/albums/x89/edwardbayntun/gifs/Jean-Claude-Van-Damme-Plays-Counter.gif)
-
[youtube]http://www.youtube.com/watch?v=u2msR5g817Y[/youtube]
-
:L :L :L i almost skipped watching it once i saw how long it was but then i couldn't stop laughing lol
-
(http://i.imgur.com/M2dE9.jpg)
-
lol :L
EDIT: finally watched it, it's epic :L
[youtube]http://www.youtube.com/watch?v=u2msR5g817Y[/youtube]
-
:L
-
[youtube]http://www.youtube.com/watch?v=t4AxP__oy1I&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?v=t4AxP__oy1I&feature=related[\youtube]
fail :L
and nice video, he's good lol
-
:\
:/
???
i've corrected it in the second and it was enough to be caught :D
-
I catch everything :L
-
http://www.youtube.com/watch?v=lBpycvdcbZY (http://www.youtube.com/watch?v=lBpycvdcbZY)
-
[youtube]http://www.youtube.com/watch?v=Pkx-LGTz2BY[/youtube]
[youtube]http://www.youtube.com/watch?v=GVSifxQ3CLc[/youtube]
[youtube]http://www.youtube.com/watch?v=GHy1E7SkGgU[/youtube]
[youtube]http://www.youtube.com/watch?v=YwdlXZzZpRM[/youtube] this dog ftw :L
-
There's a new one lol.
[youtube]http://www.youtube.com/watch?v=QWgnBjgDLKw[/youtube]
-
Chillin around ..
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-snc6/199754_1765979863624_1062982658_31742246_7023284_n.jpg)
-
There's a new one lol.
[youtube]http://www.youtube.com/watch?v=QWgnBjgDLKw[/youtube]
oh god i couldn't breathe i was laughing too hard lol
more! http://www.blogtalkradio.com/ghost
-
this is good, what you would do losing that 'tail' ???
[youtube]http://www.youtube.com/watch?v=-Xw5zhcFIOU&feature=player_embedded[/youtube]
-
There's a new one lol.
[youtube]http://www.youtube.com/watch?v=QWgnBjgDLKw[/youtube]
oh god i couldn't breathe i was laughing too hard lol
more! http://www.blogtalkradio.com/ghost
:L :L
-
this is good, what you would do losing that 'tail' ???
[youtube]http://www.youtube.com/watch?v=-Xw5zhcFIOU&feature=player_embedded[/youtube]
lool :L
-
Lady Gaga Parody :L :L
http://www.motika.com.mk/index.php?option=com_content&view=article&id=25109:2011-06-22-07-01-10&catid=8:2011-03-26-19-23-19&Itemid=23
-
Max, that video just makes me sad. :(
Poor BMW. Lol at when he says "OH KURWA" though. :L
-
LOOOOOOL TopGear on facebook posted this:
http://www.topgear.com/uk/car-news/dragster-fail-2011-06-21
-
lol
-
(http://obczaj.net/obrazki/147382.jpg)
-
:L
-
lol @ last one :L
-
this is good, what you would do losing that 'tail' ???
[youtube]http://www.youtube.com/watch?v=-Xw5zhcFIOU&feature=player_embedded[/youtube]
lool :L
oh curva in italian lol nice spelling say curva :D :D ahahaha Oh shit :D
-
slowing down?
-
Are they Italian? I thought they were Polish.
-
check out the seek bar on youtube :D
http://www.youtube.com/watch?v=QH2-TGUlwu4
-
wtf lol
-
lol :L
-
Nyan stands for "meow" in japanese :D
(http://i427.photobucket.com/albums/pp354/gazalajeff/junk/nbc_the_more_you_know.jpg?t=1242087075)
-
he stuck on the top of airport security detector when he tried to cross it and he's like raging about it for 3 mins. hilarious :L
[youtube]http://www.youtube.com/watch?v=bboG9P93HqA[/youtube]
-
lmao :L
-
http://www.joemonster.org/filmy/36204/Jak_uniknac_zderzenia_z_pociagiem_
-
[youtube]http://www.youtube.com/watch?v=eW5yWUKDMpg[/youtube]
Wait....what?
-
haha, simple merging of 2 videos
-
(http://img854.imageshack.us/img854/5294/peedreamcomic.jpg)
-
Hahaha, that's brilliant :L
-
http://www.facebook.com/video/video.php?v=153803334676300
:L :L :L :L :L
-
Hahaha, that's brilliant :L
yea :L
-
[youtube]http://www.youtube.com/watch?v=9IzHoD3sMRU&feature=player_embedded[/youtube]
-
[youtube]http://www.youtube.com/watch?v=eW5yWUKDMpg[/youtube]
Wait....what?
i should try that
-
I have seen some ugly ass dogs in my time but these.....
[youtube]http://www.youtube.com/watch?v=BdgWGI5XSF4[/youtube]
now a clever one
[youtube]http://www.youtube.com/watch?v=XdyzBIS9LXk[/youtube]
-
1st video, at 1:40 you can see text 'SONOMA' is that show close to Infineon Raceway?
-
well it says its in northern California so it might be close
EDIT:
ah ye it is actually in the same county.
-
(http://obczaj.net/obrazki/147651.jpg)
http://obczaj.net/obrazki/147654.jpg
(http://obczaj.net/obrazki/147655.jpg)
(http://obczaj.net/obrazki/147656.jpg)
(http://obczaj.net/obrazki/147657.jpg)
(http://obczaj.net/obrazki/147664.jpg)
(http://obczaj.net/obrazki/147677.jpg)
(http://obczaj.net/obrazki/147615.jpg)
(http://obczaj.net/obrazki/147621.jpg)
-
(http://obczaj.net/obrazki/147615.jpg)
haha, it took me some time to realize it's the spider :L
(http://www.toonpool.com/user/309/files/penis_enlargement_27515.jpg)
-
roads, roads, roads...
(http://obczaj.net/obrazki/147682.jpg)
(http://obczaj.net/obrazki/147684.jpg)
(http://obczaj.net/obrazki/147685.jpg)
-
(http://obczaj.net/obrazki/147684.jpg)
that one's good lol
-
[youtube]http://www.youtube.com/watch?v=MF0kKIyTmEA[/youtube]
-
omg :o
-
dunno if this is already on here but LOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOL!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
(http://www.omgsite.com/wp-content/uploads/2010/09/omg-it-spins.jpg)
-
Phobos tell me pls if its rly in czech k?
[youtube]http://www.youtube.com/watch?v=DySsm1AKFaQ&feature=related[/youtube]
-
yeah lol, never seen it though :L
-
lool, many words mean in polish funny things:
0.07 - This bread is not our
0.08 - my anal
0.19 - bitches sucks in sunday
-
:L
-
(http://img180.imageshack.us/img180/7235/elwia.jpg)
-
(http://failfun.com/wp-content/uploads/lambo-doors-funny-pictures.jpg)
-
Snatch Wars!
[youtube]kDKiQfBs9lo[/youtube]
-
Biscuit Bass!
[youtube]IfeyUGZt8nk[/youtube]
-
(http://8.asset.soup.io/asset/2089/5768_1898.jpeg)
-
lol :L
-
Oh my god, these are epic. Capitalism obsession :L
[youtube]http://www.youtube.com/watch?v=Td280rG5b70&feature=relmfu[/youtube]
[youtube]http://www.youtube.com/watch?v=3Dvsc-HB3B4&feature=relmfu[/youtube]
-
:L
[youtube]http://www.youtube.com/watch?v=AVZ1CQVMSNo[/youtube]
-
:L
-
lol :L
-
[youtube]http://www.youtube.com/watch?v=_h1euQKJsr4&feature=related[/youtube]
-
(http://8.asset.soup.io/asset/2089/5768_1898.jpeg)
LOL still can't stop laugh
-
(http://img.izismile.com/img/img3/20101206/1000/new_funny_gif_08.gif)
(http://img.izismile.com/img/img3/20101206/1000/new_funny_gif_34.gif)
(http://img.izismile.com/img/img3/20101126/1000/friday_gif_collection_10.gif)
(http://img.izismile.com/img/img3/20101102/1000/gif_selection_17.gif)
(http://img.izismile.com/img/img3/20100928/1000/funny_gif_collection_19.gif)
(http://img.izismile.com/img/img3/20100928/1000/funny_gif_collection_33.gif)
-
(http://img.izismile.com/img/img3/20101102/1000/gif_selection_17.gif)
rofl that's awesome
(http://img.izismile.com/img/img3/20100928/1000/funny_gif_collection_33.gif)
:L :L :L
-
(http://i.imgur.com/BVEkx.jpg)
-
:L :L :L :L :L
-
nice pic's
-
haha great :L
-
(http://i.imgur.com/UtWuF.gif)
-
(http://i.imgur.com/UtWuF.gif)
awesome :L
-
(http://i54.tinypic.com/687xac.png)
-
mooman: ruining your ability to tell whose post it is by glancing at the avatar since 2010
-
:L
-
O0
[Youtube]http://www.youtube.com/watch?v=4UCZF_UnG10[/Youtube]
-
And you don't even need a car to drive it around. Cool. Gonna get one definetly in the future. Btw, nice wheelie. O0
-
(http://obczaj.net/obrazki/147838.jpg)
(http://i70.photobucket.com/albums/i101/Piter997/extreme.jpg)
(http://i1.kwejk.pl/site_media/obrazki/192e16c74e537d6544d8d48ef2430a2a.jpg?1309518004)
-
(http://i.imgur.com/wEUCG.jpg)
-
(http://i.imgur.com/wEUCG.jpg)
(http://img196.imageshack.us/img196/7848/patrioticdog.jpg) (http://imageshack.us/photo/my-images/196/patrioticdog.jpg/)
:L
-
haha
-
Male to Female Ratio:21:1
-
[youtube]http://www.youtube.com/watch?v=Pz-YC0D3CNk&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=2naoSiNRQ1w[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=Pz-YC0D3CNk[/youtube]
[youtube]http://www.youtube.com/watch?feature=2naoSiNRQ1w[/youtube]
nice
-
:L
-
Male to Female Ratio:21:1
sounds like ush's kind of party!
-
[youtube]http://www.youtube.com/watch?v=Z2LR0TdoEUA[/youtube]
-
How can I take a kurwa?
You need some kurwa
:L :L :L
-
read
(http://obczaj.net/obrazki/148015.jpg)
(http://obczaj.net/obrazki/148021.jpg)
-
rofl
[offtopic] You know where chiquita bananas come from right?[/offtopic]
-
[youtube]http://www.youtube.com/watch?v=pUgiRxs3aqo[/youtube]
-
haha, idiots :L
-
lmao nice firework only what a fail :L
-
Haha, i must try to do it in my town haha. BTW poor cars :/
-
lol
-
[youtube]pT9YI3hAkCY[/youtube]
-
[youtube]4pXfHLUlZf4[/youtube]
-
(http://i.imgur.com/hnHpD.jpg)
(http://i.imgur.com/X5yGM.jpg)
(http://i.imgur.com/X7Vmk.jpg)
(http://i.imgur.com/4RBQ2.jpg)
-
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-ash4/230726_10150189878559607_700764606_7101378_1284926_n.jpg)
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-snc6/248376_10150189878604607_700764606_7101379_3032496_n.jpg)
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-snc6/231151_10150189879144607_700764606_7101394_5367964_n.jpg)
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-snc6/250096_10150189880339607_700764606_7101435_2903753_n.jpg)
-
nice
-
[youtube]http://www.youtube.com/watch?v=ZaOVNqA7lBA[/youtube]
[youtube]http://www.youtube.com/watch?v=0flZC4YLhbc&feature=relmfu[/youtube]
-
^ lol @ first video
(http://img171.imageshack.us/img171/4615/ragecomicstheskinnygirl.jpg)
________________________________________________________
(http://img163.imageshack.us/img163/552/ragecomicsillnevergrowu.jpg)
_______________________________________________________
(http://img818.imageshack.us/img818/4334/ragecomicsknowledgeyuno.jpg)
_______________________________________________________
(http://img13.imageshack.us/img13/5114/ragecomicsneveridealwea.jpg)
_______________________________________________________
(http://img5.imageshack.us/img5/4003/ragecomicsonlytwoleft.jpg)
_______________________________________________________
(http://img402.imageshack.us/img402/3278/ragecomicssmileyface.jpg)
_______________________________________________________
(http://img231.imageshack.us/img231/2596/ragecomicswhyunotalkmor.jpg)
-
ftw ^ :L
-
(http://obczaj.net/obrazki/148159.jpg)
NSFW??: http://obczaj.net/obrazki/148166.jpg
epic comic
(http://obczaj.net/obrazki/148170.jpg)
-
[youtube]http://www.youtube.com/watch?v=ZaOVNqA7lBA[/youtube]
[youtube]http://www.youtube.com/watch?v=0flZC4YLhbc&feature=relmfu[/youtube]
lol'd hard at the first one :L
-
nice comic max :L
-
(http://i295.photobucket.com/albums/mm125/ericbeer/lost_puppy.png)
-
(http://i295.photobucket.com/albums/mm125/ericbeer/lost_puppy.png)
:L :L :L
-
[youtube]http://www.youtube.com/watch?v=hO46UsXB-1s[/youtube]
[youtube]http://www.youtube.com/watch?v=3MG8iFEjUFE&feature=player_embedded[/youtube]
-
netherlands ftw
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-snc6/270381_188674354521014_100001353538977_488683_5518756_n.jpg)
-
hah :L
-
whah NL shop 'Super de Boer' :L
-
:L
-
[youtube]http://www.youtube.com/watch?v=C1juetNAGkc&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=NnyKb-KAcQ0&feature=player_embedded#at=192[/youtube]
^ 3:12
[youtube]http://www.youtube.com/watch?v=QocTNdMSAww&feature=player_embedded[/youtube]
-
I can't stop laugh... Watch all videos from this shit. They are crazy and it drills your brain utbut whatever...
[youtube]http://www.youtube.com/watch?v=D7lvBbccliM&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=RPClAUGj4S4&feature=player_embedded[/youtube]
#EDIT: Ooops double post
-
(http://www.thebookoffreak.com/wp-content/uploads/2010/10/pedo-bear.gif)
-
[youtube]http://www.youtube.com/watch?v=bOKvHj-hL-U[/youtube]
skandal?! stupid germans...
-
sweden ftw
-
I can't stop laugh... Watch all videos from this shit. They are crazy and it drills your brain utbut whatever...
[youtube]http://www.youtube.com/watch?v=D7lvBbccliM&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=RPClAUGj4S4&feature=player_embedded[/youtube]
First video is awesome :L
Important thing is that Japan won :laugh:
-
(http://i.imgur.com/eof7Z.jpg)
-
[youtube]http://www.youtube.com/watch?v=GHBN7qpdP7M&feature=feedu[/youtube]
-
[youtube]http://www.youtube.com/watch?v=GHBN7qpdP7M&feature=feedu[/youtube]
hahahaha :L
-
:L :L
-
[youtube]http://www.youtube.com/watch?v=nRsaExGcx5A[/youtube]
[youtube]http://www.youtube.com/watch?v=S-fVB-eHGVI[/youtube]
[youtube]http://www.youtube.com/watch?v=cyyG1hIEyN4[/youtube]
-
lol
-
[youtube]http://www.youtube.com/watch?v=nRsaExGcx5A[/youtube]
:L :L
-
(http://artoftrolling.files.wordpress.com/2011/07/chatroulette-trolling-it-actually-tastes-like-salt.jpg)
-
lmao :L :L :L
-
LOL
[youtube]http://www.youtube.com/watch?v=KeWsk_vPyKY[/youtube]
-
[youtube]I8kI46zMl-A&feature=player_embedded[/youtube]
-
aahahhaha :L :L :L
-
[youtube]http://www.youtube.com/watch?v=2MsEaRbVuzs[/youtube]
the newspaper technique really works hehe
-
tried it?
-
LOL
[youtube]http://www.youtube.com/watch?v=KeWsk_vPyKY[/youtube]
[youtube]http://www.youtube.com/watch?v=jH6P9SXsS_8[/youtube]
-
(http://obczaj.net/obrazki/148452.jpg)
(http://fatkidatcamp.com/wp-content/uploads/2011/07/how-to-kill-a-walrus.jpg)
(http://obczaj.net/obrazki/148472.jpg)
(http://obczaj.net/obrazki/148438.jpg)
(http://obczaj.net/obrazki/148490.jpg)
this is usefull if you wanna understand polish 'pierdolic' phrases
(http://obczaj.net/obrazki/148474.jpg)
-
(http://fatkidatcamp.com/wp-content/uploads/2011/07/how-to-kill-a-walrus.jpg)
haha, nice one
(http://assets.shitbrix.com/hashed_silo_content/silo_content/1927/resized/thelight.jpg)
-
lol i wonder if that's real or edited in PS
-
(http://i.imgur.com/TjP4D.jpg)
-
[youtube]http://www.youtube.com/watch?v=z2BgjH_CtIA[/youtube]
-
[youtube]http://www.youtube.com/watch?v=IkTw7J-hGmg[/youtube]
-
haha I've seen that one before, still makes me laugh
wtf at this:
[youtube]http://www.youtube.com/watch?v=IX0MyTbj2KA[/youtube]
-
wtf lol
-
[youtube]http://www.youtube.com/watch?v=IkTw7J-hGmg[/youtube]
lol, he aint stopping for nothing :L
-
[youtube]http://www.youtube.com/watch?v=uXjTDZwU8b0&feature=player_embedded[/youtube]
-
the guy is gay btw (the driver)
-
There are all 9 parts on youtube. If you liked the first one, you must watch the rest! Let the laugh out.
[youtube]http://www.youtube.com/watch?v=pd2IoHbjvTk[/youtube]
-
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-snc6/254579_230534480291452_133455056666062_1034657_5211053_n.jpg)
(http://a2.sphotos.ak.fbcdn.net/hphotos-ak-ash4/264659_230534510291449_133455056666062_1034659_6352621_n.jpg)
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc6/264009_230534566958110_133455056666062_1034662_2904541_n.jpg)
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-snc6/246904_230534600291440_133455056666062_1034664_1543718_n.jpg)
(http://a2.sphotos.ak.fbcdn.net/hphotos-ak-snc6/263949_230534613624772_133455056666062_1034665_3918679_n.jpg)
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-snc6/253974_230534636958103_133455056666062_1034666_2109685_n.jpg)
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-ash4/261594_230534656958101_133455056666062_1034667_3715747_n.jpg)
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-ash4/263329_230534706958096_133455056666062_1034670_6655133_n.jpg)
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-snc6/253789_230534790291421_133455056666062_1034673_8075991_n.jpg)
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-snc6/262394_230534806958086_133455056666062_1034674_2244936_n.jpg)
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc6/264404_230534846958082_133455056666062_1034676_4916917_n.jpg)
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-snc6/264049_230534866958080_133455056666062_1034677_7272078_n.jpg)
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-ash4/263754_230534920291408_133455056666062_1034680_8060794_n.jpg)
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-ash4/263979_230534946958072_133455056666062_1034681_5882527_n.jpg)
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc6/263649_230534973624736_133455056666062_1034683_3883183_n.jpg)
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-snc6/261799_230535130291387_133455056666062_1034691_6229191_n.jpg)
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc6/259874_230535393624694_133455056666062_1034706_8112526_n.jpg)
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-snc6/255034_230535726957994_133455056666062_1034726_2752313_n.jpg)
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-ash4/247199_230535930291307_133455056666062_1034738_8324935_n.jpg)
-
nice
-
haha great!
-
Awesome pics scorp :L :L :L
-
Lol Scorpion. I like the bus video too.
-
(http://obczaj.net/obrazki/148495.jpg)
(http://obczaj.net/obrazki/148529.jpg)
-
(http://obczaj.net/obrazki/148495.jpg)
funny? depressing more like :(
-
(http://obczaj.net/obrazki/148529.jpg)
:L wtf are you doing there runty
-
[youtube]http://www.youtube.com/watch?v=q4afw0uzXpE[/youtube]
anybody remember that?
-
no :o
-
=> broken arm :'(
[youtube]http://www.youtube.com/watch?v=zlYRsE5_QR4&feature=player_embedded#at=39[/youtube]
-
The drunken guy's hardcore surviving (ouch :o :L)
[youtube]http://www.youtube.com/watch?v=J5jt3xjKqEk[/youtube]
-
=> broken arm :'(
[youtube]http://www.youtube.com/watch?v=zlYRsE5_QR4&feature=player_embedded#at=39[/youtube]
awww
-
lol
[youtube]http://www.youtube.com/watch?v=mtKNUCY_cdg[/youtube]
-
haha :L
-
[youtube]http://www.youtube.com/watch?v=Vi-rsFmGsHQ[/youtube]
-
:L
-
0.39 reminds me of vertigo wash me pic :L
-
ahaha racist xbox at end lol :L :L
-
http://tu.tv/videos/gato-splash
-
hahahah poor cat :L :L
-
i'd say stupid cat :L
-
NSFW?
http://obczaj.net/obrazki/148638.jpg
http://obczaj.net/obrazki/148640.jpg
(http://obczaj.net/obrazki/148641.jpg)
(http://obczaj.net/obrazki/148651.jpg)
cool tatoo
(http://obczaj.net/obrazki/148652.jpg)
-
i'd say stupid cat :L
agree, i don't even know where he tried to go :L
-
NSFW?
http://obczaj.net/obrazki/148640.jpg
and, umm, what's funny about that?
-
NSFW (http://bit.ly/pwm53k)
-
(http://i.imgur.com/jQgdZ.jpg)
-
Moo photo remember me this words "I love quab" <3
(http://data.whicdn.com/images/9910357/everybody-loves-quab_thumb.jpg?1305787091)
-
[youtube]http://www.youtube.com/watch?v=cvER9G2wZBo[/youtube]
-
i watched this video and i feel like after brain washing :blank:
-
oh kurwa :blank:
-
I was downloading porn and suddently...
(http://i.imgur.com/snHow.jpg)
... max you poser :'(
-
NSFW?
http://obczaj.net/obrazki/148640.jpg
and, umm, what's funny about that?
I suppose it's something to do with using "poultry scissors" and stating the obvious with "this kills the crab" ? :L
-
[youtube]http://www.youtube.com/watch?v=cvER9G2wZBo[/youtube]
wtf?
ram zam zam buri buri ram zam zam
-
(http://obczaj.net/obrazki/148661.jpg)
(http://obczaj.net/obrazki/148663.jpg)
(http://obczaj.net/obrazki/148696.jpg)
(http://obczaj.net/obrazki/148697.jpg)
(http://obczaj.net/obrazki/148698.jpg)
(http://obczaj.net/obrazki/148701.jpg)
-
(http://vader.joemonster.org/upload/zyy/2430853a102217white.jpg)
-
[youtube]http://www.youtube.com/watch?v=jdp3D484Sj4[/youtube]
[youtube]http://www.youtube.com/watch?v=Tt6aMLejKZs[/youtube]
[youtube]http://www.youtube.com/watch?v=HkHMikjCTME[/youtube]
[youtube]http://www.youtube.com/watch?v=lF1HYmqKq4g[/youtube]
[youtube]http://www.youtube.com/watch?v=MnDo-yexHTU[/youtube]
[youtube]http://www.youtube.com/watch?v=TRkNXCMY9LE[/youtube]
-
I've seen that bully one before, GG for decking him :P
-
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-ash4/283407_248656155145951_133455056666062_1091916_1737706_n.jpg)
:L :L
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-snc6/267433_248656201812613_133455056666062_1091918_3372887_n.jpg)
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-ash4/282524_248656341812599_133455056666062_1091925_5964961_n.jpg)
(http://a2.sphotos.ak.fbcdn.net/hphotos-ak-snc6/264614_248656365145930_133455056666062_1091926_1498432_n.jpg)
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-snc6/259928_238945916116975_133455056666062_1046306_8357167_n.jpg)
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-snc6/268774_238945966116970_133455056666062_1046309_4335090_n.jpg)
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-snc6/260355_243286212349612_133455056666062_1071568_7530967_n.jpg)
-
(http://community.o2online.ie/t5/image/serverpage/image-id/846i215B5A92166B22EA/image-size/original?v=mpbl-1&px=-1)
(http://www.moufies.com/wp-content/uploads/2009/10/funny-weird-photo.jpg)
(http://www.zwani.com/graphics/funny_pictures/images/funny-pictures99.jpg)
-
look what i've found... xD good memories...
[youtube]http://www.youtube.com/watch?v=z08zZ1xW9Yw[/youtube]
[youtube]http://www.youtube.com/watch?v=25TXzPuje7I[/youtube]
-
[youtube]http://www.youtube.com/watch?v=cvER9G2wZBo[/youtube]
[youtube]http://www.youtube.com/watch?v=QCC6BafOiOg&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?v=BRS3h9hbsxM[/youtube]
-
i don't get it
-
(http://i1122.photobucket.com/albums/l531/robzamora/TeacherOCcheckthisouthttpwwwfunnyjunkcomfunnypictures2360894ThreeGreatKings_6ee49e_2361521.jpg)
-
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-snc4/148664_1545876725727_1199305202_31305410_8117100_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=BRS3h9hbsxM[/youtube]
lol wtf :L so ebarrassing to wrestling fans :(
-
[youtube]http://www.youtube.com/watch?v=6DUgT_W-RZE[/youtube]
[youtube]http://www.youtube.com/watch?v=nkqesXzIwsc[/youtube]
[youtube]http://www.youtube.com/watch?v=mMD0oOuCbYo[/youtube]
[youtube]http://www.youtube.com/watch?v=VfWotphjMC0[/youtube]
[youtube]http://www.youtube.com/watch?v=223zNMaM1bk[/youtube]
[youtube]http://www.youtube.com/watch?v=rjKwOptnS6Q[/youtube]
[youtube]http://www.youtube.com/watch?v=TtGpyKhKvd8[/youtube]
[youtube]http://www.youtube.com/watch?v=hDQDwprWduA[/youtube]
and LOL this:
[youtube]http://www.youtube.com/watch?v=_HmDUxaAkO0[/youtube]
-
(http://img.labnol.org/di/images/TheWorldMap_B8B4/online_communities.png)
-
wow facebook is small lol
-
spring 2007
:D
-
(http://i.imgur.com/aZFQO.jpg)
I fixed it.
-
[youtube]http://www.youtube.com/watch?v=cvER9G2wZBo[/youtube]
omg lol
-
Kudos to those who understand the joke here lol
(http://artoftrolling.files.wordpress.com/2011/07/chatroulette-trolling-should-he-stop-beating-her.jpg)
,
(http://artoftrolling.files.wordpress.com/2011/07/chatroulette-trolling-good-to-know.jpg)
(http://artoftrolling.files.wordpress.com/2011/07/email-troll-theyre-rite-of-passage-films.jpg)
-
Oh dear, I laughed so much, especially the last picture is epic! :L :L
-
haha at the first one
-
[youtube]http://www.youtube.com/watch?v=gzN92qE-JZ8[/youtube]
-
[youtube]http://www.youtube.com/watch?v=psV_r1RUNXI&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=kMyPD1VKk60&feature=feedu#movie_player[/youtube]
-
(http://obczaj.net/obrazki/148821.jpg)
(http://obczaj.net/obrazki/148824.jpg)
(http://obczaj.net/obrazki/148825.jpg)
(http://obczaj.net/obrazki/148864.jpg)
-
lol @ first one
-
[youtube]http://www.youtube.com/watch?v=5OksNUbSkp0&feature=player_embedded#at=20[/youtube]
-
:L :L :L looks like unban appeal topic :L :L :L
]http://www.lepost.fr/article/2010/10/20/2274167_dopage-les-excuses-les-plus-bidons-des-sportifs.html#xtor=ADC-218-[2274167-dopage-les-excuses-les-plus-bidons-des-sportifs] (http://www.lepost.fr/article/2010/10/20/2274167_dopage-les-excuses-les-plus-bidons-des-sportifs.html#xtor=ADC-218-[2274167-dopage-les-excuses-les-plus-bidons-des-sportifs)
Doping: the fail apologies of sports
(http://medias.lepost.fr/ill/2010/10/20/h-4-2274400-1287571963.jpg)
This sport has it spiked? Any doubt ... This sport has it spiked? Any doubt ... | Assembly according to The Post "Hulk"
The 2011 Tour de France had its first positive test. This is the Russian Alexandr Kolobnev who left the race Monday, voluntarily, pending a cons-analysis.
Meanwhile the explanations of the runner, overview of apologies cans of athletes.
It's not me it was for my dog asthma
The explanation given by Franck Vandenbroucke, a Belgian cyclist seen time as a prodigy fell into drug use and suspensions for doping. Death in 2009, his excuse will remain at least as famous as his record.
It's not me, it was for my mother
Considered "threatened" by Lance Armstrong during the Tour in 2002, the Lithuanian Raimondas Rums Tour 2005 made a very correct (third). But the interception of his wife by border police in a car packed with performance-enhancing drugs is disorder. Madame excuse: it was for my stepmother. "She was in Lithuania to my mother-in Yakstenia" said the rider, who has curiously not believe it.
It's not me, it was for my penis
LaShawn Merritt, the American athlete, will miss the Olympics in London, despite the original line of defense: he had taken of DHEA to increase the size of his penis. This, I believe our part, does not help to run faster, quite the contrary.
Not me, it is the fault in my toothpaste
Dieter Baumann, Olympic champion 5000 in 92 German, has even filed a complaint against the mysterious individual who would have introduced this product dopant (the Norandrostendione) in toothpaste. The manufacturer has been bleached teeth Dieter too, but not him, who took two years of suspension. The worst is that in 2000, it still offered a reward to find the end of the story.
Not me, it is the fault of my whiskey
This is the explanation of Floyd Landis, winner of the short-lived Tour de France 2006 downgraded in the wake. He had managed to catch up 10 minutes behind its direct competitor in a mountain stage. Tested positive, he will award ... at a party a little watered when he had drunk four glasses of whiskey. Then he explains that he suffered from dehydration when his coach saw him take 70 cans of 48 cl in that famous stage ...
It's not me, it's my butt balm
This is the excuse of Lance Armstrong ... 99 who treated as hemorrhoids Frederick Bousquet (except that Bousquet was followed clinically for 8 years for this problem).
Not me, I just wanted to remove hair
Except that when using no razor for fear of being cut, avoids the cream of clostebol Bourée, eh Maurren Higa Maggi (long jumper).
It's not me, I made a cunnilingus to my wife
The excuse of distance runner Spain Daniel Plaza, tested positive for nandrolone has a lot of people laugh in 96. Ms. Plaza was pregnant, but it is not a reason, pregnant women do not produce it naturally!
Not me, I kissed a girl who had lined his mouth of cocaine
The excuse of Richard Gasquet. An evening in Miami hosted by Bob Sinclar, a friend of a candidate of the Star Academy, and bing, the accident stupid nutcracker to the extension that contaminates the "Mozart of tennis". The worst part is that he tested positive when he had already withdrawn from the tournament ... This explanation, however, convinced the authorities of tennis.
It's not me, I ate a steak stuffed with Spanish clenbuterol
The triple Tour winner Alberto Contador should pay more attention to what's on his plate! For now, it is provisionally suspended.
It's not me, it was poorly cleaned my can/canteen!
Excuses put forward by the cyclist Danilo Hondo in 2005 to explain the traces of carphedon in her urine. It is well known, the cans are reused dozens of times. You can see on the site Cycling-dopage.com an anthology of apology to the past or can not own a teammate / opponent rider / spectator malicious quite impressive.
It's not my fault, my friends were smoking joints
The athlete Mark Lewis-Francis was nabbed on cannabis with a high rate as if he had smoked a pack of joints. He put this on behalf of a smoky evening where he was a victim of passive smoking. The worst ... that he was cleared.
It's not my fault, I just made love before the game
It is still sexier than being bitten or s'autotransfuser, right? The excuse of the AC Milan striker Marco Boriello "my partner with an eye to the vagina, so she used a cream containing cortisone, I inherited the passage."
The American athlete Dennis Mitchell, also tested positive in 98, said he had (with dignity) celebrated the birthday of his wife, "was his birthday, the lady deserved special treatment."
It's not me, I have a twin brother died before birth
Excuse the cyclist Tyler Hamilton, who had blood tests frightfully above the norm. Explanation given by his lawyer the little Tyler was originally born with a twin. The twin died before birth, contributing to a naturally Tyler Hamilton red blood cell levels comparable to cocaine in Jean-Luc Delarue: superhuman.
It's not my fault, I Alzheimer Parkison
The athlete Sureyya Ayhan of Turkey (2002 European Champion of 1500) has put a lot of reluctance to submit to a doping control. She first sent someone who looked like him or Eve to Adam to pee in the bottle in his place, and then, caught between quat'z'yeux by the controllers, overturned several times the sample. Career over!
It's not my fault, I missed the good bin
Negligence of the Russian rowing team has lost in 2007 trying to get rid of syringes or seen or known in Lausanne, they threw ... in the bin of recyclable waste. A local resident has moved and alerted the authorities. The incivility has lost ... more than the doping itself!
It's not my fault, I have more hair
Contamination due to a product to stop hair loss (not oil-Hahn, but Crescina, Ronaldo is the one ... the pub) it seems: this is how the Brazilian striker has defended Romario, taken in 2007 to finasteride.
It's not me, I ate too much veal
The excuse of the tennis player Petr Korda said the presence of nandrolone in his urine with his love for the veal. Except that, according to experts, it would have had to eat 40 a day per animal to reach the rates contained in its body ... Try again Petr: 1 year suspension and career over!
It's not me, I was made pregnant!
Frederick, a surfer, we reported the case of Sesil Karatantcheva: "After an early career that sees her thunderous reach the quarter-finals of Roland Garros in 15 years ago (in 2005), a urine sample taken during this tournament is positive for Nandrolone. His excuse, despite his young age: she was pregnant at the time of this control and had a miscarriage in between. No luck Sesil, pregnancy tests can also done on a urine sample and they broke his line of defense. "
-
[youtube]http://www.youtube.com/watch?v=aUzTos-khyg&feature=player_embedded[/youtube]
Polish, very stable frying pan.
Boxxxy is baaaaaaaaaaaaaack
[youtube]http://www.youtube.com/watch?v=mhVhS1Z0-ig&feature=player_embedded#at=51[/youtube]
Flx on the beach.
[youtube]http://www.youtube.com/watch?v=RSQI0wBJ_jE&feature=player_embedded[/youtube]
Very realistic video may damage your screen.
[youtube]http://www.youtube.com/watch?v=qmDkj2-NuZ4&feature=player_embedded[/youtube]
And the bonus for polish member about proffesional lector:
[youtube]http://www.youtube.com/watch?v=hIT2XDOGZSA&feature=player_embedded[/youtube]
-
Boxxxy is baaaaaaaaaaaaaack
[youtube]http://www.youtube.com/watch?v=mhVhS1Z0-ig&feature=player_embedded#at=51[/youtube]
she's forcing it too much now. old boxxy ftw
-
[youtube]http://www.youtube.com/watch?v=FzmAEQzZJ5Q&feature=player_embedded[/youtube]
"We Love Poland 7" some of parst and understand-able for even non polish speaker
[youtube]http://www.youtube.com/watch?v=_hT9417gm_Y&feature=player_embedded[/youtube]
-
[youtube]http://www.youtube.com/watch?v=5nTAn6E_flE[/youtube]
LOL
-
[youtube]http://www.youtube.com/watch?v=n2yuWiCEvxM&feature=player_embedded[/youtube]
v Not Funny, just beatiful.
http://www.joemonster.org/filmy/36788/Wielka_metropolia_bez_samochodow
-
[youtube]http://www.youtube.com/watch?v=5nTAn6E_flE[/youtube]
LOL
no blood no fun
-
this guy is a total nutcase lol
[youtube]http://www.youtube.com/watch?v=0nfPC7moAyA[/youtube]
he's known from a czech fortune-telling tv show
[youtube]http://www.youtube.com/watch?v=LJXaqzK-qs4&[/youtube]
watch it and you'll be like WTF :P :L
-
WTF
-
[youtube]http://www.youtube.com/watch?v=n2yuWiCEvxM&feature=player_embedded[/youtube]
This woman can be.... :L
-
(http://s3.amazonaws.com/kym-assets/photos/images/original/000/150/781/It+s+Unfair+Why+is+there+one+of+him+And+many+of_7670b8_2373457.jpg?1311121726)
-
ZDSHICHUAHSAHDAU_STUNTER on his HPV-1000. :L
[youtube]http://www.youtube.com/watch?v=pJxOsYh12yY[/youtube]
-
PSP Phone LOL
[youtube]6xO5haQzfVI[/youtube]
OMG!! u troll!! cunt
[youtube]WzbLWgO7sJI[/youtube]
-
I've got one!!!! I have an iPhone 5!!!!!!!!!!!!!
-
(http://obczaj.net/obrazki/149047.jpg)
(http://obczaj.net/obrazki/149056.jpg)
(http://obczaj.net/obrazki/149063.jpg)
(http://obczaj.net/obrazki/149069.jpg)
(http://obczaj.net/obrazki/149071.jpg)
(http://obczaj.net/obrazki/149072.jpg)
(http://obczaj.net/obrazki/149085.jpg)
(http://obczaj.net/obrazki/148957.jpg)
(http://obczaj.net/obrazki/148973.jpg)
(http://obczaj.net/obrazki/148979.jpg)
(http://obczaj.net/obrazki/148880.jpg)
-
LOL
[youtube]http://www.youtube.com/watch?v=RSDadVrHJ3s&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?v=38ebT4NtgVc&feature=youtu.be[/youtube]
-
ewwwww :L
-
ahhhhhhhh wtf i was eating too i wasn't expecting that
-
[youtube]http://www.youtube.com/watch?v=38ebT4NtgVc&feature=youtu.be[/youtube]
bleh that's disgusting
-
[youtube]http://www.youtube.com/watch?v=cjU7tXZH_1o&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=vAAZGvuApxg&feature=player_embedded[/youtube]
http://www.joemonster.org/filmy/36818/Kompilacja_porazek_lipiec_2011_1_
-
(http://m.blog.hu/ga/gazmegfek/image/m3_amg_lol.jpg)
(http://www.benzworld.org/forums/attachments/w163-m-class/314439d1276790484-saw-interesting-license-plate-benz-today-bmw_lol.jpg)
-
:L
[youtube]http://www.youtube.com/watch?v=cjU7tXZH_1o&feature=player_embedded[/youtube]
lol great commercial :L :L
-
(http://www.joemonster.org/i/d/obama_podpis0.jpg)
(http://www.joemonster.org/i/d/obama_podpis1.jpg)
(http://www.joemonster.org/i/d/obama_podpis2.jpg)
(http://www.joemonster.org/i/d/obama_podpis3.jpg)
(http://www.joemonster.org/i/d/obama_podpis4.jpg)
(http://www.joemonster.org/i/d/obama_podpis5.jpg)
(http://www.joemonster.org/i/d/obama_podpis6.jpg)
(http://www.joemonster.org/i/d/obama_podpis7.jpg)
-
(http://i.imgur.com/0yyiU.jpg)
(http://s3.amazonaws.com/kym-assets/photos/images/original/000/133/410/1307885641839.jpg?1307901943)
(http://s3.amazonaws.com/kym-assets/photos/images/original/000/147/120/quick.jpg?1310360953)
(http://s3.amazonaws.com/kym-assets/photos/images/original/000/140/952/itsfridayitsfriday.png?1309208560)
(http://s3.amazonaws.com/kym-assets/photos/images/original/000/139/084/1308115043164.jpg?1308831321)
(http://s3.amazonaws.com/kym-assets/photos/images/original/000/134/165/download%20(1).png?1308032329)
(http://s3.amazonaws.com/kym-assets/photos/images/original/000/133/927/32f9.jpg?1307997266)
(http://i.imgur.com/6nPXz.jpg)
-
(http://s3.amazonaws.com/kym-assets/photos/images/original/000/139/084/1308115043164.jpg?1308831321)
this is best :L
-
(http://i.imgur.com/6nPXz.jpg)
haha yeah, i loved playing with it as a kid
-
lol i only did it when the tape had been eaten by the player
-
lol i only did it when the tape had been eaten by me
-
they were just so tasty i couldn't stop myself
(http://i.imgur.com/xpYVI.gif)
-
haha, i thought it would never end :L
-
[youtube]http://www.youtube.com/watch?v=p9kwMKO4GAs[/youtube]
-
hilarious :L
[youtube]http://www.youtube.com/watch?v=rB2_WdYVCZc[/youtube]
-
:L Good
-
@Snoopy: It's just a silly video they keep renaming every time someone dies to whore views. :(
-
bleh -_-
-
(http://img.photobucket.com/albums/v503/werdy/TfYZe.jpg)
-
lmao! :L
-
lol :L
-
[youtube]http://www.youtube.com/watch?v=qvgYAwDORo4&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=8SsFXQ0kmLs&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=onE7mib4Qrg&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=rb2k0CnundE&feature=player_embedded[/youtube]
-
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-snc6/229773_10150324430746055_225079981054_9847199_7669865_n.jpg)
(http://a2.sphotos.ak.fbcdn.net/hphotos-ak-snc6/251728_10150322447916055_225079981054_9822831_6162300_n.jpg)
(http://a2.sphotos.ak.fbcdn.net/hphotos-ak-snc6/284017_10150321046096055_225079981054_9808763_6269794_n.jpg)
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-snc6/230954_10150245790276055_225079981054_9141707_884520_n.jpg)
-
(http://i.imgur.com/BBELO.png)
(http://i.imgur.com/ElBbL.gif)
and don't click on these:
http://i.imgur.com/rAQqM.gif
http://i.imgur.com/vIFeD.gif
-
and don't click on these:
http://i.imgur.com/rAQqM.gif
http://i.imgur.com/vIFeD.gif
I want to click but I wont ::)
-
omg i clicked :o :blank:
-
I clicked lol, first one is a glass eye, second, dont click while/after eating
-
[youtube]http://www.youtube.com/watch?v=PJzG7CSYg3U[/youtube]
-
(http://kisspic.com/wp-content/themes/a/phpThumb.php?src=http://kisspic.com/i/123253_700b_v2.jpg&h=0&w=860&zc=1&q=100&fltr[]=crop|0|0|0|40)
-
[youtube]http://www.youtube.com/watch?v=Hy3lsyMjnMY[/youtube]
[youtube]http://www.youtube.com/watch?v=VKC5d4Ytcq0[/youtube]
[youtube]http://www.youtube.com/watch?v=KSnk-aKwaUA[/youtube]
-
[youtube]http://www.youtube.com/watch?v=KSnk-aKwaUA[/youtube]
:L
-
[youtube]http://www.youtube.com/watch?v=wVuZ55J5k-g[/youtube]
-
LOL i wonder if the last girl showed them to him or not :L
-
[youtube]http://www.youtube.com/watch?v=PqJ-kRe1834[/youtube]
:L :L :L
-
easy O0
-
[youtube]http://www.youtube.com/watch?v=PqJ-kRe1834[/youtube]
:L :L :L
its Thai Soccer
-
(http://www.ahnegao.com.br/wp-content/uploads/2011/07/russia.jpg)
SOVIET RUSSIA
-
(http://i.imgur.com/myTaV.jpg)
(http://i.imgur.com/jKUTg.jpg)
(http://i.imgur.com/pWxUu.jpg)
(http://i.imgur.com/7HlAz.jpg)
(http://i.imgur.com/J8ov4.jpg)
(http://i.imgur.com/kPS93.jpg)
(http://i.imgur.com/ojzDp.jpg)
(http://i.imgur.com/RVF5G.jpg)
(http://i.imgur.com/wgeqj.jpg)
(http://i.imgur.com/AL350.jpg)
(http://i.imgur.com/gVIFX.jpg)
(http://i.imgur.com/5yzKN.jpg)
(http://i.imgur.com/G0de2.jpg)
-
[youtube]I9uAlgTwHBI[/youtube]
-
[youtube]http://www.youtube.com/watch?v=bvwHTLVn7ng[/youtube]
:L :L :L
[youtube]http://www.youtube.com/watch?v=s4YsMVA8DoU&NR=1[/youtube]
:L :L :L
-
(http://obczaj.net/obrazki/149740.jpg)
(http://obczaj.net/obrazki/149744.jpg)
-
(http://obczaj.net/obrazki/149855.jpg)
(http://obczaj.net/obrazki/149856.jpg)
(http://obczaj.net/obrazki/149866.jpg)
(http://obczaj.net/obrazki/149877.jpg)
(http://obczaj.net/obrazki/149888.jpg)
(http://obczaj.net/obrazki/149895.jpg)
-
(http://desmotivado.com/files/2009/03/conga.jpg)
(http://photos-h.ak.fbcdn.net/hphotos-ak-snc6/230214_142450382493966_124685914270413_270834_2258874_s.jpg)
(http://images.icanhascheezburger.com/completestore/2009/5/24/128876765488032368.jpg)
-
(http://img694.imageshack.us/img694/8514/111me.png)
-
:L
-
;D
-
people prefer hacks over ouzo lol
-
:( ban everybody who voted hacks.
-
(http://obczaj.net/obrazki/149918.jpg)
(http://obczaj.net/obrazki/149953.jpg)
-
Best Nicki Minaj impression lol. :L
[youtube]http://www.youtube.com/watch?v=bSbKXQAhpZA[/youtube]
-
haha loling :L
-
Epic:
[youtube]CMWwTl3Dz9M[/youtube]
[youtube]dyM2W9rAPeU[/youtube]
-
Epic:
[youtube]CMWwTl3Dz9M[/youtube]
:o crazy
-
[youtube]http://www.youtube.com/watch?v=bSbKXQAhpZA[/youtube]
LMAO :L
-
[youtube]http://www.youtube.com/watch?v=tj7UwiuzaKA&feature=player_embedded[/youtube]
-
lol
-
http://www.facebook.com/l.php?u=http%3A%2F%2F9gag.com%2Fgag%2F183209%3Fref%3Dfb&h=JAQBkdwDC
-
hah
-
(http://userserve-ak.last.fm/serve/500/50186093/Quan+3.jpg)
-
nothing funny about this but lol this are skills:
http://www.autojunk.nl/2010/01/dat-is-een-krappe-bocht
first turn not so, but after that with the bus lol
-
http://www.autojunk.nl/2010/01/dat-is-een-krappe-bocht
-
^ who cares, that video was pretty cool!
-
^ who cares, that video was pretty cool!
thats what i tought too ;)
-
^ who cares, that video was pretty cool!
it was cool, turbofreak always says junk, thats why i quoted it :police:
-
ah yeh so thats true lol then i understand why u did that :-* :police:
-
[youtube]http://www.youtube.com/watch?v=LO9xzfvgpEc[/youtube]
[youtube]http://www.youtube.com/watch?v=QV3u5h5NoP8[/youtube]
-
lol @ soken dvd
-
Haha real time lag
-
nah, that would be more like:
[youtube]http://www.youtube.com/watch?v=-MlSOshISXA[/youtube]
-
hahahaha
-
/lagX on
-
[youtube]http://www.youtube.com/watch?v=S5WFl4E8VCI&feature=related[/youtube]
-
:L
-
[youtube]http://www.youtube.com/watch?v=4PZxRFXjRgA[/youtube]
-
(http://obczaj.net/obrazki/150009.jpg)
(http://obczaj.net/obrazki/150023.jpg)
(http://obczaj.net/obrazki/150024.jpg)
(http://obczaj.net/obrazki/149992.jpg)
(http://obczaj.net/obrazki/150025.jpg)
(http://obczaj.net/obrazki/150043.jpg)
(http://obczaj.net/obrazki/150044.jpg)
(http://obczaj.net/obrazki/150057.jpg)
(http://obczaj.net/obrazki/149962.jpg)
and final, Ham Solo
(http://obczaj.net/obrazki/150058.jpg)
-
lol nike wellingtons
and tuned bike
-
YoOoO! M4lysz hire xDDD
-
(http://desmond.imageshack.us/Himg809/scaled.php?server=809&filename=photo0469w.jpg&res=medium)
my personal reserve 8)
-
real or fake?
(http://i.imgur.com/EbhO3.jpg)
-
fake
-----
[youtube]http://www.youtube.com/watch?v=QKEqMpaVP1A&feature=player_embedded[/youtube]
-
jam probably
-
lol the heart has chunks, looks like strawberry jam :laugh:
-
game for madmax lol
(http://image.jeuxvideo.com/images/jaquettes/00034302/jaquette-zombie-driver-pc-cover-avant-g.jpg)
-
Lmao, where'd you find that?
-
someone sent it to me on facebook so i downloaded the picture on my pc so i could masterbate over it.
-
:L
-
(http://obczaj.net/obrazki/150075.jpg)
(http://obczaj.net/obrazki/150117.jpg)
(http://obczaj.net/obrazki/150129.jpg)
-
game for madmax lol
(http://image.jeuxvideo.com/images/jaquettes/00034302/jaquette-zombie-driver-pc-cover-avant-g.jpg)
Awesome game
this is game for Madmax
(http://cdn.steampowered.com/v/gfx/apps/91900/header_292x136.jpg?t=1311807842)
http://store.steampowered.com/app/91900
-
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-ash4/251054_214140951958079_107458725959636_543561_7007988_n.jpg)
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-snc6/264365_214140938624747_107458725959636_543560_1640149_n.jpg)
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-snc6/263190_214141048624736_107458725959636_543566_1674439_n.jpg)
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-ash4/261356_214141231958051_107458725959636_543578_545242_n.jpg)
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-snc6/269594_214141248624716_107458725959636_543579_6527037_n.jpg)
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-snc6/264509_214141278624713_107458725959636_543580_4632856_n.jpg)
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-snc6/263174_214141435291364_107458725959636_543589_4335426_n.jpg)
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-snc6/264262_214141528624688_107458725959636_543595_8184959_n.jpg)
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-snc6/262623_214141585291349_107458725959636_543598_6201599_n.jpg)
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-ash4/263870_214141625291345_107458725959636_543601_6968279_n.jpg)
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-snc6/270904_214141765291331_107458725959636_543609_6619921_n.jpg)
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-snc6/264067_214141795291328_107458725959636_543611_1185235_n.jpg)
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc6/268851_214141898624651_107458725959636_543618_1549696_n.jpg)
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-snc6/251381_214141941957980_107458725959636_543620_2003856_n.jpg)
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-snc6/264848_214142188624622_107458725959636_543634_4434442_n.jpg)
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-ash4/270398_214142255291282_107458725959636_543638_5295321_n.jpg)
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-ash4/271057_214142265291281_107458725959636_543639_4304964_n.jpg)
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-snc6/264138_214142315291276_107458725959636_543641_4059706_n.jpg)
(http://a2.sphotos.ak.fbcdn.net/hphotos-ak-ash4/263835_214142331957941_107458725959636_543642_2201752_n.jpg)
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-snc6/261974_214614961910678_107458725959636_546348_8231258_n.jpg)
-
someone sent it to me on facebook so i downloaded the picture on my pc so i could masterbate over it.
ahahaha
-
lol scorp ! nice pics
-
:L
-
nice pictures, scorpion :L
and ewww @ mr. and mrs. thebault :L :L
-
(http://i.imgur.com/UKiJc.jpg)
-
Where can I buy one of those Huey Hog helicopters?
-
nice pictures, scorpion :L
and ewww @ mr. and mrs. thebault :L :L
ahahahhahah
-
(http://i.imgur.com/UKiJc.jpg)
don't do step 3 BEFORE finishing cockpit interior, coz later you would have some trouble putting it is right possition
Where can I buy one of those Huey Hog helicopters?
try revell web pages
http://www.revell.com/model-kits/aircraft/85-5201.html
-
is that real? i don't really want to look to find out lol
-
is that real? i don't really want to look to find out lol
No, I think it's a joke lol. :L
-
some noob can't even cut pieces of model from plastic frame lol
btw this remind me to finish my airbus
(http://img405.imageshack.us/img405/5051/dsc01950tb.jpg)
nearly finished engines, right one is ready for base painting, but left one still need finishing details
(http://img851.imageshack.us/img851/2682/dsc01953u.jpg)
-
meh
[youtube]s0AjiN9q_TU[/youtube]
-
what a pile of shit
but those breasts <3
-
Oh goddddddddddddd, this shit better not go viral.
-
OMG, total shit.
-
meh
[youtube]s0AjiN9q_TU[/youtube]
nice bitch gnum :P
-
lol this is shiteeeee!
-
[youtube]http://www.youtube.com/watch?v=E6gO6zwPJMA[/youtube]
I probably posted it before:
[youtube]http://www.youtube.com/watch?v=xLmBiBGOPJs[/youtube]
-
loool l want a cat like that :L
-
(http://i.imgur.com/wZGlA.gif)
-
RIP Billy Mays! :(
[youtube]http://www.youtube.com/watch?v=IDfrwHHScxg[/youtube][youtube]http://www.youtube.com/watch?v=yRRJ6mMsVBc&NR=1[/youtube][youtube]http://www.youtube.com/watch?v=D68mignoFAI&feature=channel_video_title[/youtube][youtube]http://www.youtube.com/watch?v=bCEwZm9jh38&feature=channel_video_title[/youtube][youtube]http://www.youtube.com/watch?v=YILTC8f5wXY&feature=channel_video_title[/youtube][youtube]http://www.youtube.com/watch?v=mnmnIOMWzbg&feature=channel_video_title
http://www.youtube.com/watch?v=sf_zWjSJWJ4&feature=channel_video_title[/youtube]
-
I think some of these have been already here somewhere but nevermind :L
(http://i.imgur.com/bOBqG.gif)
(http://i.imgur.com/crX1T.gif)
(http://i.imgur.com/TLNVm.gif)
(http://i.imgur.com/xbeME.gif)
(http://i.imgur.com/8iM1c.gif)
(http://i.imgur.com/3Xg9j.gif)
(http://i.imgur.com/eznz6.gif)
(http://i.imgur.com/6bge2.gif)
(http://i.imgur.com/wkjJM.gif)
(http://i.imgur.com/2SfZW.gif)
(http://i.imgur.com/473zk.gif)
(http://i.imgur.com/mG1Wg.gif)
(http://i.imgur.com/j84r0.gif)
(http://i.imgur.com/XIW3X.gif)
(http://i.imgur.com/ZgIdl.gif)
(http://i.imgur.com/oubBO.gif)
(http://i.imgur.com/qFxGw.gif)
(http://i.imgur.com/j5wOx.gif)
(http://i.imgur.com/tUx4C.gif)
(http://i.imgur.com/OE1Ae.gif)
(http://i.imgur.com/ODnbj.gif)
(http://i.imgur.com/0I6PP.gif)
(http://i.imgur.com/1uRWp.gif)
(http://i.imgur.com/y6bAM.gif)
(http://i.imgur.com/iza31.gif)
(http://i.imgur.com/mbPLP.gif)
-
empty hallway one got me!
-
empty hallway one got me!
(spin)
-
chick magnet :L
-
(http://obczaj.net/obrazki/150150.jpg)
(http://obczaj.net/obrazki/150160.jpg)
(http://obczaj.net/obrazki/150156.jpg)
NSFW???
http://obczaj.net/obrazki/150194.jpg
-
empty hallway one got me!
Yeah, I wasn't expecting it: it would have got me if I didn't have such a slow connection lol. :L
-
[youtube]http://www.youtube.com/watch?v=7bRUbBqXs2g&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=cBmRnVwrhD4&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=FngGGthZySY&feature=player_embedded[/youtube]
-
nothing funny about 1st one and last one its just pitiful
-
[youtube]http://www.youtube.com/watch?v=udg7aygNQGs&feature=player_embedded[/youtube]
funny is that how guy in red is rolling :L
-
[youtube]http://www.youtube.com/watch?v=udg7aygNQGs&feature=player_embedded[/youtube]
funny is that how guy in red is rolling :L
He kicked him so hard, that he starts rolling the other way.. AMAZING!
nookie602 1 days ago 121 (http://s.ytimg.com/yt/img/pixel-vfl3z5WfW.gif)
-
(http://i.imgur.com/gQOre.jpg)
-
Just....what...I don't...
[youtube]http://www.youtube.com/watch?v=IOWo8X84fSM[/youtube]
-
oh my, give me one lol
-
oh my, give me one lol
I know, right? I don't want a sports car any more, I want a Patrol.
Also, I lol'd:
(http://jpg.artige.no/store/9604.png)
-
[youtube]http://www.youtube.com/watch?v=Mdv-g-fsQmk[/youtube]
-
[youtube]http://www.youtube.com/watch?v=p39ULW_xzUE[/youtube]
-
hahah loool
-
Got IRL LOLs for that^
Look at this one (fast forward to 1:40)
[youtube]http://www.youtube.com/watch?v=mAII_KuXfsE[/youtube]
Orderly queue outside JD Sports. Britain: even when we are looting we follow the polite stereotype. :L
-
and lol @ the shop called "loot" ^
[youtube]http://www.youtube.com/watch?v=p39ULW_xzUE[/youtube]
loooooooooooooooooooooooooooooool :L :L :L
-
You can hear someone laughing at him :L
-
lol :L
-
whahah :L
-
Another British stereotype...
There's a war going on in the streets, a war on thirst.
(http://i.imgur.com/6NcIj.png)
Also rammer noob:
(http://3.bp.blogspot.com/-hVOf2nTHY6E/TkESqDXmk6I/AAAAAAAAAFo/Y_L8WoTpx8o/s400/riot+1.PNG)
-
(http://www.wired.com/autopia/wp-content/gallery/15-readers-dream-rides/ferrari-f40.jpg)
(http://autophotosite.com/wp-content/uploads/2010/04/1987_Ferrari-F40_1987-03.jpg)
(http://4.bp.blogspot.com/_FoXyvaPSnVk/S9dGBk3o7eI/AAAAAAACyoc/1dAFHajYxnE/s1600/Ferrari-F40-1.jpg)
(http://www.greyhoundzoom.com/images/ferrari-f401.jpg)
-
nice lol
-
They all look so sad, Max.
-
They all look the same.
-
[MAF]Snoops
(http://forum.adrenalinex.co.uk/index.php?action=dlattach;attach=3474;type=avatar)
lol :L
-
(http://i.imgur.com/mmXzV.jpg)
And trust the Daily Mail to put this...
(http://i.imgur.com/PUXTR.png)
:L
-
(http://i.imgur.com/hFnCY.jpg)
-
And trust the Daily Mail to put this...
(http://i.imgur.com/PUXTR.png)
:L
So shocking....:L
-
[youtube]http://www.youtube.com/watch?v=D3Qz7ksl63Y[/youtube]
[youtube]http://www.youtube.com/watch?v=RU1_8QE0gt0[/youtube]
[youtube]http://www.youtube.com/watch?v=kzO0aD4hZgQ[/youtube]
-
omg lol the 1st one
the 2nd is so fail :L
and the 3rd one :o
-
Ahahahaha. The subwoofer one. 8)
-
(http://i.imgur.com/y6Djv.jpg)
-
BAHAHHAHAHAHAHAHAAAAAHAHHAHAHAHAHAHAAAAvAHAHHAHAHAHAHAHAAAAAHAHHAHAHAHAHAHAAAAAHAHHAHAHAHAHAHAAAA :laugh:
-
:L
-
(http://i897.photobucket.com/albums/ac180/CondemnedPictures/198647_233029170067127_232804136756297_599961_6947715_n.jpg)
(http://i897.photobucket.com/albums/ac180/CondemnedPictures/215077_233029143400463_232804136756297_599959_1835196_n.jpg)
(http://i897.photobucket.com/albums/ac180/CondemnedPictures/184151_233029006733810_232804136756297_599951_716466_n.jpg)
(http://i897.photobucket.com/albums/ac180/CondemnedPictures/223109_233029106733800_232804136756297_599957_2225972_n.jpg)
(http://i897.photobucket.com/albums/ac180/CondemnedPictures/184189_233030156733695_232804136756297_599964_4337496_n.jpg)
(http://i897.photobucket.com/albums/ac180/CondemnedPictures/263230_232813693422008_232804136756297_599259_3746454_n.jpg)
(http://i897.photobucket.com/albums/ac180/CondemnedPictures/262946_232811113422266_232804136756297_599242_3083628_n.jpg)
(http://i897.photobucket.com/albums/ac180/CondemnedPictures/252036_232811143422263_232804136756297_599243_3849884_n.jpg)
(http://i.imgur.com/NaCAz.jpg)
(http://i.imgur.com/AA4PX.png)
(http://i.imgur.com/A0Xqe.jpg)
(http://i.imgur.com/dp5Gs.jpg)
-
:L :L
[youtube]http://www.youtube.com/watch?v=Z_hwMtG2xCs&NR=1[/youtube]
[youtube]http://www.youtube.com/watch?v=t5sTBrs4fhQ[/youtube]
-
nice pictures epoxi xD
-
(http://i.imgur.com/6ujLk.jpg)
-
(http://i.imgur.com/zczD0.png)
-
(http://i.imgur.com/zczD0.png)
lmao :L
-
poor David :L
-
whahah
http://www.vidup.de/v/Jwopc/
-
classic XD
-
[youtube]http://www.youtube.com/watch?v=TNpjrkZmbvU&feature=relmfu[/youtube]
-
:L
-
hi Lam.
-
I kinda don't speak polish, so I didn't laugh at all
-
http://www.joemonster.org/filmy/37315/Drift_domowy
[youtube]http://www.youtube.com/watch?v=tH0lIIQ05Uw&feature=player_embedded[/youtube]
-
hi Lam.
I'm not him :blank: ::)
-
you aren't you
-
...
-
dotdotdot
-
Time to go on-topic with some: Success kid!
(http://chzmemebase.files.wordpress.com/2011/08/memes-untitled11.jpg)
-
I am very impressed if they managed to push that train for real: pushing a 1 tonne car by yourself takes a fair amount of effort, so 4 people for a 100+ tonne train is quite a feat.
-
(http://i.imgur.com/EaxOs.jpg)
-
(http://www.jankokuk.estranky.cz/img/mid/13/51.jpg)
(http://www.babas.estranky.cz/img/mid/12/-obrazky.4ever.sk--macka-9954455.jpg)
-
(http://i.imgur.com/JIaKH.jpg)
-
:L :L :L
-
poor Alf! :L
-
Achmed is the best one ;) So i haven't got any.
-
(http://sig.grumpybumpers.com/host/ukriots.gif)
-
(http://www.rotfllol.com/pdata/t/412.gif)
[youtube]http://www.youtube.com/watch?v=1vslyvJNQ2A[/youtube]
[youtube]http://www.youtube.com/watch?v=bwHk5qJD8Vo[/youtube]
-
demonstar didn't have his lamp post mod installed it seems like.
[youtube]http://www.youtube.com/watch?v=OPdQCuc7CZo&feature=aso[/youtube]
-
haha
-
for max
(http://i.imgur.com/N6bJf.jpg)
-
Just picked up some Funny Pictures / GIFS
GIF
(http://phun.madme.net/images/scooter.gif)
PIC
(http://phun.madme.net/images/38218.jpg)
PIC
(http://phun.madme.net/images/drunkcrossing.jpg)
Normal
(http://phun.madme.net/images/phunny209.jpg)
(http://phun.madme.net/images/phunny386.jpg)
Norwegian Picture:D As you see Idiot and same colours as Police :p "Politi"
(http://phun.madme.net/images/genialt.jpg)
-
[youtube]http://www.youtube.com/watch?v=W8SK0rk5jdE&feature=player_embedded[/youtube]
-
wow lol
-
^If that is real I am amazed. O0
[youtube]IHnGMV8yOEQ[/youtube]
-
wtf is this shit
(http://i.imgur.com/Gzvbo.jpg)
-
hm so what happened after you clicked yes
-
lol
(http://i.imgur.com/Ju2qX.png)
-
nice
-
btw what's with your sig? D=
-
(http://i.imgur.com/m0FOF.png)
-
(http://obczaj.net/obrazki/150887.jpg)
(http://obczaj.net/obrazki/150920.jpg)
(http://obczaj.net/obrazki/150978.jpg)
(http://obczaj.net/obrazki/150973.jpg)
(http://obczaj.net/obrazki/150995.jpg)
(http://obczaj.net/obrazki/150656.jpg)
(http://obczaj.net/obrazki/150659.jpg)
(http://obczaj.net/obrazki/150661.jpg)
for polish people, i'm affraid that only them will ge this one right:
(http://obczaj.net/obrazki/150728.jpg)
-
Rofl nice pics :D
(http://phun.madme.net/images/hahagotcreamed.jpg)
-
(http://phun.madme.net/images/godkills.jpg)
-
(http://phun.madme.net/images/NoName21.jpg)
-
(http://phun.madme.net/)
-
(http://phun.madme.net/images/Donor.jpg)
-
(http://phun.madme.net/images/71.jpg)
-
(http://phun.madme.net/images/euro.gif)
-
(http://phun.madme.net/images/403.jpg)
-
[youtube]http://www.youtube.com/watch?v=W8SK0rk5jdE&feature=player_embedded[/youtube]
This video has been removed because its content violated YouTube's Terms of Service. :-\
-
(http://www.kalerab.sk/pic/forum/v/vtipne_obrazky_334_8.jpg1.819396_e50kebw84.jpg)
(http://files.mad-house.meu.zoznam.sk/200000026-79dce7adb8/fotbal_vtipne_obrazky29.jpg)
(http://2.bp.blogspot.com/_vAYEvG73xmw/S1XOnTwhGKI/AAAAAAAAAJM/3KnptxBLgU8/s640/fotbalova_momentka.jpg)
:)
-
lol @ the last one
-
(http://www.socialsitehumor.com/wp-content/uploads/2011/05/DNA-e1305790504493.png)
[youtube]AZDtmRje4Wk[/youtube]
-
haha wtf lol
-
(http://i.imgur.com/giCPG.jpg)
-
:L
-
[youtube]AZDtmRje4Wk[/youtube]
lol
-
[youtube]http://www.youtube.com/watch?v=euXQbZDwV0w[/youtube]
[youtube]http://www.youtube.com/watch?v=Xe1a1wHxTyo[/youtube]
[youtube]http://www.youtube.com/watch?v=-jIC9807Xb8&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=vciA9-01M88&feature=player_embedded[/youtube] - LadyBower River block.
-
[youtube]http://www.youtube.com/watch?v=oLgOAg80m_s&feature=channel_video_title[/youtube]
:L :L
-
(http://i.imgur.com/Jr9Cb.jpg)
DEFINITIVE PROOF SAN ANDREAS IS BEST GTA :L
-
imo either san andreas or vice city is best gta
-
SP:
Vice City > 3 > IV > San Andreas
MP:
San Andreas > IV
-
Vice City > 3 > IV > San Andreas
Get out....
Get out now.
:L
-
this:
3 < IV < Vice City < San Andreas
or even this
IV < 3 < Vice City < San Andreas
-
IV > 3 > Vice City > San Andreas
Not sure you used proper math symbol Max or if you did best part is IV ???
Here is my vote
IV<GTAIII=Vice City<San Andreas
-
[youtube]http://www.youtube.com/watch?v=2T9w6AG20Lc[/youtube]
[youtube]http://www.youtube.com/watch?v=GM6oBP_lUM0&annotation_id=annotation_422377&feature=iv[/youtube]
[youtube]http://www.youtube.com/watch?v=DZ3oUmnb_us&feature=iv&annotation_id=annotation_238721[/youtube]
[youtube]http://www.youtube.com/watch?v=5u--7pBf8ao&feature=iv&annotation_id=annotation_485118[/youtube]
[youtube]http://www.youtube.com/watch?v=YW1MjoZk3PE&annotation_id=annotation_266707&feature=iv[/youtube]
-
hahaha i hadn't seen the baywatch one before
-
IV > 3 > Vice City > San Andreas
Not sure you used proper math symbol Max or if you did best part is IV ???
Here is my vote
IV<GTAIII=Vice City<San Andreas
oops ye, should be < instead >, done
-
(http://i.imgur.com/WUspe.gif)
-
^I don't understand it Moo. :-\
(http://i255.photobucket.com/albums/hh159/macorules94/funny-facebook-fails-omg-mom.jpg)
-
and here he goes again... >:D
[youtube]http://www.youtube.com/watch?v=btViXvIDsi0[/youtube]
-
[youtube]EwKsLXYFKCU[/youtube]
Edit: Hmm, never mind, looks like there are only 2 songs in that video, but the title is still very true. :L
-
mine pic is FTW
-
mine pic is FTW
i use it for few time :) look mine :d
-
NSFW ffs
-
LOL WTF!
-
mine pic is FTW
i use it for few time :) look mine :d
mine you can't see nothing only a tit :D
-
still it's NSFW, you should change it..
-
still it's NSFW, you should change it..
phobos sneaky admin :L :L
-
(http://i.imgur.com/3tclC.gif)
-
(http://i.imgur.com/3tclC.gif)
ftw pic i love it :D
-
8)
-
(http://i.imgur.com/hUsNj.gif)
-
[youtube]http://www.youtube.com/watch?v=jjwna0QSnqs[/youtube]
[youtube]http://www.youtube.com/watch?v=FHxar1iT-6g[/youtube]
-
mine pic is FTW
i use it for few time :) look mine :d
mine you can't see nothing only a tit :D
fuck it, go use, everyone free :P
-
(http://i.imgur.com/zerQC.jpg)
(http://i.imgur.com/YkObL.jpg)
(http://i.imgur.com/6fVeF.jpg)
(http://i.imgur.com/NrZmY.jpg)
(http://i.imgur.com/aWaqX.jpg)
-
fuck it, go use, everyone free :P
http://forum.adrenalinex.co.uk/index.php/topic,2499.msg65579.html#msg65579
-
Ouzomeze photo
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc6/166275_186840031327564_133455056666062_706409_4364234_n.jpg)
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-snc6/229644_255696317775268_133455056666062_1123075_1137160_n.jpg)
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc6/262504_255696364441930_133455056666062_1123077_5550092_n.jpg)
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-snc6/224554_255696517775248_133455056666062_1123084_1639283_n.jpg)
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-snc6/253259_255696654441901_133455056666062_1123090_2964150_n.jpg)
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-snc6/282439_255696934441873_133455056666062_1123101_815154_n.jpg)
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-ash4/262949_255697017775198_133455056666062_1123104_6062875_n.jpg)
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-ash4/284769_255697251108508_133455056666062_1123112_2214627_n.jpg)
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-ash4/198739_255697807775119_133455056666062_1123136_8079466_n.jpg)
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-snc7/301536_100263600078965_100002859750363_583_5348736_n.jpg)
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-snc6/69428_169709763040591_133455056666062_580378_3360689_n.jpg)
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc4/72706_169706969707537_133455056666062_580347_315768_n.jpg)
(http://a2.sphotos.ak.fbcdn.net/hphotos-ak-ash2/38018_145070445504523_133455056666062_424476_3947553_n.jpg)
-
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-snc6/282439_255696934441873_133455056666062_1123101_815154_n.jpg)
This is my favourite lol. :L
-
great pictures :L
-
rofl
(http://www.crazylolz.com/images/1313340592-56664.jpg)
-
Ouzomeze photo
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc6/166275_186840031327564_133455056666062_706409_4364234_n.jpg)
:L :L :L :L
-
eHarmony Video Bio :L
[youtube]mTTwcCVajAc[/youtube]
-
Ouzomeze photo
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc6/166275_186840031327564_133455056666062_706409_4364234_n.jpg)
:L :L :L :L
lol he mad cause I beat him 5-0
-
Ouzomeze photo
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc6/166275_186840031327564_133455056666062_706409_4364234_n.jpg)
:L :L :L :L
lol he mad cause I beat him 5-0
you beat me 5-0 , no you wrong you beat me 10 - 0 :D
-
[youtube]http://www.youtube.com/watch?v=bCAZPHGP-VI[/youtube]
-
lol :L
-
[youtube]http://www.youtube.com/watch?v=4Tq08tnNBo4&feature=player_embedded[/youtube]
Not sure if you will understand couse there is polish lector also:
[youtube]http://www.youtube.com/watch?v=s668hdBwb-I&feature=player_embedded[/youtube]
http://www.joemonster.org/filmy/37442/Niesamowity_lot_BASE_jumpera
This one owns!
[youtube]http://www.youtube.com/watch?v=UkmjYUhjcmc&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=KBJXZBrC5is&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=fZmAakumN-Y&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=yoOwCSgvNs0&feature=player_embedded[/youtube]
-
http://videosift.com/video/Anti-Masturbation-VS-Louis-CK
-
[youtube]http://www.youtube.com/watch?v=EJpP7ZId-mc[/youtube]
-
This one owns!
[youtube]http://www.youtube.com/watch?v=UkmjYUhjcmc&feature=player_embedded[/youtube]
hahaaa, she got owned :L
-
Woo 5,000th post in the topic. 8)
(http://artoftrolling.files.wordpress.com/2011/08/chatroulette-trolling-untitled37.jpg)
-
Firefox, Chrome, Opera, Safari but last one i dunno, toliet looks shitty so for sure IE.
P.S "a fun game for all family" LOL
-
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-snc7/314209_267053493306217_133455056666062_1161257_209814_n.jpg)
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-snc7/306101_267053506639549_133455056666062_1161258_5347002_n.jpg)
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc7/293609_267053519972881_133455056666062_1161259_7244906_n.jpg)
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-ash4/291790_267053539972879_133455056666062_1161260_2290076_n.jpg)
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-snc7/315809_267053563306210_133455056666062_1161261_5161277_n.jpg)
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-ash4/302914_267053599972873_133455056666062_1161263_8316206_n.jpg)
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-ash4/315776_267053663306200_133455056666062_1161267_1591691_n.jpg)
(http://a2.sphotos.ak.fbcdn.net/hphotos-ak-snc7/320166_267053799972853_133455056666062_1161276_6519505_n.jpg)
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-ash4/303656_267053813306185_133455056666062_1161277_8031791_n.jpg)
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-ash4/297143_267053819972851_133455056666062_1161278_2042548_n.jpg)
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-snc6/228842_267053849972848_133455056666062_1161281_7386087_n.jpg)
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-snc7/293556_267053899972843_133455056666062_1161286_5743397_n.jpg)
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-ash4/306731_267053946639505_133455056666062_1161291_2428056_n.jpg)
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-ash4/313873_267053979972835_133455056666062_1161294_8143300_n.jpg)
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-ash4/312065_267053989972834_133455056666062_1161295_600791_n.jpg)
(http://a2.sphotos.ak.fbcdn.net/hphotos-ak-snc7/320610_267054009972832_133455056666062_1161297_831090_n.jpg)
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-ash4/311693_267054039972829_133455056666062_1161300_7754987_n.jpg)
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-ash4/298321_267054073306159_133455056666062_1161303_4639396_n.jpg)
:L :L :L :L :L :L :L :L :L
this is a bug in gta san andreas in the car ahah
(http://28.media.tumblr.com/tumblr_llgbkourSF1qzmowao1_500.png)
(http://29.media.tumblr.com/tumblr_lpfrdpoxQR1qdqk39o1_500.jpg)
-
lol that pinguin one :L
-
lol that pinguin one :L
ty this is for you ;)
(http://i.imgur.com/BSnWr.gif)
ROFL
-
haha lol
-
[youtube]http://www.youtube.com/watch?v=cxsjDOSgWdA[/youtube]
-
looooooooooooooooooooool :L :L :L :L :L
-
hahah :L :L
-
rofl :L
-
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-ash4/293914_267208079957425_133455056666062_1162262_5200919_n.jpg)
-
haha
-
[youtube]http://www.youtube.com/watch?v=TKE2TdVgmbM[/youtube]
OMG I CAN'T STOP LOLING
-
(http://graphjam.files.wordpress.com/2011/08/funny-graphs-cds-are-too-mainstream.gif)
-
(http://adrenalinex.co.uk/randomimage) :L :L
random phtos
-
Can't stop loling at this video. :L
[youtube]ambm6D3H7rI[/youtube]
And a large cheese with cheese! :L :L
-
[youtube]http://www.youtube.com/watch?v=TKE2TdVgmbM[/youtube]
OMG I CAN'T STOP LOLING
my biggest fan since 2008 lol
-
LMAO
[youtube]http://www.youtube.com/watch?v=gexwFIC1xjQ&feature=related[/youtube]
-
(http://i.imgur.com/oSEwo.jpg)
8)
-
hahahahah i think i've seen that guy somewhere before, maybe someone on jeremy kyle or from bristol
-
:L
-
(http://obczaj.net/obrazki/151820.jpg)
(http://obczaj.net/obrazki/151822.jpg)
(http://obczaj.net/obrazki/151828.jpg)
(http://obczaj.net/obrazki/151831.jpg)
(http://obczaj.net/obrazki/151881.jpg)
(http://obczaj.net/obrazki/151919.jpg)
(http://obczaj.net/obrazki/151652.jpg)
(http://obczaj.net/obrazki/151657.jpg)'
american versions of 'Harry Potter' cast:
(http://obczaj.net/obrazki/151662.jpg)
short story of noob helicopter:
(http://obczaj.net/obrazki/151776.jpg)
(http://obczaj.net/obrazki/151777.jpg)
(http://obczaj.net/obrazki/151778.jpg)
(http://obczaj.net/obrazki/151779.jpg)
intresting places:
(http://obczaj.net/obrazki/151783.jpg)
(http://obczaj.net/obrazki/151784.jpg)
(http://obczaj.net/obrazki/151785.jpg)
(http://obczaj.net/obrazki/151786.jpg)
-
(http://obczaj.net/obrazki/151828.jpg)
(http://obczaj.net/obrazki/151831.jpg)
:L :L :L
-
owns:
(http://obczaj.net/obrazki/151787.jpg)
(http://obczaj.net/obrazki/151788.jpg)
(http://obczaj.net/obrazki/151789.jpg)
(http://obczaj.net/obrazki/151790.jpg)
(http://obczaj.net/obrazki/151791.jpg)
(http://obczaj.net/obrazki/151792.jpg)
(http://obczaj.net/obrazki/151793.jpg)
(http://obczaj.net/obrazki/151794.jpg)
(http://obczaj.net/obrazki/151795.jpg)
(http://obczaj.net/obrazki/151796.jpg)
(http://obczaj.net/obrazki/151797.jpg)
(http://obczaj.net/obrazki/151798.jpg)
(http://obczaj.net/obrazki/151799.jpg)
(http://obczaj.net/obrazki/151800.jpg)
(http://obczaj.net/obrazki/151801.jpg)
(http://obczaj.net/obrazki/151802.jpg)
(http://obczaj.net/obrazki/151803.jpg)
(http://obczaj.net/obrazki/151804.jpg)
(http://obczaj.net/obrazki/151805.jpg)
(http://obczaj.net/obrazki/151806.jpg)
(http://obczaj.net/obrazki/151807.jpg)
(http://obczaj.net/obrazki/151808.jpg)
(http://obczaj.net/obrazki/151809.jpg)
(http://obczaj.net/obrazki/151810.jpg)
(http://obczaj.net/obrazki/151811.jpg)
-
hahaha omg :L :L
-
intresting places:
(http://obczaj.net/obrazki/151783.jpg)
(http://obczaj.net/obrazki/151784.jpg)
(http://obczaj.net/obrazki/151785.jpg)
(http://obczaj.net/obrazki/151786.jpg)
:L
-
[youtube]http://www.youtube.com/watch?v=MtVIUPscC9A&feature=player_embedded[/youtube]
(http://vader.joemonster.org/upload/zot/512_628420db0ecf3d3.jpg)
(http://vader.joemonster.org/upload/zot/512_6284184ff069121.jpg)
(http://vader.joemonster.org/upload/zot/512_628421e8997b9f4.jpg)
(http://vader.joemonster.org/upload/zot/512_6284227023e2725.jpg)
(http://vader.joemonster.org/upload/zot/512_628423ec56b48b6.jpg)
(http://vader.joemonster.org/upload/zot/6284245e4715d57.jpg)
(http://vader.joemonster.org/upload/zot/512_628426d39b6d159.jpg)
(http://vader.joemonster.org/upload/zot/512_628427bdf46aed10.jpg)
(http://vader.joemonster.org/upload/zot/512_628428279a791f11.jpg)
(http://vader.joemonster.org/upload/zot/512_62842926db2e0212.jpg)
(http://vader.joemonster.org/upload/zot/512_6284305c6f69df13.jpg)
(http://vader.joemonster.org/upload/zot/512_628431eb353dc814.jpg)
(http://vader.joemonster.org/upload/zot/512_6284321045432d15.jpg)
(http://vader.joemonster.org/upload/zot/512_6284340de254fe17.jpg)
(http://vader.joemonster.org/upload/zot/512_628435c4a0bfbc18.jpg)
(http://vader.joemonster.org/upload/zot/512_628436f472f19619.jpg)
(http://vader.joemonster.org/upload/zot/628437422d178d20.jpg)
(http://vader.joemonster.org/upload/zot/512_6284380cd8629921.jpg)
(http://vader.joemonster.org/upload/zot/512_6284391d244afc22.jpg)
(http://vader.joemonster.org/upload/zot/628440ec05381423.jpg)
(http://vader.joemonster.org/upload/zot/512_628441d3b2552624.jpg)
(http://vader.joemonster.org/upload/zot/512_62844280e9331225.jpg)
(http://vader.joemonster.org/upload/zot/512_62844365e3f0c526.jpg)
(http://vader.joemonster.org/upload/zot/512_628444fa09a9e627.jpg)
(http://vader.joemonster.org/upload/zot/628445614ed74028.jpg)
(http://vader.joemonster.org/upload/zot/512_628446fd096c8029.jpg)
(http://vader.joemonster.org/upload/zot/512_6284486150684831.jpg)
(http://vader.joemonster.org/upload/zot/512_6284497ae4c46332.jpg)
(http://vader.joemonster.org/upload/zot/512_6284477d65bb6f30_special.jpg)
-
omg :L :L :L
-
haha rofl :L
-
perfectly safe for work :L
-
hahahahaha
-
haha :L
-
(http://i.imgur.com/x6kh7.jpg)
-
[youtube]http://www.youtube.com/watch?v=KK4Z7QlqnX8[/youtube]
-
[youtube]http://www.youtube.com/watch?v=_kI9xhIJTFk[/youtube]
[youtube]http://www.youtube.com/watch?v=v-T425L85uQ[/youtube]
[youtube]http://www.youtube.com/watch?v=M7LF0fwMZ_o[/youtube]
-
[youtube]http://www.youtube.com/watch?v=j51A_2pavEo&feature=related[/youtube]
XDDDD
-
Wow, getting trance tune with a guitar. PRO
[youtube]http://www.youtube.com/watch?v=eXqPYte8tvc&feature=player_embedded[/youtube]
-
^ :o
-
[youtube]HThx6vsq7w4[/youtube]
[youtube]bMHApq8zSYM[/youtube]
-
Fuuuu
-
i only posted this here because i love this "internet anime"... that green guy is hilarious... xD
[youtube]http://www.youtube.com/watch?v=9UikCf4HyoY[/youtube] [youtube]http://www.youtube.com/watch?v=qa3XCEBwX-k[/youtube]
[youtube]http://www.youtube.com/watch?v=j3n_IkqcPV0[/youtube] [youtube]http://www.youtube.com/watch?v=QclETzGxYtg[/youtube]
[youtube]http://www.youtube.com/watch?v=l0nDTacTyNA[/youtube] [youtube]http://www.youtube.com/watch?v=jx6nYP_eDDg[/youtube]
hakuna matata! *PUNCH* xD
-
haha, that's cool, i'm gonna watch the rest of the episodes :L
-
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-ash4/295929_269719743039592_133455056666062_1171777_4583791_n.jpg)
:L
-
[youtube]http://www.youtube.com/watch?v=lP9kY9S2Ejc&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=71vI5hvG-xQ&feature=player_embedded#![/youtube]
-
(http://img.photobucket.com/albums/v207/OdDsOcK/sniper.gif)
-
[youtube]http://www.youtube.com/watch?v=W0U84z_SZv4&feature=related[/youtube]
-
omg what an asshole, i dont get why people like him don't feel bad saying such things on tv
-
i'm surprised you could even understand him :L i had trouble
-
I found it easy
-
i suppose it's easier to understand english more than it would be for me to understand czech or estonian i guess so i find it hard to imagine :L
-
i'm surprised you could even understand him :L i had trouble
i had it too :L
i suppose it's easier to understand english more than it would be for me to understand czech or estonian i guess so i find it hard to imagine :L
yeah, probably
-
(http://pics.kuvaton.com/kuvei/amount_of_acting_classes_needed.jpg)
(http://pics.kuvaton.com/kuvei/wii.jpg)
(http://pics.kuvaton.com/kuvei/mopo_crash.jpg)
(http://pics.kuvaton.com/kuvei/fuck_the_exam_comic.png)
-
[youtube]http://www.youtube.com/watch?v=giR6VDZjpa4[/youtube]
-
LOL! I don't want to image how she felt after she got some smoke
-
I don't think this is the only DNA test we have to do...
(http://i.imgur.com/jHg05.jpg)
:L
-
haha :L
-
[youtube]http://www.youtube.com/watch?v=W0U84z_SZv4&feature=related[/youtube]
and not a single fuck was given that day..... now seriously, that douche is totally a bigger asshole than all the assholes in the world together shiiiiit
-
he has no confidence at all lol
-
or he just went there for fun
-
[youtube]http://www.youtube.com/watch?v=lUQqNOhxeQY[/youtube]
[youtube]http://www.youtube.com/watch?v=6-CbFnKcUug[/youtube]
[youtube]http://www.youtube.com/watch?v=0VOuQ-Uf5Gs[/youtube]
-
[youtube]http://www.youtube.com/watch?v=oNh8AT_FFuc[/youtube]
-
lol this is gross but so funny. NSFW:
click me (http://trololololololololololo.com/)
-
lol here's one remix... \m/
[youtube]http://www.youtube.com/watch?v=Qw7LEIDFCX4[/youtube]
-
2:20 - 2:40+ ftw
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
-
(http://chzmemebase.files.wordpress.com/2011/08/memes-lego-my-sanity.jpg)
-
(http://forum.adrenalinex.co.uk/Smileys/default/tRDvJjVtKsqb6zdWUBdiJt7emmc.gif)
-
[youtube]http://www.youtube.com/watch?v=yO9wOid1DMU&feature=player_embedded[/youtube]
-
lol
German girls
-
[youtube]http://www.youtube.com/watch?v=H0kxyGAubzM&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=3ZvL58nBC68&feature=player_embedded[/youtube]
-
Oscar and a drill:
[youtube]http://www.youtube.com/watch?v=KAfrQW3657c&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=7ALOPQUMryo&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=4-YIDmwv4pE&feature=player_embedded[/youtube]
-
(http://pics.kuvaton.com/kuvei/polishing.jpg)
-
:L
-
lol :L
-
^ :L
(http://www.realoakfloors.co.uk/media/24_Parkett_Flooring_Polish_1L.jpg)
ivanduk:
(http://chzmemebase.files.wordpress.com/2011/06/memes-i-still-dont-get-it.jpg)
-
hahaha :L :L
-
hahaha :L :L
btw ivan that's a seagull in your avatar (http://forum.adrenalinex.co.uk/Smileys/default/tRDvJjVtKsqb6zdWUBdiJt7emmc.gif)
-
O0 O0 O0 O0 O0 O0 O0 O0
(http://forum.adrenalinex.co.uk/Smileys/default/tRDvJjVtKsqb6zdWUBdiJt7emmc.gif)
-
rofl
-
(http://i144.photobucket.com/albums/r165/isy209/godzilla-facepalm-47886290990.jpg)
(http://i306.photobucket.com/albums/nn242/2poortufans/pedobear.gif)
(http://i734.photobucket.com/albums/ww347/fast_notch/FAIL%203/fail-owned-bike-fail.jpg)
(http://i1085.photobucket.com/albums/j424/Aubergine_Ace/1310499062292_1310536417.gif)
(http://i1122.photobucket.com/albums/l540/LIMEYLOVESHERTWINNIEO3O/WHITEFRIENDSISNOW.jpg)
-
(http://i1122.photobucket.com/albums/l540/LIMEYLOVESHERTWINNIEO3O/WHITEFRIENDSISNOW.jpg)
hahaha :L
-
[youtube]http://www.youtube.com/watch?v=JSowsD_Kbhg[/youtube]
-
haha cooljump :P
-
was so close O0
-
[youtube]http://www.youtube.com/watch?v=DK_9uBR0NAQ&feature=player_embedded[/youtube][youtube]http://www.youtube.com/watch?v=3v1MDtFP5lU&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=rRlbaa1BAvk&feature=player_embedded[/youtube][youtube]http://www.youtube.com/watch?v=EJ7HgHEGc2w&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=n1MhA0NGiRY&feature=player_embedded[/youtube]
-
[youtube]http://www.youtube.com/watch?v=6faZU4Y47rI[/youtube]
-
Contains strong language!!
[youtube]http://www.youtube.com/watch?v=pgQzRATYBjA[/youtube]
-
rofl
-
[youtube]http://www.youtube.com/watch?v=Q7Hl7oPKDpQ&feature=player_embedded#![/youtube][youtube]http://www.youtube.com/watch?v=0rr7uQyjyk4&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=OvW2xeSn4As&feature=player_embedded#![/youtube]
-
(http://i.imgur.com/4sD6z.png)
lol
-
^MSN Messenger Blurry Edition.
-
[youtube]http://www.youtube.com/watch?v=9QS0q3mGPGg&NR=1&feature=fvwp[/youtube]
:L
-
[youtube]http://www.youtube.com/watch?v=swowiMAHS0o[/youtube]
[youtube]http://www.youtube.com/watch?v=P5ShotO8GUs[/youtube]
[youtube]http://www.youtube.com/watch?v=G-VTPm5todw[/youtube]
[youtube]http://www.youtube.com/watch?v=EJ7HgHEGc2w[/youtube]
-
No video or picture.. but just from the forum:
Your last search was less than 5 seconds ago. Please try again later.
:L
-
[youtube]http://www.youtube.com/watch?v=cYNdUM2gRsg&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=QYTcf55B-oY&feature=player_embedded[/youtube]
-
LOL Sanderos video. I am surprised the presenters cracked. :L
-
^ lol
[youtube]http://www.youtube.com/watch?v=syBo8Y7tW2s&feature=aso[/youtube]
-
[youtube]http://www.youtube.com/watch?v=HVHb0t_TEs0[/youtube]
-
:L
-
lol
-
[youtube]http://www.youtube.com/watch?v=ynC0jLGBA_U[/youtube]
-
@Snoopy: lol Bristol is just Mummerset with lack of enthusiasm. :L
@CruzeS: :L
-
[youtube]http://www.youtube.com/watch?v=ynC0jLGBA_U[/youtube]
nice cat :L
-
:L :L :L :L :L :L :L :L :L :L :L :L nice cat :L :L :L :L :L :L :L :L :L noob dog :L :L
-
[youtube]http://www.youtube.com/watch?v=ynC0jLGBA_U[/youtube]
lol good vid. cat win :D
-
[youtube]http://www.youtube.com/watch?v=cTKU9_dqVUg&feature=player_embedded[/youtube]
-
Lmao cat!
-
(http://i.imgur.com/fJXqq.jpg)
(http://i.imgur.com/1cFn0.jpg)
-
lmao cookie
-
[youtube]http://www.youtube.com/watch?v=_ZXeFPpPJeI[/youtube]
-
:L :L :L
(http://chzragecomics.files.wordpress.com/2011/09/rage-comics-untitled.jpg)
-
(http://cheezcomixed.files.wordpress.com/2011/06/koma-comic-strip-marley-rage.jpg)
-
ush avatar :L
-
[youtube]http://www.youtube.com/watch?v=1hD6lN-_uAM&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=zKO-tZGuFDg&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=L6Cuq-BueEs[/youtube]
[youtube]http://www.youtube.com/watch?v=wZMZdQzoQgo&feature=related[/youtube]
-
Bonus . :p
[youtube]http://www.youtube.com/watch?v=0Yij6f5lVbk&feature=relmfu[/youtube]
-
Rofl...
[youtube]http://www.youtube.com/watch?v=lm_n3hg-Gbg&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=r3UGHFitODk&feature=fvwrel[/youtube]
[youtube]http://www.youtube.com/watch?v=zRjzXXWb91s&feature=fvwrel[/youtube]
[youtube]http://www.youtube.com/watch?v=Dwimc4cvUmQ&feature=relmfu[/youtube]
[youtube]http://www.youtube.com/watch?v=MyNSx7TXVqE&feature=relmfu[/youtube]
[youtube]http://www.youtube.com/watch?v=0D1bTjETpWU&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=3T3H_kMeXh0&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=zc8mmzURoyk&feature=related[/youtube]
Have more in youtube :p
-
:L
[youtube]http://www.youtube.com/watch?v=xdhLQCYQ-nQ[/youtube]
-
roflmao the way the cat jumps makes it look like it was thrown out of the box
-
(http://i.wp.pl/a/f/gif/27507/drogba.gif)
-
(http://i.imgur.com/4OW29.gif)
-
ROFL Nice kid :L
-
[youtube]http://www.youtube.com/watch?v=72lq9Q5edwU[/youtube]
-
for m4lysz & skunk
[youtube]http://www.youtube.com/watch?v=IxpPjpIK9mQ&feature=player_embedded[/youtube]
-
smoke rings are awesome!
-
[youtube]http://www.youtube.com/watch?v=C9Yd3XN_p4k[/youtube]
-
for m4lysz & skunk
[youtube]http://www.youtube.com/watch?v=IxpPjpIK9mQ&feature=player_embedded[/youtube]
thx for leaving me out :L
-
if you take 'pin-up girls' bit too serious...
(http://obczaj.net/obrazki/153290.jpg)
love these FAIL...
(http://obczaj.net/obrazki/153324.jpg)
(http://obczaj.net/obrazki/153373.jpg)
(http://obczaj.net/obrazki/153374.jpg)
(http://obczaj.net/obrazki/153421.jpg)
(http://obczaj.net/obrazki/153354.jpg)
-
for m4lysz & skunk
[youtube]http://www.youtube.com/watch?v=IxpPjpIK9mQ&feature=player_embedded[/youtube]
thx for leaving me out :L
sorry :(
-
[youtube]http://www.youtube.com/watch?v=YGOGrk25gko&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=JNu7do5sCv0&feature=related[/youtube]
-
http://forum.adrenalinex.co.uk/index.php?action=profile;u=11 (http://forum.adrenalinex.co.uk/index.php?action=profile;u=11)
mikeGT profile .
under his pic there is 2 links , : 1 for msn and 1 for his website ! try it !
-
:L :L :L
ppl say ufo in israel
[youtube]http://www.youtube.com/watch?v=zQ-bNOy_CKQ[/youtube]
but i say is Nadeo/maor with airbrake speedhax ahahah
-
but i say is Nadeo/maor with airbrake speedhax ahahah
lOl
-
(http://img685.imageshack.us/img685/135/unledyu.gif)
:L
-
that first one is true, when i bought dirt 3 the day it came out, there were no extra events to buy so you could progress but now there suddenly is.........
-
[youtube]http://www.youtube.com/watch?v=ZtJGKFq4DYk[/youtube]
heh that guy has never seen 'Manhatan' in GTA IV. Well guess what?! NEITHER HAVE I!!!
-
(http://i.imgur.com/El1zV.png)
-
[youtube]http://www.youtube.com/watch?v=pDxn0Xfqkgw[/youtube]
my favorites: "you've just been erased" or "hasta la vista, baby"
xD
-
[youtube]http://www.youtube.com/watch?v=bLq4Lz_D078[/youtube]
[youtube]http://www.youtube.com/watch?v=uuaJF9S8r7M[/youtube]
[youtube]http://www.youtube.com/watch?v=c3YZqUhB9u8[/youtube]
-
[youtube]http://www.youtube.com/watch?v=uuaJF9S8r7M[/youtube]
lololol
-
some portuguese regional rally... the co-pilot is pissed off with the driver.. lol
for me, the best part is on 1:44 when co-pilot screams "trava! trava! DEVAGAR CARALHO! está muito sujo!" that it's something like: "brake! brake! SLOW FFS! it's too dirty!" :L and then, the gesture that driver makes to the public... :L and seconds later the driver says "WOOOO" :L :L :L
[youtube]http://www.youtube.com/watch?v=DhbJWq1mCdI[/youtube]
and another one from the same rally and same guys. in the beginning driver saying "there's a fucking citroen in 2nd place..." (talking about theirs) :L
[youtube]http://www.youtube.com/watch?v=-kaGvcoT3Jk[/youtube]
now, something different but equal... lol speed/racing/adrenaline...
LOL at the commentators....
[youtube]http://www.youtube.com/watch?v=zCMQPzKcFqs[/youtube]
PRO! and fast!
-
(http://chzragecomics.files.wordpress.com/2011/04/i-see-you.jpg)
(http://chzmemebase.files.wordpress.com/2011/04/memes-pass-me-that-blunt.jpg)
-
[youtube]http://www.youtube.com/watch?v=-H57zcozi7k[/youtube]
-
recived that rage message when he failed and quited in race.
(http://i.imgur.com/CIxHC.jpg)
any ideas what kaffir and poes means? :L
-
[youtube]http://www.youtube.com/watch?v=JclZxpJdkD0[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=ZrEZVEWPj6o[/youtube]
-
[youtube]http://www.youtube.com/watch?v=N7xk1n1a45I&list=PL17D9987649F80D9E&index=14[/youtube]
;D
-
(http://artoftrolling.files.wordpress.com/2011/04/chatroulette-trolling-untitled19.jpg)
(http://chzmemebase.files.wordpress.com/2011/04/memes-tv-memes.jpg)
-
hahaha, sex and the city :L :L
---------------------------------
what the hell is this, lol
(http://i.imgur.com/rCoVp.jpg)
-
Has this already been posted?
[youtube]4drucg1A6Xk[/youtube]
-
yep, i think so
-
crazy..
[youtube]http://www.youtube.com/watch?v=xIe6hYAdw_I&feature=player_embedded[/youtube]
-
omg pro lol
-
Wow, that's pretty amazing. I got scared at the part with the dog. :L
-
yea, amazing and at 2.43 you can hear Spierdalac :L
-
my sausage before the fire :L
(http://img508.imageshack.us/img508/3843/p0409111828.jpg)
and my mad dinner few days ago :L
(http://img6.imageshack.us/img6/8672/p100911230201.jpg)
-
Creative :D
-
:L kielbasa
-
[youtube]http://www.youtube.com/watch?v=LhjFOjKwGmg&feature=related[/youtube]
release date: World: 16 September 2011
need to play this :L
-
I am laughing because it is a really boring game, but the graphics are really good and everything is realistic. :L
Usually I expect something like this for sim games:
[youtube]http://www.youtube.com/watch?v=rD7bjKo1uEc[/youtube]
-
(http://img14.imageshack.us/img14/167/130746075211photo.jpg)
(http://img691.imageshack.us/img691/9522/186kj.jpg)
(http://img851.imageshack.us/img851/407/perfectlytimedphotoscomf.jpg)
(http://img27.imageshack.us/img27/3299/mcdonalda.jpg)
-
[youtube]http://www.youtube.com/watch?v=bShUwehhARg[/youtube]
best reaction i found
macho boy rules
-
http://www.youtube.com/watch?v=bShUwehhARg
best reaction i found
macho boy rules
haha :L
-
[youtube]http://www.youtube.com/watch?v=1hAv1frMX_0[/youtube]
lol
-
2 chat bots, well, chatting...
[youtube]WnzlbyTZsQY[/youtube]
-
(http://www.rotfllol.com/pdata/588.jpg)
(http://www.rotfllol.com/pdata/584.jpg)
(http://www.rotfllol.com/pdata/578.jpg)
(http://www.rotfllol.com/pdata/574.jpg)
(http://www.rotfllol.com/pdata/569.jpg)
(http://www.rotfllol.com/pdata/560.jpg)
(http://www.rotfllol.com/pdata/564.gif)
-
(http://www.rotfllol.com/pdata/569.jpg)
lols
-
You have to see these videos :L :
[youtube]http://www.youtube.com/watch?v=o71kCuva4B4[/youtube]
[youtube]http://www.youtube.com/watch?v=i_St7LbeeiM[/youtube]
[youtube]http://www.youtube.com/watch?v=ArMKLWaW5SI[/youtube]
[youtube]http://www.youtube.com/watch?v=UHqPzaUrMDQ[/youtube]
[youtube]http://www.youtube.com/watch?v=3Gy0EkpIdj8[/youtube]
poor cats ;(
[youtube]http://www.youtube.com/watch?v=ZBPruEyTGr0[/youtube]
loool:
[youtube]http://www.youtube.com/watch?v=5YsOZza65v4&feature=related[/youtube]
-
I found this hilarious, but now I feel like a terrible person.
[youtube]http://www.youtube.com/watch?v=08parivWs1Q[/youtube]
-
it's lovely to see two gay men so happy in love.
(http://i.imgur.com/Ya5dl.jpg)
(http://i.imgur.com/FwnEQ.jpg)
(http://i.imgur.com/S8zlX.jpg)
(http://i.imgur.com/sTIDo.jpg)
-
it's lovely to see two gay men so happy in love.
:L :L
-
[youtube]http://www.youtube.com/watch?v=4gAtvrYrB7k&feature=related[/youtube]
-
Not so much a difference between US and Europe but more of a difference between how you treat men and women. :L
-
(http://i53.tinypic.com/2irajph.gif)
-
rofl :L
-
For ZDHISHDIHXUCHYU_STUNTER
[youtube]http://www.youtube.com/watch?v=nOcjMDSEfXY[/youtube]
-
Lol
-
lol :L
-
(http://chzmemebase.files.wordpress.com/2011/09/memes-woopwoopwoop.jpg)
-
(http://i53.tinypic.com/2irajph.gif)
:L :L :L
-
[youtube]http://www.youtube.com/watch?v=itZ87ioaS7Y[/youtube]
wtf?
[youtube]http://www.youtube.com/watch?v=7G46YMyQjBY[/youtube]
-
[youtube]http://www.youtube.com/watch?v=Jup836e2qtE&feature=player_embedded[/youtube]
lol
-
Lolool
-
[youtube]http://www.youtube.com/watch?v=gSQxfl7rwTI[/youtube]
-
hahaha
-
lmao nice
-
(http://cheezpictureisunrelated.files.wordpress.com/2011/03/wtf-photos-videos-classic-grandmas-bookmarks.jpg)
(http://chzmemebase.files.wordpress.com/2011/03/memes-simpsons-surprise-crossover.jpg)
-
hahaha
-
[youtube]http://www.youtube.com/watch?v=-uCHtlf9Hpk[/youtube]
[youtube]http://www.youtube.com/watch?v=dRIa_5ErXbw[/youtube]
[youtube]http://www.youtube.com/watch?v=CzJOY0nzKIw[/youtube]
mooman And Friends:
[youtube]http://www.youtube.com/watch?v=lXKDu6cdXLI[/youtube] :L
[youtube]http://www.youtube.com/watch?v=BzMv6kVsPdA[/youtube]
-
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s720x720/310517_10150312650057545_183082232544_8032413_546628694_n.jpg)
lol
-
i laughed so much when i've seen this :L
[youtube]http://www.youtube.com/watch?v=9S75Rfva9O8[/youtube]
-
lol I thought it'd be some sexist stuff :L kinda like that old advert:
[youtube]http://www.youtube.com/watch?v=rC5aGCOT6bs[/youtube]
-
[youtube]http://www.youtube.com/watch?v=Q_OHxzzjiy8&[/youtube]
-
i laughed so much when i've seen this :L
[youtube]http://www.youtube.com/watch?v=9S75Rfva9O8[/youtube]
lol i wanted to post it too
-
i don't get it lol
-
:L that mr is hitler, mourad but she dont wanted to die so she turned the time back but then saw it was hitler so she is owned :L
-
ah lol
-
:L that mr is hitler, mourad but she dont wanted to die so she turned the time back but then saw it was hitler so she is owned :L
she didnt want to kill that hitler
-
[youtube]http://www.youtube.com/watch?v=YYuTfxctxU4&feature=player_embedded#![/youtube]
-
LOL
-
LOL
-
[youtube]http://www.youtube.com/watch?v=chXy4HF1ybQ
[/youtube]
:L :L :L :L
-
(http://verydemotivational.files.wordpress.com/2011/09/demotivational-posters-seems-legit15.jpg)
-
not funny but amazing 8)
[youtube]http://www.youtube.com/watch?v=74mhQyuyELQ[/youtube]
-
(http://i.imgur.com/cTXxj.jpg)
-
not funny but amazing 8)
[youtube]http://www.youtube.com/watch?v=74mhQyuyELQ[/youtube]
wow that is AMAZING!
-
On that video of flying over the world these are the top comments:
(http://i.imgur.com/Mh1T5.jpg)
So to save you the effort I went ahead and found the insightful comment in question...
(http://i.imgur.com/9nqcK.jpg)
-
On that video of flying over the world these are the top comments:
(http://i.imgur.com/Mh1T5.jpg)
So to save you the effort I went ahead and found the insightful comment in question...
(http://i.imgur.com/9nqcK.jpg)
lmao :L
-
Yesterday I saw this, and today when I was harvesting potatoes on the farm I remembered it and I couldn't stop chuckling. :L
(http://verydemotivational.files.wordpress.com/2011/09/demotivational-posters-taters.jpg)
I had to look away from everyone because if I got caught laughing I would have to explain why...which would be impossible.
-
lol great :L
-
(http://i.imgur.com/k8WRm.png)
-
cool grammar bro
-
[youtube]http://www.youtube.com/watch?v=lXKDu6cdXLI[/youtube]
8)
-
Wow, what an appreciative audience. 8)
-
nice picture lol
-
LOL watch 1st minute of GGN Ep. 7
[youtube]http://www.youtube.com/watch?v=FMBOAugTspk&feature=feedu[/youtube]
-
I like his rap at 3:56. :L
Edit: JESUS CHRIST HE WAS BORN IN 1976
-
[youtube]http://www.youtube.com/watch?v=-uCHtlf9Hpk[/youtube]
[youtube]http://www.youtube.com/watch?v=dRIa_5ErXbw[/youtube]
[youtube]http://www.youtube.com/watch?v=CzJOY0nzKIw[/youtube]
mooman And Friends:
[youtube]http://www.youtube.com/watch?v=lXKDu6cdXLI[/youtube] :L
[youtube]http://www.youtube.com/watch?v=BzMv6kVsPdA[/youtube]
i was faster m4 8)
-
[youtube]http://www.youtube.com/watch?v=UZMKHp46Hxs[/youtube]
[youtube]http://www.youtube.com/watch?v=fiwK5hijjV0[/youtube]
-
Damn son, Spongebob just got serious. :o
[youtube]http://www.youtube.com/watch?v=l-Q8Vhk5Qjc[/youtube]
[youtube]http://www.youtube.com/watch?v=3pgRLFjDPpY[/youtube]
-
:L :L :L :L :L at both
-
(http://i.imgur.com/0apZz.gif)
-
huh? ???
-
huh? ???
It's taken from an old children's book/cartoon called Thomas The Tank Engine.
(http://londonparticulars.files.wordpress.com/2010/08/thomas-the-tank-engine.jpg)
-
http://www.sadistic.pl/rosyjska-kamienica-vt88366.htm
[youtube]http://www.youtube.com/watch?v=CQqf1yoRwxA[/youtube]
[youtube]http://www.youtube.com/watch?v=7T5ev0smgGw[/youtube]
-
http://www.sadistic.pl/rosyjska-kamienica-vt88366.htm
For some reason I don't want to click on that link :L
-
why?
its just video that i didnt found on youtube
-
[youtube]http://www.youtube.com/watch?v=IEjBn25kvWQ[/youtube]
-
I don't mean to offend any indians or sth
these arent the real meaning of the translations
[youtube]http://www.youtube.com/watch?v=6AHq78O7BX0[/youtube]
[youtube]http://www.youtube.com/watch?v=bLpROhIg9eA&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=zDKcevMFUCo&feature=related[/youtube]
:L sorry if its old
-
hahaha yeah good old indian songs :L
-
[youtube]http://www.youtube.com/watch?v=YYuTfxctxU4&feature=player_embedded#![/youtube]
PES is always better :L
[youtube]http://www.youtube.com/watch?v=vOgpt6J47Nc[/youtube]
-
[youtube]http://www.youtube.com/watch?v=YYuTfxctxU4&feature=player_embedded#![/youtube]
PES is always better :L
[youtube]http://www.youtube.com/watch?v=vOgpt6J47Nc[/youtube]
LOL i think animation has gone too far and realistic :L :L
-
Rofl :L
-
[youtube]http://www.youtube.com/watch?v=mtCwNa4Ra1U&feature=related[/youtube]
-
OMG The PES one is soooooo funny. :L
-
:'( [youtube]http://www.youtube.com/watch?v=QCb_XPRkMFg[/youtube]
[youtube]http://www.youtube.com/watch?v=VJNBfBr-OGU[/youtube]
LOOL:
[youtube]http://www.youtube.com/watch?v=nwO2cJRLqN8[/youtube]
[youtube]http://www.youtube.com/watch?v=bhj9yq2GXbM[/youtube]
couldn't find it on youtube so: http://www.sadistic.pl/bez-hamulcow-vt88869,15.htm
-
[youtube]http://www.youtube.com/watch?v=J9TyqT0Erpk[/youtube]
-
someone sent me this but i forgot who :L :L
(http://i.imgur.com/raoGt.png)
-
:L :L
-
lol
-
:L
-
:L
-
someone sent me this but i forgot who :L :L
(http://i.imgur.com/raoGt.png)
ogitrev
-
mooman has a lot of work here :L
[youtube]koTCXbV0jEw[/youtube]
[youtube]gxRwbQcCN4s[/youtube]
-
haha ken leeee :L
we have something like this here too:
0.08 - 0.47
[youtube]http://www.youtube.com/watch?v=Z74Av3ZHJgU[/youtube]
-
[youtube]http://www.youtube.com/watch?v=hGT3ypJHc9w[/youtube]
[youtube]http://www.youtube.com/watch?v=BU62jg568Dk[/youtube]
-
hmmm...
(http://i.imgur.com/WJGDI.png)
-
lmao
-
LOLO
-
[youtube]http://www.youtube.com/watch?v=FUKQgOzJgEs&feature=player_embedded[/youtube]
-
(http://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-snc7/294086_249426808427905_199635993406987_629529_1038761686_n.jpg)
a bit in a rush I guess
-
(http://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-snc7/294086_249426808427905_199635993406987_629529_1038761686_n.jpg)
a bit in a rush I guess
loool, such an accident that makes you an idiot?
-
(http://i.imgur.com/LMVvN.jpg)
(http://i.imgur.com/iZB3E.jpg)
(http://i.imgur.com/3YIHu.jpg)
(http://i.imgur.com/ZkwPu.jpg)
-
haha good ones
-
[youtube]http://www.youtube.com/watch?v=n4FagAsSSJo[/youtube]
-
hahahaha baby on board
-
it isnt funny but amazing:
[youtube]http://www.youtube.com/watch?v=qqhlfz9GQPE[/youtube]
-
nice
-
the best youtube movie
-
[youtube]http://www.youtube.com/watch?v=wAEm_M1flbE&feature=feedrec_grec_index[/youtube]
-
omg robot voice is like "oooooooo, aaaaah, awwwwwww, laaaaaaa, laaaaaaawl"
-
i feel strange:
[youtube]http://www.youtube.com/watch?v=LMnaDcGrV3s[/youtube]
-
:L
[youtube]http://www.youtube.com/watch?v=QYm-dT24iRY[/youtube]
[youtube]http://www.youtube.com/watch?v=xwoCQPwJV5M[/youtube]
[youtube]http://www.youtube.com/watch?v=onUqCPupBPg[/youtube]
-
omg that last guy must be crazy
-
he's so lucky his feet didn't hit the edge
-
hmmm...
(http://i.imgur.com/WJGDI.png)
wtf not again
-
FOR MOOMAN
[youtube]q_gfD3nvh-8[/youtube]
[youtube]PYVMk71lpwI[/youtube]
[youtube]ovVfLancwys[/youtube]
[youtube]NjWq8YrkSJw[/youtube]
[youtube]olLDrvc1qt4[/youtube]
-
(http://i.imgur.com/ZrOZd.png)
-
lmaoooooooooooooooooo
-
hahah XD wtf
-
lol, nice fail
-
ROFLMAO WTF
-
[youtube]http://www.youtube.com/watch?v=PppCMRWemR0&feature=player_embedded[/youtube]
-
[youtube]http://www.youtube.com/watch?v=JtuYHgnhxfE[/youtube]
crazy woman with bonus racism at the end!
-
[youtube]http://www.youtube.com/watch?v=ZrK4llAu2T0&feature=player_embedded&noredirect=1[/youtube]
-
lol :L
-
[youtube]http://www.youtube.com/watch?v=JtuYHgnhxfE[/youtube]
crazy woman with bonus racism at the end!
woop racism always a good call :L
-
[youtube]http://www.youtube.com/watch?v=JtuYHgnhxfE[/youtube]
crazy woman with bonus racism at the end!
i guess someone wasn't satisfied with the bucket of chicken
-
[youtube]http://www.youtube.com/watch?v=u6f9TyXNs6w[/youtube]
-
holy fuck hahaha I think Im no longer hungry
-
omg lol
-
hahah xD
-
im disgusted bleahhh
(http://amicio.altervista.org/forum/html/emoticons/36_2_16.gif)
-
(http://images.cheezburger.com/completestore/2011/10/14/f14bdf43-7626-4a58-a922-99a29da7617b.jpg)
duelboy - based on a true story
-
he told me he wanted to make german boy pissed off, in my eyes his a winner
-
Ya dun goofed son! :L
[youtube]dYrlj9VE2fg[/youtube]
-
:L :L :L
[youtube]http://www.youtube.com/watch?v=xp4QVYNAFcQ&feature=player_embedded[/youtube]
-
[youtube]http://www.youtube.com/watch?v=RQWWbr6qKM0[/youtube]
-
:L
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/359803_700b.jpg)
-
"He doesn't understand, he's a dog." hahahaha :L :L
-
"because you're an ocean that's a lot of water to replace" :L
-
I don't find them funny.
-
he told me he wanted to make german boy pissed off, in my eyes his a winner
merc pays lot of attention of me
-
[youtube]http://www.youtube.com/watch?v=wJr48sjvz-E[/youtube]
-
[youtube]http://www.youtube.com/watch?NR=1&v=GL4hyATkQ74[/youtube]
-
I remember this since it was on the pc we had back in the days:
[youtube]http://www.youtube.com/watch?v=n8HJ5Izlk_0[/youtube]
-
[youtube]http://www.youtube.com/watch?v=RY66BCxlSkw[/youtube]
-
hahaha at the rage at 1:05
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=S2oymHHyV1M[/youtube]
-
wow that must of been scary for the guy
-
wow that guy got demolished
-
Holy fuck :o
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=S2oymHHyV1M[/youtube]
o kurwa!
-
[youtube]http://www.youtube.com/watch?v=czpwrg8zNls&feature=related[/youtube]
-
(http://lolsnaps.com/upload_pic/16.jpg)
-
lmao!^
-
hahah xD it works
-
omg lol
-
watch this :D
[youtube]http://www.youtube.com/watch?v=mJNjPSq4rnI[/youtube]
-
big brother is watching you !
(http://www.lanostratv.it/wp-content/uploads/2011/02/big-brother-is-watching-you.png)
http://www.gigapixel.com/image/gigapan-canucks-g7.html (http://www.gigapixel.com/image/gigapan-canucks-g7.html)
-
[youtube]http://www.youtube.com/watch?v=cKHiPfNIBpY[/youtube]
lol:
[youtube]http://www.youtube.com/watch?v=ZbKAIydXLvU[/youtube]
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/385033_700b_v1.jpg)
-
(http://artoftrolling.files.wordpress.com/2011/10/chatroulette-trolling-we-all-knew-it-was-coming.jpg)
-
[youtube]http://www.youtube.com/watch?v=b0HYoBppGHk&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=ZZrY1jMcmO0&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?v=9A4UGtM4hDQ[/youtube]
lol:
http://www.sadistic.pl/metalowe-konie-vt90552.htm?sid=95d1a8a40c7272a85b8e98b7c3b30332
-
[youtube]http://www.youtube.com/watch?v=H-o2kE7db9M&list=LLAymVz8uCBzswWZ8kbQi87A&index=23[/youtube]
[youtube]http://www.youtube.com/watch?v=UoUien5geyY[/youtube]
[youtube]http://www.youtube.com/watch?v=i61nF7-R5n4[/youtube]
-
(http://i53.tinypic.com/6ixiec.jpg)
-
(http://i56.tinypic.com/24bosvs.jpg)
-
ENJOY:
[youtube]http://www.youtube.com/watch?v=3Mrjx1KsrNA[/youtube]
[youtube]http://www.youtube.com/watch?v=y_wkQBDDgvI[/youtube]
[youtube]http://www.youtube.com/watch?v=nSPtz7wVDHI[/youtube]
[youtube]http://www.youtube.com/watch?v=CLlnYVAmx-k[/youtube]
[youtube]http://www.youtube.com/watch?v=mV-gnh1En6E[/youtube]
[youtube]http://www.youtube.com/watch?v=0t71cexWzvM[/youtube]
[youtube]http://www.youtube.com/watch?v=T3DSDybuBsU[/youtube]
-
heh
-
(http://i.imgur.com/7Am2T.gif)(http://i.imgur.com/7Am2T.gif)(http://i.imgur.com/7Am2T.gif)
this is cool =)
-
[youtube]DMPwsUey0U0[/youtube]
-
lol :L
-
this happens when you give your phone to someone when drinking
(http://i.imgur.com/grZNa.jpg)
-
(http://chanon.ro/b/src/131764772996.jpg) LOL
-
[youtube]http://www.youtube.com/watch?v=4pCfmqO197A&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=hPIquf2uErc&feature=related[/youtube]
-
both aren't funny but nice:
[youtube]http://www.youtube.com/watch?v=HbTs3TLo414[/youtube]
[youtube]http://www.youtube.com/watch?v=9DItbharEN8[/youtube]
[youtube]http://www.youtube.com/watch?v=VN2PnmK5KGY[/youtube]
For Polish People:
Bear Grylls Parody
[youtube]http://www.youtube.com/watch?v=YFOmE7vhk4Q[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=uuaJF9S8r7M[/youtube]
by overlook ahahah
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=yKWoPlL2B8I[/youtube]
[youtube]http://www.youtube.com/watch?v=GPuG1ruG_4o&feature=related[/youtube]
:L :L :L :L 50 sec
v
[youtube]http://www.youtube.com/watch?v=jFHw6nXd5k8&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=yKWoPlL2B8I[/youtube]
nice
-
That's crazy;
[youtube]http://www.youtube.com/watch?v=nTasT5h0LEg[/youtube]
-
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-ash4/393500_231704786891805_100001568572511_671646_1203568542_n.jpg)
-
lol
shouldnt it be 16 years old ?
-
(http://img.turbo.fr/01437398-photo-ford-escort-1995-escort-1-4i.jpg)
-
[youtube]http://www.youtube.com/watch?v=pE6lktbtH3U&feature=player_embedded[/youtube]
-
Lets dance lol
http://www.dumpert.nl/mediabase/1769271/3831bda1/in_da_zoo.html
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/395440_460s.jpg)
-
[youtube]http://www.youtube.com/watch?v=eo1r43Wy0nY[/youtube]
-
pro keeper
-
(http://i1.kwejk.pl/site_media/obrazki/2011/11/d7a830dcebbf8294c4f866881868c1b3.gif?1320237567)
-
lol
-
nice :L
-
(http://img52.imageshack.us/img52/2008/lolfdc.png)
snoopy like this pic :D :L
i think with balentin_vettina i didn't insulted nothing :D
-
He gave those private informations about him by his own, nobody forced him to. I remember he was asking many people, me included, if I had facebook etc, if somebody doesn't want people to get private information they don't tell private informations.
Plus, he's on a bad side to criticize that, he took pictures from AX people's facebook account (so restricted to 'friends') to put them on youtube, on public videos, without even asking.
-
lol what a tard
-
lol:
[youtube]http://www.youtube.com/watch?v=x43dCWkDWFU&feature=player_embedded[/youtube]
-
lol what a tard
^init
-
[youtube]http://www.youtube.com/watch?v=fhb7pkvLbBs&feature=player_embedded[/youtube]
-
http://mrdoob.com/projects/chromeexperiments/google_gravity/
-
http://mrdoob.com/projects/chromeexperiments/google_gravity/
:L :L :L :L :L :L :L :L :L :L :L :L :L :L
-
(http://i1.kwejk.pl/site_media/obrazki/2011/11/d7a830dcebbf8294c4f866881868c1b3.gif?1320237567)
Road warrior in his sabre :D
-
more like shoting 'round and round' scene from movie "Dukes of Hazzard"
-
1 of best burnouts ever seen lol
3:25 :o
[youtube]http://www.youtube.com/watch?v=unwujSVpZwA[/youtube]
-
[youtube]http://www.youtube.com/watch?v=_Fe17mCBzAk[/youtube]
-
I like the burnout on bicycle, wish I could do that!
-
this is brilliant :L
[youtube]http://www.youtube.com/watch?v=VJNBfBr-OGU[/youtube]
-
[youtube]http://www.youtube.com/watch?v=XBVXPYTzczU[/youtube]
LOL :o
-
[youtube]http://www.youtube.com/watch?v=tC3YfM8q82w[/youtube]
[youtube]http://www.youtube.com/watch?v=il1BI5VzAUI[/youtube]
-
[youtube]http://www.youtube.com/watch?v=XBVXPYTzczU[/youtube]
LOL :o
blasphemy!
-
(http://i.imgur.com/FXyda.jpg)
-
huh?
-
. . . . . . . . . . . . . . . . . . . ________
. . . . . .. . . . . . . . . . . ,.-‘”. . . . . . . . . .``~.,
. . . . . . . .. . . . . .,.-”. . . . . . . . . . . . . . . . . .“-.,
. . . . .. . . . . . ..,/. . . . . . . . . . . . . . . . . . . . . . . ”:,
. . . . . . . .. .,?. . . . . . . . . . . . . . . . . . . . . . . . . . .\,
. . . . . . . . . /. . . . . . . . . . . . . . . . . . . . . . . . . . . . ,}
. . . . . . . . ./. . . . . . . . . . . . . . . . . . . . . . . . . . ,:`^`.}
. . . . . . . ./. . . . . . . . . . . . . . . . . . . . . . . . . ,:”. . . ./
. . . . . . .?. . . __. . . . . . . . . . . . . . . . . . . . :`. . . ./
. . . . . . . /__.(. . .“~-,_. . . . . . . . . . . . . . ,:`. . . .. ./
. . . . . . /(_. . ”~,_. . . ..“~,_. . . . . . . . . .,:`. . . . _/
. . . .. .{.._$;_. . .”=,_. . . .“-,_. . . ,.-~-,}, .~”; /. .. .}
. . .. . .((. . .*~_. . . .”=-._. . .“;,,./`. . /” . . . ./. .. ../
. . . .. . .\`~,. . ..“~.,. . . . . . . . . ..`. . .}. . . . . . ../
. . . . . .(. ..`=-,,. . . .`. . . . . . . . . . . ..(. . . ;_,,-”
. . . . . ../.`~,. . ..`-.. . . . . . . . . . . . . . ..\. . /\
. . . . . . \`~.*-,. . . . . . . . . . . . . . . . . ..|,./.....\,__
,,_. . . . . }.>-._\. . . . . . . . . . . . . . . . . .|. . . . . . ..`=~-,
. .. `=~-,_\_. . . `\,. . . . . . . . . . . . . . . . .\
. . . . . . . . . .`=~-,,.\,. . . . . . . . . . . . . . . .\
. . . . . . . . . . . . . . . . `:,, . . . . . . . . . . . . . `\. . . . . . ..__
. . . . . . . . . . . . . . . . . . .`=-,. . . . . . . . . .,%`>--==``
. . . . . . . . . . . . . . . . . . . . _\. . . . . ._,-%. . . ..`\
-
Hilarious live action trailer. One of the best trailers of war games :L
[youtube]http://www.youtube.com/watch?v=zuzaxlddWbk[/youtube]
-
[youtube]http://www.youtube.com/watch?v=dT_kD8zBglE&feature=feedrec_grec_index[/youtube]
-
watch this trailer, haven't seen any more stupid plot idea in any horror/thrillier movie ever!
[youtube]http://www.youtube.com/watch?v=6G5pyFhmAqE[/youtube]
-
So basically I got around 200 killers near my flat.
I think they smoke weed from Ush. :L
-
AHAHAHAAH GONNA WATCH IT FOR SURE
-
AHAHAHAAH GONNA WATCH IT FOR SURE
It's from 1st of April. Shame it wasn't here in the cinema. Gotta download it.
-
watch this trailer, haven't seen any more stupid plot idea in any horror/thrillier movie ever!
[youtube]http://www.youtube.com/watch?v=6G5pyFhmAqE[/youtube]
This is the best idea for a movie ever :L Think I'm gonna watch this stoned :L
LOL, while posting this reply I just thought, hm what movie didn't I see stoned? :L I see all movies stoned haha.
-
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-snc7/381945_10150452326876885_311478426884_10908749_1160722109_n.jpg)
-
^
(http://d24w6bsrhbeh9d.cloudfront.net/photo/530762_700b.jpg)
-
WORST ACTION MOVIE EVER! (2.30 min)
http://www.kalam.tv/fa/video/94376/index.html
-
lmao
-
WORST ACTION MOVIE EVER! (2.30 min)
http://www.kalam.tv/fa/video/94376/index.html
I like the car explosions and effects when the cars were about to crush him :L
-
LMFAO, that's hilarious :L
-
lolete :D
-
[youtube]myA2x_0fNuo[/youtube]
-
lmao, "oh kurwa"
-
haha the kurwas are the best part of that video
-
haha the kurwas are the best part of that video
I also see a lot of women who sell themselves in that video.
-
haha :(
-
kurwa!
-
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-ash4/390083_285423708155108_248563848507761_915072_1382384471_n.jpg)
-
Lmao :L
-
map of macdonalds fastfood resaurants in usa
(http://www.lemonde.fr/mmpub/ill/2011/11/11/ill_1602577_52e4_mcdo.jpg)
-
Holy ship! :o
-
Holy ship! :o
Holy rap! :O
-
WHAT THE FUNK???
-
(http://i0.ifrype.com/gallery/4d67784ab4e1c06f5ba96dcfefd251e1/238/580/v1/l_235238580.jpg)
(http://i7.ifrype.com/gallery/8ce1eb8919b6e0dcd1b318575bc901ac/238/577/v1/l_235238577.jpg)
(http://i5.ifrype.com/gallery/592a5170b8af7287ad7f22bf96d3d8d6/238/575/v1/l_235238575.jpg)
(http://i3.ifrype.com/gallery/a5250fe221101634147d621fed8b1b1d/238/573/v1/l_235238573.jpg)
(http://i2.ifrype.com/gallery/f23b4a4c6cfea042f4e9fdf91e14fe32/238/572/v1/l_235238572.jpg)
(http://i5.ifrype.com/gallery/bbcac060d11077476d5e2551e00be739/238/565/v1/l_235238565.jpg)
(http://i1.ifrype.com/gallery/6b1e80a44928cf12780d73db0159f3b7/238/561/v1/l_235238561.jpg)
(http://i7.ifrype.com/gallery/70fb706bab37efc7a7a65e8b664b1984/239/517/v1/l_235239517.jpg)
(http://i0.ifrype.com/gallery/37c8d428f5a77c5133874c4743119e7d/239/510/v1/l_235239510.jpg)
(http://i9.ifrype.com/gallery/f1482d6e30b4608d11e8ff3bc0f3dd79/239/509/v1/l_235239509.jpg)
(http://i6.ifrype.com/gallery/8f6225eb50be6d6671f2661d2ead6cb2/238/566/v1/l_235238566.jpg)
-
I LOL'd so fucking hard. xDDD
[youtube]http://www.youtube.com/watch?v=5QfNm3fcoqI&feature=player_embedded[/youtube]
-
lol thefuck..
-
[youtube]http://www.youtube.com/watch?v=aE3zESmcqwA[/youtube]
[youtube]http://www.youtube.com/watch?v=sNZ1pky4cZY[/youtube]
-
[youtube]http://www.youtube.com/watch?v=KgUIbPfhSuo[/youtube]
-
(http://cdn.blogosfere.it/internetepolitica/images/thend-anteprima-400x265-515789.jpg)
yes berlusconi gameover fucker bastard ! :L
Silvio Berlusconi resigns as PM
now i can sleep much better!
-
now he has enough time to spend his money on prostitues
-
^:L
-
now he has enough time to spend his money on prostitues
now and the past he spend money for prostitute how he call them escort :P
-
[youtube]http://www.youtube.com/watch?v=nwg9eLHZZRo[/youtube]
Programming excel must have been a torture hehe.
-
now he has enough time to spend his money on prostitues
bunga bunga tralalala fantastico
-
[youtube]http://www.youtube.com/watch?v=3far9oHZOsI[/youtube]
-
[youtube]http://www.youtube.com/watch?v=elv0y_XKhak[/youtube]
-
awesome 8)
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=ShFAeNdiEiA#![/youtube]
-
not funny but WTF
(http://pics.kuvaton.com/kuvei/marinetraffic.jpg)
-
scary lol
-
(http://pics.kuvaton.com/kuvei/laser_dot_cat.gif)
:L :L
-
(http://i.imgur.com/5Xrmh.gif)
-
rofl cat + laser = lots of fun
-
also cat + cat
[youtube]http://www.youtube.com/watch?v=8MJgKDYk5zQ[/youtube]
another:
[youtube]http://www.youtube.com/watch?v=uXGg9Dd17G8[/youtube]
-
LOL ninja cat :L
-
this is best video with cat:
[youtube]http://www.youtube.com/watch?v=xLmBiBGOPJs[/youtube]
-
(http://cheezcomixed.files.wordpress.com/2011/10/koma-comic-strip-why-cant-it-be-both.gif)
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/552335_700b.jpg)
-
[youtube]http://www.youtube.com/watch?&v=RaaZsBxWeiQ[/youtube]
-
This is so ridiclious I have to laugh so hard :L
[youtube]http://www.youtube.com/watch?v=cjluz5zyYDE[/youtube]
[youtube]http://www.youtube.com/watch?v=9pu-OShtEw4&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=ahAKzZQILTI[/youtube]
[youtube]http://www.youtube.com/watch?v=u_TtEHgKlFo&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=ZEc5BAUYqwM[/youtube]
-
(http://files.uploadffs.com/8/1fe78e3d/ushhour.PNG)
lmao ush hour ;D :L
ahh mooman. my 'ush hour' picture isn't uploaded anymore :( do you still have it?
-
[youtube]http://www.youtube.com/watch?v=u_TtEHgKlFo&feature=related[/youtube]
lol Max Payne
-
LOL
http://www.youtube.com/watch?v=DFMD7hW9DFY
-
that is fudging disgusting!
-
[youtube]rZmhOhBc-lw[/youtube]
-
LOL
http://www.youtube.com/watch?v=DFMD7hW9DFY
mmm tasty
-
OMFG :o :o :o :o
-
me gusta
-
(http://images3.wikia.nocookie.net/__cb20110605080552/nonsensopedia/images/9/90/Longcat4.jpg)
-
[youtube]http://www.youtube.com/watch?v=pja2WYdMygc&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=leaUy7vhhz4&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?v=j6xkEKFFz_8[/youtube]
-
haha
-
[youtube]http://www.youtube.com/watch?v=j6xkEKFFz_8[/youtube]
lol djharley failed this time
-
(http://obczaj.net/obrazki/156632.jpg)
(http://obczaj.net/obrazki/156646.jpg)
(http://obczaj.net/obrazki/156604.jpg)
-
:L
-
http://www.joemonster.org/art/18621/Szalony_szczeniak_nowy_internetowy_mem :L
[youtube]http://www.youtube.com/watch?v=31MMw3Eazqw&feature=related[/youtube]
-
best oval ever
-
holy shit!!! cars!!!!
-
epic
-
[youtube]a7UFm6ErMPU[/youtube]
O0
-
chujowe
-
ale chujowe
-
fuck lmfao :L :L :L :L :L :L
[youtube]http://www.youtube.com/watch?v=hAAx6l9nCv4&feature=related[/youtube]
-
(http://obczaj.net/obrazki/156954.jpg)
(http://obczaj.net/obrazki/156987.jpg)
(http://obczaj.net/obrazki/156759.jpg)
-
I do same on my english lessons when I'm bored lol...
or saying to techear "Put a dick into the correct answer's box" FTW.
-
[youtube]http://www.youtube.com/watch?v=gb7mZflQ2Cg&feature=player_embedded[/youtube]
-
Blowjob is an art!
[youtube]http://www.youtube.com/watch?v=Hw_whFIsnw8&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=lVVpAR9_Tgc&feature=player_embedded[/youtube]
(http://vader.joemonster.org/upload/qzx/6846273ffd8a9278.jpg)
(http://vader.joemonster.org/upload/qzx/684630720f1aeecompelling_and_humor.jpg)
(http://vader.joemonster.org/upload/qzx/684633c044d8efcompelling_and_humor.jpg)
-
(http://www.chamsko.pl/demot/100_100_984779591_Maly_psikus_przez_Kickowski_middle.jpg)
(http://www.nie-chamsko.pl/demot/100_100_960302127_Montana_przez_Kanty1_middle.jpg)
(http://www.nie-chamsko.pl/demot/100_100_490654586_W_przypadku_trzesienia_ziemi_przez_Kanty1_middle.jpg)
(http://www.nie-chamsko.pl/demot/100_100_1614901047_Narodowosci_w_niebie_i_piekle_przez_Kanty1_middle.jpg)
-
(http://i1.kwejk.pl/site_media/obrazki/2011/11/6ad195813acebfd298a3cadfa7a430f9.gif?1321968955)
(http://i1.kwejk.pl/site_media/obrazki/2011/11/647d3e6d9b87322687acb21b52be256f.jpg?1321982348)
(http://i1.kwejk.pl/site_media/obrazki/2011/11/db381f749a927b1fd6d912a41bf0b5c2.jpg?1321978973)
(http://i1.kwejk.pl/site_media/obrazki/2011/11/9700b16f718084fc629f52c2e9742f4e.gif?1321961421)
(http://i1.kwejk.pl/site_media/obrazki/2011/11/e3b1282ad361e208a1538cd8fdd3bf18.gif?1321977747)
-
NSFW but funny :D
http://i.imgur.com/4ybTN.jpg
Facebook version of WWII lol
(http://i.imgur.com/gPirx.jpg)
-
facebook one is epic :L
-
hahahahaha
-
lolololol
-
:L :L :L :L
-
http://www.tonterias.com/2011/11/fakires-con-talento/
-
OMG :L :L :L :L
btw. avatar pouring ketchup into his brain
-
ROFL
(http://27.media.tumblr.com/tumblr_luy90r5QhC1r3zquoo1_500.png)
-
lol thats awesome
-
(http://i1.kwejk.pl/site_media/obrazki/2011/11/6cd693e1269ca157f21f412081325c3a.jpg?1322169633)
-
http://www.pyzam.com/tictactoe
:L
-
[youtube]http://www.youtube.com/watch?v=LCl5uyn5K7k&feature=feedrec_grec_index[/youtube]
-
(http://www.rischiocalcolato.it/wp-content/uploads/2011/11/ScreenHunter_01-Nov.-19-15.45.jpg)
new pm of italy called Mario monti :L
-
(http://www.chamsko.pl/demot/100_100_1210917422_Kupa_przez_Karol9666.jpg)
-
LOOOOOOOOOL
-
hahah
-
:L :L :L
-
[youtube]http://www.youtube.com/watch?v=T1dyqOmKdg8&feature=player_embedded[/youtube]
(http://i1.kwejk.pl/site_media/obrazki/2011/11/9924f014f0ea2e5748e785bb26f90923.jpg?1322257391)
(http://kwejk.tk/img/upload/26112011135243-2b8a612a9d3bf48a160c0e806a3d7c99.gif)
(http://kwejk.tk/img/upload/29102011133417-1319756505075.gif)
-
(http://www.chamsko.pl/demot/100_100_1210917422_Kupa_przez_Karol9666.jpg)
lolete
-
[youtube]http://www.youtube.com/watch?v=LPlTpdBTKF8&feature=player_embedded[/youtube][youtube]http://www.youtube.com/watch?v=Fqqvj4G4Bbg&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=tGg42tXHqxc[/youtube][youtube]http://www.youtube.com/watch?v=C0tRJ-dC4kk&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=h4QUFfYA0wA&feature=player_embedded[/youtube][youtube]http://www.youtube.com/watch?v=Pvrcx6FuwU8&feature=player_embedded[/youtube]
-
http://uncyclopedia.wikia.com/wiki/Necrophilia
xD
-
(http://imagerz.com/QEEQDktvAwMGBF9EFgVR)
-
(http://s3.amazonaws.com/kym-assets/photos/images/newsfeed/000/167/177/380aba6a3c8b20c1ea5de00.gif?1318992465)
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-ash4/380549_302483983103605_293154100703260_1152116_428132801_n.jpg)
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-ash4/377012_302750406410296_293154100703260_1152964_1973951815_n.jpg)
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-snc7/380501_302444383107565_293154100703260_1152060_1093045693_n.jpg)
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-snc7/312846_301578653194138_293154100703260_1149415_1443901928_n.jpg)
(http://img337.imageshack.us/img337/9966/nxx2j.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/533454_700b.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/634813_700b.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/652584_700b.jpg)
(http://i.imgur.com/KEhia.gif)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/609444_460s_v1.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/580786_460s.jpg)
(http://www.lolwtfcomics.com/upload/uploads/1315941269.jpg)
(http://pics.kuvaton.com/kuvei/2d_face_girl.jpg)
-
:L :L :L :L :L :L
-
:L :L :L :L :L :L
-
(http://i1.kwejk.pl/site_media/obrazki/2011/11/4f54542d65a53e0faefdc8c6c274c158.gif?1322494741)
NFSW (http://i1.kwejk.pl/site_media/obrazki/2011/11/f522091f21ef7df93518b32c44af015e.gif?1322487512)
-
What is funny about that car crash Max?
-
dunno, just 2 random gifs, i find funny the 1st one, 2nd one is a bonus from my friends
-
is the 2nd real?
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/533454_700b.jpg)
lol i was reading this on 4chan some days ago:
Last week was my birthday
and I didn't feel very well
waking up on that morning.
I went downstairs for breakfast
hoping my wife would be pleasant and say,
"Happy Birthday!",
and possibly have a small present for me.
As it turned out,
she barely said good morning,
let alone
" Happy Birthday."
I thought...
Well,
that's marriage for you,
but the kids....
They will remember.
My kids came bounding down stairs to breakfast
and didn't say a word.
So when I left for the office,
I felt pretty low
and somewhat despondent.
As I walked into my office,
my secretary Jane said,
"Good Morning Boss,
and by the way
Happy Birthday ! "
It felt a little better
that at least someone had remembered.
I worked until one o'clock ,
when Jane knocked on my door
and said, "You know,
It's such a beautiful day outside,
and it is your Birthday,
what do you say we go out to lunch,
just you and me."
I said, "Thanks, Jane,
that's the greatest thing
I've heard all day.
Let's go !"
We went to lunch.
But we didn't go
where we normally would go.
She chose instead a quiet bistro
with a private table.
We had two martinis each
and I enjoyed the meal tremendously.
On the way back to the office,
Jane said, "You know,
It's such a beautiful day...
On the way back to the office,
Jane said, "You know,
It's such a beautiful day...
We don't need to go straight back to the office,
Do We ?"
I responded,
"I guess not.
What do you have in mind ?"
She said,
"Let's drop by my apartment,
it's just around the corner."
After arriving at her apartment,
Jane turned to me and said,
" Boss, if you don't mind,
I'm going to step into the bedroom
for just a moment.
I'll be right back."
"Ok." I nervously replied.
She went into the bedroom and,
after a couple of minutes,
she came out
carrying a huge birthday cake ...
Followed
by my wife,
my kids,
and dozens of my friends
and co-workers,
all singing "Happy Birthday".
And I just sat there...
On the couch...
Naked.
-
happend with me when I was at fastcakes birthday!
btw max, I made it NFSW. But I prefer to not post 'pictures' like that.. car crashes are no fun imo. (Not even if fake).
-
happend with me when I was at fastcakes birthday!
btw max, I made it NFSW. But I prefer to not post 'pictures' like that.. car crashes are no fun imo. (Not even if fake).
NSFW*
-
need for speed most wanted
-
(http://i.imgur.com/VuDcr.png)
-
what about this
-
haha
-
[youtube]http://www.youtube.com/watch?v=YlE7oTd_ncY[/youtube]
-
(http://www.chamsko.pl/demot/100_100_1210917422_Kupa_przez_Karol9666.jpg)
LOL that really got me :L :L :L
-
ye, in this one Peter shows his strange creativity lol
-
self ownage much??
[youtube]http://www.youtube.com/watch?v=FjrDZB5-SFY[/youtube]
-
:L
-
:L
Nice Fail.
-
don't be surprised if he tries to ram you anytime soon lol
-
gragerz fail :L :L
-
:L :L :L
-
he is big rammer
he wanted to P.I.T me but he failed so he smashed me in next corner and was saying that i didnt give him space ??? ???
-
he tried it on me in a different race too and failed. he often rage quits after
-
First of all, Scorpion you are a two faced cunt. I know what you wrote about me in LSR forum, while you were always friendly with me when we were clanmates. By the way, you rages way more than me.
Krzy, i don't even know who the f are you, but i don't really care to be honest. But all i can say is i'm not a rammer. I know the rules, i know sync, many people can do good battles with me, just ask some. If i ram somebody once a week, that's on purpose, and because of reasons like he was cocky with me, or rammed me many times before. I'm not a rammer, but this is my punishment, because i can't do more, and if i ask someone to do more, he doesn't do.
Last, Snoopy. You are an annoying, childish nobody, who keep insulting me since i left LSR again. But you know what? Do it. You will never record when you come to server as "Ragorz" and flaming me, you will never record that when you ram me on purpose, you will never record any of your insults and things against rules. People will eat your lies, but who cares about people here. It's a fucking game, you will realize it once. This is joy for you, to insulting me every time you see me on server? I let you. Why i wouldn't let be happy a guy who had no childhood? Come on. :D
Bye all, i won't write anymore. ;)
Oh, one last sentence: i didn't ragequit after these things, i typed lol, you can see it at the end of your video. Own goal.
-
lol says the guy who rages and flames all the time. including making fun of ush's mom
-
First of all, Scorpion you are a two faced cunt. I know what you wrote about me in LSR forum, while you were always friendly with me when we were clanmates. By the way, you rages way more than me.
im friendly with who show some respect and you lost my respect and of my clan . About last words , rages about two years ago true...now day i don't rage on every moments try ramm all try troll others and other shit you put on other player , you need change your mind firstly , and im happy you are off in the LSR Clan... times ago you have spoken with jalicno to be reinstated in the clan , and i was happy , but your behavior is back to being grumpy with all , in th end your behavior means betray LSR clan and AX Server.
-
but your behavior is back to being grumpy with all , in th end your behavior means betray LSR clan and AX Server.
^
-
Can you at least leave ONE FUCKING THREAD where we can laugh instead of argueing? Would be FUCKING NICE! Thank you!
-
[youtube]http://www.youtube.com/watch?v=6zXDo4dL7SU[/youtube]
LET ME DANCE FOR YOU!!!!!!!!!!:
[youtube]http://www.youtube.com/watch?v=ucFn5pAfUB8[/youtube]
-
(http://www.adamtam.com/wp-content/uploads/2011/05/tumblrlol.gif)
-
hahahahahha
-
lol Gregorz, Snoopy and Scorpion in one car :L
[youtube]http://www.youtube.com/watch?v=-ExT4qXW3EY[/youtube]
-
Then mooman, Ush and Firefox follow in the next car.. :L
[youtube]http://www.youtube.com/watch?v=LWgN_d5ydJk[/youtube]
-
lol Gregorz, Snoopy and Scorpion in one car :L
[youtube]http://www.youtube.com/watch?v=-ExT4qXW3EY[/youtube]
haha but gregorz can't ram then :(
-
Last car is Vertigo who's forever alone in Austria :L
[youtube]http://www.youtube.com/watch?v=4UOd53l3kH0[/youtube]
-
ahahahahahah
-
haha but gregorz can't ram then :(
that's why Vertigo is in the last car :L
-
Last car is Vertigo who's forever alone in Austria :L
[youtube]http://www.youtube.com/watch?v=4UOd53l3kH0[/youtube]
hahaha :L
-
:L
-
????
-
dunno i was laughing cause everyone else was
-
WE LOVE YOU VERTIGO
P.S. v sig
-
mom
(http://i.imgur.com/3srmh.png)
-
just incase foreigners don't know what "mum" means :L
-
thoughtful :L
-
/me can be very warm hearted (sometimes)
-
Krzy, i don't even know who are you
/aka id
-
haha ^
-
lmao videos cool to read this all :L
-
[youtube]http://www.youtube.com/watch?v=jdp3D484Sj4[/youtube]
-
^ lololol
-
ohohoh, embarrasing :L
-
just incase foreigners don't know what "mum" means :L
mum that is from mummy!!! I KNOW!!!
(http://www.freecraftideas.org/wp-content/uploads/2009/05/ist2_3064179-mummy-walking1.jpg)
-
????
/me hugs Vertigo :-*
-
talented goalkeeper
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=K6mjbJ1mk1A[/youtube]
-
(http://pics.kuvaton.com/kuvei/cat98.gif)
(http://i.imgur.com/7QI96.jpg)
(http://i55.tinypic.com/20aqnt4.gif)
(http://lolsnaps.com/upload_pic/6338.jpg)
(http://www.damnlol.com/pics/948/1207355519b5a69b08788cef439d7388.gif)
(http://i.imgur.com/PVnbi.png)
(http://i3.imageban.ru/out/2011/06/26/8db680b42c255764d973af418e0b3922.gif)
(http://30.media.tumblr.com/tumblr_lmwno8JZgF1qb5gkjo1_400.jpg)
(http://www.trolldad.com/comics/06-14-11-withoutcondom.jpg)
(http://www.nemosvjerovat.com/upload/159.gif)
(http://i.imgur.com/oVdep.gif)
(http://i52.tinypic.com/4r7prp.gif)
(http://d3uwin5q170wpc.cloudfront.net/photo/140360_700b.jpg)
(http://chzragecomics.files.wordpress.com/2011/06/rage-comics-aaaaaaaaaaaaaaay.jpg)
(http://img17.imageshack.us/img17/4649/dailypicdump72264030dai.jpg)
(http://img860.imageshack.us/img860/6489/fdrfgragecomicss651x961.png)
(http://forgifs.com/gallery/d/185532-1/Gym_shower_sneeze.gif)
-
[youtube]http://www.youtube.com/watch?v=Ov_ZTBB9szM&feature=fvst[/youtube] [youtube]http://www.youtube.com/watch?v=fzzjgBAaWZw[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=21GTjw2sZ2o#![/youtube]
-
[youtube]http://www.youtube.com/watch?v=6uPpbqPmee0&feature=player_embedded[/youtube]
-
(http://i.imgur.com/7QI96.jpg) (http://bit.ly/skzNYI)
lmao @ 1:04 :L
Edit: watch this https://bitly.com/skzNYI+ (https://bitly.com/skzNYI+)
-
At 0:59 he is making one line in the wrong place.
-
wtf fu
-
(http://i52.tinypic.com/4r7prp.gif)
lol reminds me this
(http://therecord.blogs.com/photos/uncategorized/2008/06/03/mexico_accident_topix_temp.jpg)
-
(http://i.imgur.com/e2Rth.jpg)
-
(http://i52.tinypic.com/4r7prp.gif)
lol reminds me this
(http://therecord.blogs.com/photos/uncategorized/2008/06/03/mexico_accident_topix_temp.jpg)
Still don't see the fun of these images/gifs..
-
gif was funny for me, also reminded me famous picture, anyway this may be funny (finally):
(http://obczaj.net/obrazki/158811.jpg)
-
Hahah yeah that was some good fun, made me laugh!
-
(http://i.imgur.com/7QI96.jpg) (http://bit.ly/skzNYI)
lmao @ 1:04 :L
Edit: watch this https://bitly.com/skzNYI+ (https://bitly.com/skzNYI+)
so we got 17 clicks
(http://i.imgur.com/dsvxb.png)
-
stuck in traffic jam at tollboth?
no problem
(http://i1.kwejk.pl/site_media/obrazki/2011/12/56cc2be6d5aeafa224c6ea4f465a64cc.gif?1322768093)
-
lmao :L
-
(http://d3uwin5q170wpc.cloudfront.net/photo/99273_460s.jpg)
so true
-
[youtube]http://www.youtube.com/watch?v=_AZ-Zdv29Sc[/youtube]
btw tourista mean diahrea in french (coz tourists often have diahrea coz of eating foreign food they're not used to , or by drinking water less clean). and toutou mean dog . ahh nice to see marketing genious ^^
-
crashes are not funny....
-
(http://www.lescretins.com/images/news/image-01.jpg) | (http://www.lescretins.com/images/news/image-70.jpg) |
(http://www.lescretins.com/images/news/image-68.jpg) | (http://www.lescretins.com/images/news/image-61.jpg) |
(http://www.lescretins.com/images/news/image-59.jpg) | (http://www.lescretins.com/images/news/image-51.jpg) |
(http://www.lescretins.com/images/news/image-47.jpg) | (http://www.lescretins.com/images/news/image-33.jpg) |
(http://www.lescretins.com/images/news/image-30.jpg) | (http://www.lescretins.com/images/news/image-60.jpg) |
(http://www.lescretins.com/images/news/image-21.jpg) | (http://www.lescretins.com/images/news/image-17.jpg) |
(http://www.lescretins.com/images/news/image-14.jpg) | (http://www.lescretins.com/images/news/image-05.jpg) |
(http://www.lescretins.com/images/news/image-16.jpg) |
-
[youtube]http://www.youtube.com/watch?v=Zi_bMYFmFGg[/youtube]
-
(http://i.imgur.com/jo8FD.jpg)
-
[youtube]http://www.youtube.com/watch?v=GfJJjwbIuOA[/youtube]
-
(http://a.asset.soup.io/asset/2587/1658_a366.gif)
-
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-snc7/s320x320/378096_226137647459164_133705686702361_549604_512366021_n.jpg)
-
[youtube]gLfYXp_1OxM[/youtube]
-
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-snc7/s320x320/378096_226137647459164_133705686702361_549604_512366021_n.jpg)
i dont see anything
-
(http://i.imgur.com/NrSSM.png)
-
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-snc7/319932_311343932214782_226210720728104_1467096_1692697754_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=KDwEe6KRzIc&feature=related[/youtube]
-
haha
-
Just reinstalled customers pc :L
(http://img94.imageshack.us/img94/9366/image016is.jpg) (http://imageshack.us/photo/my-images/94/image016is.jpg/)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=qox7x6dWYaI[/youtube]
-
LMAO
-
:L
-
[youtube]http://www.youtube.com/watch?v=GAabVQ_XkJ4&feature=player_embedded[/youtube]
-
haha
-
Nice one Cromiell!
-
EPIC TROLL SONGS :L :L :L :L :L :L :L :L :L :L
-
lmao
-
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-snc7/313264_240781265969785_199077356806843_630498_523435197_n.jpg)
-
O0
-
:L
-
(http://vader.joemonster.org/upload/qzg/6927962d1eb57f11.jpg)
-
lol
-
loooooooooooooooooooooooooooooooool
[youtube]http://www.youtube.com/watch?v=qLVKPL9FwNQ[/youtube]
-
the guy singing wasn't bad at all. simon just didn't like the welsh guy lol
-
http://www.joemonster.org/filmy/40151/Strasznie_mnie_cisnie_
[youtube]http://www.youtube.com/watch?v=WT-pNYPYE4g&feature=player_embedded[/youtube]
-
loool :L
-
rofl epic bug
-
The crash I had in GRID yesterday. Made me laugh lol, what a bunch of rolls. I guess I couldn't continue racing. :L
[youtube]http://www.youtube.com/watch?v=ThsWYnoG0m8[/youtube]
-
Blah! How dare you wreck an NSX.
Nice (t)rolling tho.
-
[youtube]http://www.youtube.com/watch?v=WT-pNYPYE4g&feature=player_embedded[/youtube]
:L
-
The crash I had in GRID yesterday. Made me laugh lol, what a bunch of rolls. I guess I couldn't continue racing. :L
[youtube]http://www.youtube.com/watch?v=ThsWYnoG0m8[/youtube]
XD How the fuck did you launch yourself like that? I once landed on my roof after hitting a bump sideways :L
-
I crashed a lot of cars in this place. Practice lol. :L I love to play with GRID's damage model.
-
[youtube]http://www.youtube.com/watch?v=WT-pNYPYE4g&feature=player_embedded[/youtube]
:L
ewwww
-
lool:
[youtube]http://www.youtube.com/watch?v=zCfm-vWuQRk[/youtube]
-
ahahahahhaahhahah he called himself nigger
-
omg you can't call yourself a nigger when you're white.. lol! What a noob..
-
The best clock ever...
(http://www.joemonster.org/i/am/zegar2.jpg)
-
omg you can't call yourself a nigger when you're white.. lol! What a noob..
init lol he's a wigger
-
[youtube]http://www.youtube.com/watch?v=gFFVhxjYUpM&feature=related[/youtube]
-
Somewhere in the other dimension...
(http://www.joemonster.org/i/e/alternatywny_swiat01.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat02.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat04.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat05.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat06.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat08.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat10.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat11.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat12.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat13.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat15.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat16.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat17.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat21.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat23.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat25.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat26.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat28.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat32.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat33.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat34.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat37.jpg)
-
haha
-
really nice collection :L
-
I love this game :L
[youtube]TT1HShMInUs[/youtube]
(http://cloud.steampowered.com/ugc/630733235513209630/681212D9EC7B2232520ED122FDEC1D0216D310B1/)
-
[youtube]http://www.youtube.com/watch?v=9mwb8OWMdGk&feature=player_embedded[/youtube][youtube]http://www.youtube.com/watch?v=5-wf-spStDE&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=FMMeQt2v57M&feature=player_embedded[/youtube]
-
nice pics cromiell
-
[youtube]Kt-ZESIFkgs[/youtube]
-
removed because some irish fool got pissy over it lol
-
lol ^
-
I thought it's runty hahahaha...
-
blegh
-
:L
-
Somewhere in the other dimension...
(http://www.joemonster.org/i/e/alternatywny_swiat01.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat02.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat04.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat05.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat06.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat08.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat10.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat11.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat12.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat13.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat15.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat16.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat17.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat21.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat23.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat25.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat26.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat28.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat32.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat33.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat34.jpg)
(http://www.joemonster.org/i/e/alternatywny_swiat37.jpg)
Soviet Russia?
-
I thought it's runty hahahaha...
same lol
-
Soviet Russia?
huh?
-
lol
-
Somewhere in the one of Soviet Russia schools.:
[youtube]http://www.youtube.com/watch?v=6v6Ue5LjdTg&feature=player_embedded[/youtube]
-
(http://i.imgur.com/IE10j.jpg)
-
OMFG IT'S THAT GIRL :L :L :L :L :L
-
Somewhere in the one of Soviet Russia schools.:
[youtube]http://www.youtube.com/watch?v=6v6Ue5LjdTg&feature=player_embedded[/youtube]
omg :L I used to do kinda the same, let my head "fall" to the table in school XD I want a .gif of that from 0:04 to 0:08, gotta find fb's topic!
-
i think lilrunty hit his head too many times like that as well. that explains why he is the way he is.
-
erm, that's true because I use to do that at school :(
-
at home then?
-
nah, home is fist to the wall, not head :L
-
but i thought you didn't go to a proper school?
-
back when I was in like year 5-6 lol
-
last year then (spin)
-
Wedding fun in Russia. :L
[youtube]http://www.youtube.com/watch?v=fa0Yd7XrkXQ&feature=player_embedded[/youtube]
__________________
http://www.joemonster.org/art/18838/Ciezko_zaimponowac_astronautom_mem_internetowy
__________________
Somebody decided to buy cd-key for BF3 online to save the time... So did he?
(http://vader.joemonster.org/upload/qzi/512_6946025df04f2b1.jpg)
(http://vader.joemonster.org/upload/qzi/512_69460327d618532.jpg)
(http://vader.joemonster.org/upload/qzi/694604eb3a85f83.jpg)
(http://vader.joemonster.org/upload/qzi/512_6946051667f2774.jpg)
-
[youtube]http://www.youtube.com/watch?v=x01j3M3PrGk[/youtube]
-
[youtube]http://www.youtube.com/watch?v=vncIBREXCwU&context=C26352ADOEgsToPDskJ5kJvPuxfQJl66uqbeB6i8[/youtube]
-
[youtube]http://www.youtube.com/watch?v=dXmPrYEOvM8&feature=related[/youtube]
-
check this videos:
[youtube]http://www.youtube.com/watch?v=IQK8VbE5_bA&list=FLJPgODT5gwuNGUVkP1D0AIw&index=1&feature=plpp_video[/youtube]
[youtube]http://www.youtube.com/watch?v=wsBon3DTwIY&feature=bf_next&list=FLJPgODT5gwuNGUVkP1D0AIw&lf=plpp_video[/youtube]
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/994761_700b.jpg)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=3PqC7CLqL-E#![/youtube]
-
[youtube]http://www.youtube.com/watch?v=O6Xo21L0ybE&feature=player_embedded[/youtube][youtube]http://www.youtube.com/watch?v=qUcCZTnImCI&feature=player_embedded[/youtube]
-
[youtube]http://www.youtube.com/watch?v=O9qjr9_1ibs&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=gIOupZjEOTw&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=vs2Ue_5l-VA&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=arKpdxjHamI[/youtube]
silly warcraft commercial
-
The new generation of Czech hardstyle music.
Watch the old dancechampion (He got the moves like Jagger):
[youtube]http://www.youtube.com/watch?v=5T_uxoV5FuQ&feature=related[/youtube]
-
The new generation of Czech hardstyle music.
it's old video lol :L
-
They are forever youngs. XD
I found a mix, but the original is unbeatable. ^^
[youtube]http://www.youtube.com/watch?v=qt-azG9ft2k&feature=relatedĐ[/youtube]
-
man gets crazy when his driving licens gets taked :L
[youtube]http://www.youtube.com/watch?v=DIXD_pwooGQ[/youtube]
-
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
-
[youtube]abs_yGod5MQ[/youtube]
Not that funny but i can't find place where to post this
-
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-snc7/s320x320/378542_213558415391079_139461069467481_497990_64505959_n.jpg)
(http://a2.sphotos.ak.fbcdn.net/hphotos-ak-snc7/s320x320/390754_213529138727340_139461069467481_497957_1931834758_n.jpg)
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/379453_213177655429155_139461069467481_497206_1589997709_n.jpg)
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-snc7/s320x320/387952_212972308783023_139461069467481_496641_2116035852_n.jpg)
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/383946_212570602156527_139461069467481_495598_1485856823_n.jpg)
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/390035_214677508612503_139461069467481_500641_1213809683_n.jpg)
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/374765_214610458619208_139461069467481_500554_1849464254_n.jpg)
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/378112_214577321955855_139461069467481_500357_257126889_n.jpg)
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-snc7/s320x320/376528_214258618654392_139461069467481_499496_662768556_n.jpg)
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/388480_212496118830642_139461069467481_495456_1674097061_n.jpg)
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/375258_211892278891026_139461069467481_494435_1646622935_n.jpg)
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/381371_211831935563727_139461069467481_494364_718169018_n.jpg)
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/376979_211776275569293_139461069467481_494297_177578883_n.jpg)
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc7/s320x320/376375_211744995572421_139461069467481_494208_1218296997_n.jpg)
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/379945_211688068911447_139461069467481_494108_2085971172_n.jpg)
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/377894_211353228944931_139461069467481_493218_2145243302_n.jpg)
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/384448_211078715639049_139461069467481_492296_827208166_n.jpg)
(http://forum.adrenalinex.co.uk/index.php?action=dlattach;attach=3723;type=avatar)
-
hahahah :DD
-
lol frog
-
XDDDDDDDDDD
ABS: ON :D :D
-
Not funny but very interesting.:
[youtube]http://www.youtube.com/watch?v=q7mXLqIJXHs&feature=player_embedded[/youtube]
-
(http://i41.tinypic.com/a0i5uo.jpg)
(http://24.media.tumblr.com/tumblr_liuhwmsY0K1qha5lao1_500.jpg)
(http://i.imgur.com/Xba1D.png)
(http://i.imgur.com/QH3Ou.jpg)
-
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM&feature=g-u&context=G23b458cFUAAAAAAABAA[/youtube]
-
lmaoooo!!!!
-
[youtube]http://www.youtube.com/watch?v=7KvxOuC7Bhc[/youtube]
-
Awesome uploads guys, fails of 2011 was superb, also the concreate escalator :L
I took a picture on my phone, fucking neighbours...
(http://img259.imageshack.us/img259/6968/43873943.jpg) (http://imageshack.us/photo/my-images/259/43873943.jpg/)
Uploaded with ImageShack.us (http://imageshack.us)
-
http://kimjongillookingatthings.tumblr.com/ :(
-
He made looking look good :(
-
http://kimjongillookingatthings.tumblr.com/ :(
R.I.P Kim Jong Il
-
OMG. I was talking to my friend just last night about Kim Jong Il, and I was not sure if he was alive, so I checked wikipedia.org and he still was.
Now he dies.
The same thing happened with Nate Dogg when he died...I need to stop killing people by looking them up on Wikipedia. :-\
-
I just made a wikipedia page for mooman, can you look if all's correct epoxi?
-
murderer :/
-
I'm sorry mooman :( bye! :L
-
[youtube]http://www.youtube.com/watch?v=jojU2KZNMVQ&feature=g-all-lik&context=G2780db8FAAAAAAAABAA[/youtube]
[youtube]http://www.youtube.com/watch?v=2M0R19gEr-s[/youtube]
[youtube]http://www.youtube.com/watch?v=lPDXypTfKzg[/youtube]
[youtube]http://www.youtube.com/watch?v=hMTxbUdLQ5s[/youtube]
-
http://en.wikipedia.org/wiki/MOO_(programming_language)
You have 24 hours remaining...spend them wisely.
-
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM[/youtube]
(http://i.imgur.com/PpvZ3.gif)(http://i.imgur.com/uTUTt.gif)(http://i.imgur.com/lPu71.gif)(http://i.imgur.com/ySdGb.gif)(http://i.imgur.com/XovKn.gif)(http://i.imgur.com/mceSX.gif)(http://i.imgur.com/WY4Zt.gif)(http://i.imgur.com/8qeKk.gif)(http://i.imgur.com/iFPu6.gif)(http://i.imgur.com/WGLjf.gif)(http://i.imgur.com/djYz3.gif)(http://i.imgur.com/V2RrC.gif)(http://i.imgur.com/SOxgt.gif)(http://i.imgur.com/o3CiD.gif)(http://i.imgur.com/2t4Nx.gif)(http://i.imgur.com/CHXlk.gif)(http://i.imgur.com/I2amP.gif)(http://i.imgur.com/gfeHr.gif)(http://i.imgur.com/yLPB5.gif)(http://i.imgur.com/PVJLG.gif)(http://i.imgur.com/ScfZj.gif)(http://i.imgur.com/ZubeD.gif)(http://i.imgur.com/x4Xhk.gif)(http://i.imgur.com/xGaY7.gif)(http://i.imgur.com/qaQ5o.gif)(http://i.imgur.com/hIo7b.gif)(http://i.imgur.com/ImW0R.gif)(http://i.imgur.com/635Bd.gif)(http://i.imgur.com/3e57a.gif)(http://i.imgur.com/ayVLb.gif)(http://i.imgur.com/WxxDz.gif)(http://i.imgur.com/LkT4B.gif)(http://i.imgur.com/QepSq.gif)(http://i.imgur.com/llgS8.gif)(http://i.imgur.com/RBs2w.gif)(http://i.imgur.com/JhRjo.gif)(http://i.imgur.com/wBLI4.gif)(http://i.imgur.com/z6WMp.gif)(http://i.imgur.com/Cadps.gif)(http://i.imgur.com/4rDL3.gif)(http://i.imgur.com/yIpxF.gif)(http://i.imgur.com/XTaWy.gif)(http://i.imgur.com/OyW5P.gif)(http://i.imgur.com/27L2b.gif)(http://i.imgur.com/PS6IC.gif)(http://i.imgur.com/fzqdA.gif)(http://i.imgur.com/dkAFr.gif)(http://i.imgur.com/GvxpV.gif)(http://i.imgur.com/AcDH0.gif)(http://i.imgur.com/vvaqJ.gif)(http://i.imgur.com/hyy45.gif)(http://i.imgur.com/oCwFa.gif)(http://i.imgur.com/E3u6V.gif)(http://i.imgur.com/VF3Qr.gif)(http://i.imgur.com/DIbw0.gif)(http://i.imgur.com/MFvt9.gif)(http://i.imgur.com/k2ZHi.gif)(http://i.imgur.com/2a1SL.gif)(http://i.imgur.com/2RTdH.gif)(http://i.imgur.com/gnJa5.gif)(http://i.imgur.com/2oYWq.gif)(http://i.imgur.com/4VuMS.gif)(http://i.imgur.com/RiwGN.gif)(http://i.imgur.com/CRjFa.gif)(http://i.imgur.com/DXheH.gif)(http://i.imgur.com/hkuyt.gif)(http://i.imgur.com/24pfG.gif)(http://i.imgur.com/XVtde.gif)(http://i.imgur.com/PT3Mn.gif)(http://i.imgur.com/6c9rY.gif)(http://i.imgur.com/7bpy7.gif)(http://i.imgur.com/LZDfU.gif)(http://i.imgur.com/7E98C.gif)(http://i.imgur.com/OtgLd.gif)(http://i.imgur.com/oA8rx.gif)(http://i.imgur.com/rdM1m.gif)(http://i.imgur.com/hNtVN.gif)(http://i.imgur.com/BgMdH.gif)(http://i.imgur.com/k3uTX.gif)(http://i.imgur.com/0ULZb.gif)(http://i.imgur.com/OGyVJ.gif)(http://i.imgur.com/eVlVB.gif)(http://i.imgur.com/OwOTm.gif)(http://i.imgur.com/rj0Gc.gif)(http://i.imgur.com/HKK5R.gif)(http://i.imgur.com/gJxiy.gif)(http://i.imgur.com/fRcQd.gif)(http://i.imgur.com/GWHGE.gif)(http://i.imgur.com/LgwBm.gif)(http://i.imgur.com/4PRvp.gif)(http://i.imgur.com/uLI71.gif)(http://i.imgur.com/jpY1Y.gif)(http://i.imgur.com/9pMJv.gif)(http://i.imgur.com/WmC4J.gif)(http://i.imgur.com/1uWX4.gif)(http://i.imgur.com/qvbI2.gif)(http://i.imgur.com/oGqdi.gif)(http://i.imgur.com/zNVEM.gif)(http://i.imgur.com/jyF8l.gif)(http://i.imgur.com/2umqO.gif)(http://i.imgur.com/PJida.gif)(http://i.imgur.com/WIgUJ.gif)(http://i.imgur.com/dUCJ9.gif)(http://i.imgur.com/nQ02f.gif)(http://i.imgur.com/mfOXz.gif)(http://i.imgur.com/z62cX.gif)(http://i.imgur.com/jWgep.gif)(http://i.imgur.com/JJIF8.gif)(http://i.imgur.com/6wFhk.gif)(http://i.imgur.com/U9NlW.gif)(http://i.imgur.com/zwAaD.gif)(http://i.imgur.com/Rsxjz.gif)(http://i.imgur.com/DNUM8.gif)(http://i.imgur.com/FMiOY.gif)(http://i.imgur.com/efDaT.gif)(http://i.imgur.com/RZkfS.gif)(http://i.imgur.com/Il8Qm.gif)(http://i.imgur.com/vV8n3.gif)(http://i.imgur.com/dZfuB.gif)(http://i.imgur.com/kMgUM.gif)(http://i.imgur.com/gCnI1.gif)(http://i.imgur.com/izJ17.gif)(http://i.imgur.com/M3ujw.gif)(http://i.imgur.com/bzDmF.gif)(http://i.imgur.com/diOud.gif)(http://i.imgur.com/cYgjO.gif)(http://i.imgur.com/TJgOT.gif)(http://i.imgur.com/dteY9.gif)(http://i.imgur.com/ldeou.gif)(http://i.imgur.com/VJ349.gif)(http://i.imgur.com/BhnN0.gif)(http://i.imgur.com/432dK.gif)(http://i.imgur.com/BjfVD.gif)(http://i.imgur.com/Xqead.gif)(http://i.imgur.com/JoMX8.gif)(http://i.imgur.com/vN7ls.gif)(http://i.imgur.com/h7ddf.gif)(http://i.imgur.com/gnK39.gif)(http://i.imgur.com/gHVF3.gif)(http://i.imgur.com/2FaNR.gif)(http://i.imgur.com/GWdJt.gif)(http://i.imgur.com/yvDYw.gif)(http://i.imgur.com/0gyAS.gif)(http://i.imgur.com/H7WH3.gif)(http://i.imgur.com/F6WOb.gif)(http://i.imgur.com/FzAeb.gif)
:blank:
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/1113494_700b.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/983090_700b_v1.jpg)
Russia :
(http://d24w6bsrhbeh9d.cloudfront.net/photo/977063_700b.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/957866_700b.jpg)
-
[youtube]http://www.youtube.com/watch?v=VJNBfBr-OGU&feature=player_embedded[/youtube]
-
[youtube]http://www.youtube.com/watch?v=LwFQ8iMMdZY&feature=player_embedded[/youtube]
(http://www.joemonster.org/i/e/3pedaly02.jpg)
-
[youtube]http://www.youtube.com/watch?v=qq6KC8vlx0Y[/youtube]
-
Haha FireBox, that GIF array is amazing. It was worth waiting for it to download. :L
-
The year that was in failures. Some of them hurts much even while being watched.
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM&feature=player_embedded[/youtube]
-
^ lol
this video is already on this page
-
guys check out this never before seen video!
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM&feature=player_embedded[/youtube]
-
[youtube]http://www.youtube.com/watch?v=mghhLqu31cQ[/youtube]
OWNS.
-
guys check out this never before seen video!
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM&feature=player_embedded[/youtube]
Haha, triple repost.
Cromiell, check the .gif files by Firebox above too.
-
Haven't seen lol. Been too busy lately.
-
Haven't seen lol. Been too busy lately.
Same. lol is afk all the time too
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/1113494_700b.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/983090_700b_v1.jpg)
Russia :
(http://d24w6bsrhbeh9d.cloudfront.net/photo/977063_700b.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/957866_700b.jpg)
Eww, 9GAG, eww!!
-
9gag ftw ;)
-
Makes me "GAG" with hate.
-
(http://i.imgur.com/Nb5Yx.png)
-
check this out guys!
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM&feature=player_embedded[/youtube]
-
haha few funny moments but i liked last year's compilation better
-
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM&feature=g-u&context=G23b458cFUAAAAAAABAA[/youtube]
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM[/youtube]
<snip 146 gif's>
:blank:
The year that was in failures. Some of them hurts much even while being watched.
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM&feature=player_embedded[/youtube]
guys check out this never before seen video!
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM&feature=player_embedded[/youtube]
guys check out this never before seen video!
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM&feature=player_embedded[/youtube]
Haha, triple repost.
Cromiell, check the .gif files by Firebox above too.
check this out guys!
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM&feature=player_embedded[/youtube]
lmao
-
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM&feature=player_embedded[/youtube]
omg lol so funny
-
Wow this video is so cool.
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM[/youtube]
-
Wow this video is so cool.
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM[/youtube]
haha nice one!
-
i found this earlier, it's hilarious :L :L :L :L :L :L :L
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM[/youtube]
-
i found this earlier, it's hilarious :L :L :L :L :L :L :L
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM[/youtube]
:L :L :L
-
i found this earlier, it's hilarious :L :L :L :L :L :L :L
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM[/youtube]
:L :L :L
Omg so amazing. :o
-
Maybe enough? :L
-
Not funny but woah. Supra can be tweaked so hard!
[youtube]http://www.youtube.com/watch?v=NPCWHHdOFjQ&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=ecpF567VTsc[/youtube][youtube]http://www.youtube.com/watch?v=oLUEdh0sMlU[/youtube]
[youtube]http://www.youtube.com/watch?v=1xsp76cVTJU[/youtube]
-
9gag ftw ;)
This is the single most retarded statement ever.
-
9gag ftw ;)
This is the single most retarded statement ever.
why ?
-
Because you used "9gag" and "ftw" in a sentence. Together. Like, right next to each other.
-
Talent:
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=dcMSTmoNd_0[/youtube]
-
[youtube]http://www.youtube.com/watch?v=I7TK_8RiVj8&feature=related[/youtube]
oh and...
[youtube]http://www.youtube.com/watch?v=QQ19A2GFaBM[/youtube]
-
[youtube]2zls4Ao3GyM[/youtube]
[youtube]iW-BxAU2xvo[/youtube]
-
[youtube]http://www.youtube.com/watch?v=LbNl3J8HXw4&feature=player_embedded[/youtube]
-
haha
[youtube]http://www.youtube.com/watch?v=EKsfF9QM4Ps[/youtube]
[youtube]http://www.youtube.com/watch?v=vUHu4TAmNMM[/youtube]
-
costarican like a fuckin boss :D
-
Hah yeh that's international news :L
imo he was right kicking the guy two times.. see how he's scared when the steward runs towards him. He should even have kicked harder!
-
(http://i.imgur.com/IHKIf.jpg)
-
(http://img88.imageshack.us/img88/1939/39803533044951031598929.jpg)
-
[youtube]http://www.youtube.com/watch?v=wDpuNrA55-A[/youtube]
-
lol it bounced off or wut?
-
(http://i.imgur.com/jppAe.png)
-
[youtube]http://www.youtube.com/watch?v=NvhiKgH-LhA[/youtube]
-
my grandma :L :L
[youtube]http://www.youtube.com/watch?v=LIPwKZ3xN6c&feature=share[/youtube]
-
:L she seems like a lot of fun :L
-
lmao :L :L
-
:L
-
IT MUST BE DONE:
If I had a pound for every pixel, I'd have 1 pound.
-
Ahahaa nonna. 8)
-
without alchool without wine my nonna(grandmother) did a dance-doggy style :L
-
http://www.worldstarhiphop.com/videos/video.php?v=wshh6Og1MarEOjrYOu03
-
[youtube]http://www.youtube.com/watch?v=Yaw7qX_ZDNE&feature=related[/youtube]
-
http://www.worldstarhiphop.com/videos/video.php?v=wshh6Og1MarEOjrYOu03
ho0o0o0o0o0o000ot GIRL!
-
http://www.worldstarhiphop.com/videos/video.php?v=wshh6Og1MarEOjrYOu03
ho0o0o0o0o0o000ot GIRL!
wheres your butter ush
-
I creamed myself in butter, you need to massage it all over me even more!
-
I can't stop laughing at the first one HAHAHAHA :L
[youtube]http://www.youtube.com/watch?v=5wnqPb8gXns&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=PkT2_WL6ACE&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=JoR6Qi1q-os&feature=player_embedded[/youtube]
-
[youtube]http://www.youtube.com/watch?v=A8T6UYZxNUQ&feature=player_embedded[/youtube][youtube]http://www.youtube.com/watch?v=h5qMbk5mL24&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=TyoeacXBHDQ&feature=player_embedded[/youtube][youtube]http://www.youtube.com/watch?v=8CA76mfdzgU&feature=player_embedded[/youtube]
_____________________________________________________________________________________________________
Trolling by Santa Claus
(http://vader.joemonster.org/upload/qqs/512_70509237bd9a8b1.jpg)
(http://vader.joemonster.org/upload/qqs/512_70509376a716dd2.jpg)
(http://vader.joemonster.org/upload/qqs/7050940fcf1d933.jpg)
(http://vader.joemonster.org/upload/qqs/512_705095435fb0e84.jpg)
(http://vader.joemonster.org/upload/qqs/70509648c02b0d5.jpg)
(http://vader.joemonster.org/upload/qqs/705097d58fa71d6.jpg)
(http://vader.joemonster.org/upload/qqs/256_7055002875a446trollface.jpg)
-
Read 1st comments on this one :L
[youtube]http://www.youtube.com/watch?v=Rt7dK62QdLM&feature=related[/youtube]
-
[youtube=640,360]JUiBlDyYWUc[/youtube]
-
[youtube]http://www.youtube.com/watch?v=sP4NMoJcFd4&feature=related[/youtube]
-
blonde attack!
(http://obczaj.net/obrazki/159787.jpg)
-
[youtube]http://www.youtube.com/watch?v=iuMDVlK75Ss&feature=player_embedded[/youtube]
-
omg!
-
Holy ship! :o
-
[youtube]http://www.youtube.com/watch?v=h2Jp4wdIzU8[/youtube]
-
[youtube]http://www.youtube.com/watch?v=iuMDVlK75Ss&feature=player_embedded[/youtube]
holy fuckO_o
-
that's some risky ballsy shit right there! clearly a man with nothing to lose in life!!
-
[youtube]http://www.youtube.com/watch?v=7uBNCN6v_gk[/youtube]
i found it funny.......
-
[youtube]http://www.youtube.com/watch?v=QYGk3iYj84U[/youtube]
-
:L
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=rcHugZSRIqI#![/youtube]
-
[youtube]http://www.youtube.com/watch?v=QYGk3iYj84U[/youtube]
Is that you, merc, saying "Andy"? You sound like a badly flushed up cow :L :L :L
-
it's mooman
-
You sound like a badly flushed up cow :L :L :L
it's mooman
that fits i guesssss
-
oh..
-
[youtube]http://www.youtube.com/watch?v=AwgvwFWK_dQ[/youtube]
[youtube]http://www.youtube.com/watch?v=FYrfKkmNGEk&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=OjLG92qXfSg[/youtube]
-
(http://img.myepicwall.com/i/2011/12/d9d44bc683dcb233e687f7218169b390.jpg?1325262656)
-
LOL You understood what's that? LMAO :L
-
yeh, found it funny :L
-
if you take out text you can still understand it perfectly. i don't know why they even put any text in the first place
-
(http://static.arstechnica.net/assets/2011/10/bf3-rage-4ea8374-intro-thumb-640xauto-27067.jpg)
-
[youtube]http://www.youtube.com/watch?v=SNH5EUw7gxk[/youtube]
-
(http://i.imgur.com/PZsyW.jpg)
-
election in russia lol :D
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=mdBF56ahgLw[/youtube]
-
lmao
-
it's mooman
it's ush lol
-
For Mourad ahaha
(http://photos-h.ak.fbcdn.net/hphotos-ak-snc7/377415_302250633119836_133455056666062_1305242_955591186_a.jpg)
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-ash4/319188_302250689786497_133455056666062_1305244_1806107994_n.jpg)
(http://photos-h.ak.fbcdn.net/hphotos-ak-ash4/378515_304520406226192_133455056666062_1314045_2131052645_a.jpg)
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-ash4/388516_340177292660503_133455056666062_1433723_1597391837_n.jpg)
(http://photos-h.ak.fbcdn.net/hphotos-ak-ash4/387495_338730416138524_133455056666062_1425822_1180892216_a.jpg)
last image isn't funny but wtf is that .___.
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-snc7/406974_340177672660465_133455056666062_1433739_2110132963_n.jpg)
-
hahaha :L
-
How true Russia...
[youtube]http://www.youtube.com/watch?v=mdBF56ahgLw&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=ZkEHA-wixDw&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=YrzSmQSwfbg&feature=player_embedded[/youtube]
-
lol Cromiell you did it again :L
v
election in russia lol :D
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=mdBF56ahgLw[/youtube]
-
(http://i1007.photobucket.com/albums/af196/WolfLikeMe/2-1.jpg)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/01/7f5c41cefbcc958c35cee9fec9515347.gif?1325454008)
not really funny... (click on your own risk)
http://www.chamsko.pl/demot/100_100_2107886208_a_mama_mowila_nie_baw_sie_jedzeniem_przez_polo.nez.gif
(http://www.chamsko.pl/demot/100_100_2066628130_naucz_anglika_przez_lilliputz_middle.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/a5617d6a86f8ca04f4c929a96ca9fb2c.jpg?1325458633)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/979d4a3be4c07674f07a4c234a405df2.jpg?1325545313)
-
poor cat, he seems relatively fine however...
-
LOL at Max's insulting in polish learning.
I can teach you some more anyway.
runty tea chipo
runty nye mash vaskka
-
Crazy dutchie launch a firework in his ass :L
[youtube]
http://www.youtube.com/watch?v=mKi_EQpHONI&feature=player_embedded[/youtube]
-
Crazy dutchie launch a firework in his ass :L
[youtube]
http://www.youtube.com/watch?v=mKi_EQpHONI&feature=player_embedded[/youtube]
Would laugh if his ass exploded and everybody would be dealt with some poop...
-
this is not funny at all, but watch how someone can be that stupid to play with such dangerous explosives in a public place...
[youtube]http://www.youtube.com/watch?v=T0FusG_uSR0[/youtube]
-
Happy new year in NL isn't happy.. somehow people have to ruin others properties (youngsters).
-
[youtube]http://www.youtube.com/watch?v=UTq8EjVmCw8&feature=related[/youtube]
-
Quote from: DemonStar
I wanted to start again whitout cheating , but because of you , i gonna use proxy ore something and start again with cheating .
Thanks dude .
-
[youtube]http://www.youtube.com/watch?v=jsGR5678p7Y&feature=player_embedded[/youtube][youtube]http://www.youtube.com/watch?v=eVXKKaWJTls&feature=player_embedded[/youtube]
-
First one looks fake when it disappears behind the truck: I think it is two shots spliced together.
Second one is hilarious though, I have no idea how he thought it would work. :L
-
(http://i.imgur.com/GpCna.jpg)
-
(http://media.rockstargames.com/rockstargames/img/global/news/upload/gta3_gta4_scripts1.jpg)
Left: The original story and mission scripts from Grand Theft Auto III. Right: Seven years later - a glimpse of the voluminous Grand Theft Auto IV script.
-
wow lol
-
What's that on the left?
-
Left: The original story and mission scripts from Grand Theft Auto III
-
what about the right?
-
Right: Seven years later - a glimpse of the voluminous Grand Theft Auto IV script
.andre :L
-
this is borderline ridiculous
(http://i.imgur.com/BNvAG.jpg)
-
ewww wtf
-
ewww wtf
-
ewww wtf
-
ewww wtf
-
ewww wtf
-
ewww wtf
-
ewww wtt
-
ewww wtf
-
(http://www.chamsko.pl/demot/100_100_1253275106_sztuczka_przez_lilliputz_middle.jpg)
(http://www.chamsko.pl/demot/100_100_2052784647_Nigga_przez_bloodsucker.gif)
(http://i1.kwejk.pl/site_media/obrazki/2011/11/565a3bb186032b68be26ccce7cd7ba52.jpg?1321373810)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/d0666aa7e752a2a9f7ca5b27d0176ce5.gif?1325787014)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/44b64bcfa4ce005581b8ab061cf2aeef.gif?1325772245)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/5225df92de98ed195f65146dc215d3a5.jpeg?1325771495)
(http://farm8.staticflickr.com/7019/6508023829_3d44c4ac16.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/0d6a10e06123ef9759cd72167aa75ea1.jpg?1325707209)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/da83312ccc14a36395fbabfa08b3019a.gif?1325695438)
-
i really want to try that mentos trick lol.
-
I just looked at my mouse... lol
-
scared of my mouse now, thanks bitch.
-
i really want to try that mentos trick lol.
-
[youtube]http://www.youtube.com/watch?v=tsLQi1dol6A[/youtube]
how i can take kurva?
You need some kurva
[youtube]http://www.youtube.com/watch?v=a56Se27v0aE&feature=youtu.be&t=10s[/youtube]
-
:L
-
KURWA
-
[youtube]http://www.youtube.com/watch?v=wsQOXas7sI8[/youtube]
O KURWA, O KURWA. :L :L :L
-
[youtube]http://www.youtube.com/watch?v=FhVGeIgLdlI&feature=player_embedded[/youtube]
-
3:59 hahahahaha
[youtube]http://www.youtube.com/watch?v=AU6W_YkqILY[/youtube]
-
bazinga!
-
(http://farm6.static.flickr.com/5171/5481854438_2e63b6d01d.jpg)
-
milk
-
[youtube]http://www.youtube.com/watch?v=EYX5fFxcXWU&feature=player_embedded[/youtube]
-
http://www.youtube.com/watch?v=jvijM4Vr7oA
-
[youtube]http://www.youtube.com/watch?v=WGz9QmirLBE[/youtube]
-
i feel like watching that whole porn vid now. such bad acting lol
-
[youtube]http://www.youtube.com/watch?v=zRMvqPRWhCc&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=CUTFFMM-ZIo[/youtube]
:L :L :L :L :L
-
[youtube]7kA8-BPmUEs[/youtube]
-
:L
-
:L :L
-
(http://kwejk.pl/obrazek/813857/deal.html)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/19182692f1824439e70bb40efcc210ec.jpg?1325976325)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/ff32e9764fb0e14b1caabd2b8ed6e06e.jpg?1325868117)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/1bac9b1296f84c776db5605228fe3d25.jpg?1325859500)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/e014e77c148f1347628104239466a809.gif?1325869794)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/dc51b71b951299fec0f7c99709ec3576.jpeg?1325883775)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/accd6c31109b9673fd6b2aa614866c73.gif?1325880657)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/ae05846a4c0b7e21ec409ca0b3a2f045.gif?1326058401)
-
http://www.youtube.com/watch?v=opGbvGa67AQ
[youtube]http://www.youtube.com/watch?v=I8lVGe64fN4[/youtube]
[youtube]http://www.youtube.com/watch?v=Jv_CmrRZljA[/youtube]
-
(http://i1.kwejk.pl/site_media/obrazki/2012/01/accd6c31109b9673fd6b2aa614866c73.gif?1325880657)
BUSTED. :L :L
-
[youtube]http://www.youtube.com/watch?v=b_V37YwCJkM&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?v=Jv_CmrRZljA[/youtube]
hehehe, this was in NL :L
-
[youtube]http://www.youtube.com/watch?v=c3y4-H2l31Q&feature=player_embedded[/youtube]
-
karma.
-
This is so fucking hilarious. :L
[youtube]http://www.youtube.com/watch?v=pRYUx8RsAKg&feature=player_embedded[/youtube]
-
hey guys check this out
[youtube]http://www.youtube.com/watch?v=pRYUx8RsAKg&feature=player_embedded[/youtube]
-
[youtube]http://www.youtube.com/watch?v=c3y4-H2l31Q&feature=player_embedded[/youtube]
(http://img31.imageshack.us/img31/9028/qqqah.png)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/01/e932c5c137dfdb8bb92afb6c9826a0cd.png?1326231887)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/8a436e1691136ecedd947ce6c22ddd39.jpg?1326229757)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/058465ed88f304afdf614b5ea9fea0ff.jpg?1326237526)
-
[youtube]http://www.youtube.com/watch?v=Im8iaua9T0I&feature=related[/youtube]
-
hahaha nice one m4!
-
Ush change avatar pls
-
(http://pics.kuvaton.com/kuvei/nfs_africa.jpg)
(http://pics.kuvaton.com/kuvei/chocolate.jpg)
(http://pics.kuvaton.com/kuvei/no_excuses.jpg)
(http://pics.kuvaton.com/kuvei/doing_it_wrong79.gif)
(http://pics.kuvaton.com/kuvei/a_subtle_note_for_the_husband.jpg)
(http://pics.kuvaton.com/kuvei/pure_magic.gif)
(http://pics.kuvaton.com/kuvei/beer_baby.jpg)
(http://pics.kuvaton.com/kuvei/angry_birds8.jpg)
(http://pics.kuvaton.com/kuvei/bananagun.jpg)
(http://pics.kuvaton.com/kuvei/flying_a_helicopter.jpg)
(http://pics.kuvaton.com/kuvei/hat_trick.gif)
(http://pics.kuvaton.com/kuvei/totally_true.jpg)
(http://pics.kuvaton.com/kuvei/notepad_business_card.jpg)
(http://pics.kuvaton.com/kuvei/gift_multi_trolling2.jpg)
(http://pics.kuvaton.com/kuvei/mortal_pizza.jpg)
(http://pics.kuvaton.com/kuvei/thief_in_the_night.gif)
(http://pics.kuvaton.com/kuvei/family_christmas_photo.jpg)
(http://pics.kuvaton.com/kuvei/portal_xmas_tree.jpg)
(http://pics.kuvaton.com/kuvei/dirty_monkeys.jpg)
(http://pics.kuvaton.com/kuvei/beautiful_smile.jpg)
-
[youtube]http://www.youtube.com/watch?v=XOeYax787K0&feature=player_embedded[/youtube]
-
lmao m4 great collection
-
Ush change avatar pls
what for?
-
(http://pics.kuvaton.com/kuvei/kia2.jpg)
(http://pics.kuvaton.com/kuvei/conversation.jpg)
(http://pics.kuvaton.com/kuvei/elections.jpg)
(http://pics.kuvaton.com/kuvei/cheater13.jpg)
-
(http://pics.kuvaton.com/kuvei/cheater13.jpg)
:L
-
:L
-
:L
-
[youtube]http://www.youtube.com/watch?v=XOeYax787K0&feature=player_embedded[/youtube]
lol :L
run pedobear run!
-
(http://www.basketnews.lt/paveikslelis-35904-bg.jpg)
BUUUUMM! :L :L
-
Turkish airlines: :L
(http://i41.tinypic.com/30xk11c.png)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/01/57fd2ab5f8b9ae6f442170ab44ed6fae.jpg?1326311357)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/c5d8d64af1ec7f43c1bc3a991042a9c2.jpg?1326388760)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/f9a67ec7b85bb60322a8940fb03b7f81.jpeg?1326376580)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/cba4d65921d33b1a8449e0297305755d.gif?1326371947)
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/1427583_700b.jpg)
-
:L
-
(http://i1.kwejk.pl/site_media/obrazki/2012/01/57fd2ab5f8b9ae6f442170ab44ed6fae.jpg?1326311357)
i'm actually just man, my 2nd letter of name is ā :D
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=8XG4jY9MCYk[/youtube]
[youtube]http://www.youtube.com/watch?v=UF4I_BMzRL0&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=y-QC0W7LPPc[/youtube]
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=bgmNjrR1cA0[/youtube]
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=LF9Qk6m_b74[/youtube]
[youtube]http://www.youtube.com/watch?v=HzyXcjqzEw8&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=wwnMfvfPQQE[/youtube]
-
(http://i1.kwejk.pl/site_media/obrazki/2012/01/e23d524f73d1c28ab9b720f052134963.jpg?1326555142)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/e3ab74e5c0f9699ce98059aa4d15b9f0.gif?1326555364)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/e480e3cb636d962cd43b6f5118deda25.jpg?1326537596)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/02fd9c999c28fb5a346890ec107095a3.jpg?1326538176)
-
for mourad :D
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc7/397471_332961736715907_192716404073775_1361113_1570237802_n.jpg)
-
omg what stupidity has done to kids.... :( poor things
-
for mourad :D
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc7/397471_332961736715907_192716404073775_1361113_1570237802_n.jpg)
yeah i seen this lol. awesome.
-
Kids grow up faster nowadays :L
-
:L
-
HARD GAME FOR YOU:
FOUND THE DIFFERENTS
(http://img845.imageshack.us/img845/7773/snoopyd.jpg)
Only for Pro :L :D
-
2 different people
-
ear on 1st one doesn't fix dude's face
-
One of them bumped a topic and got banned :/
-
http://www.youtube.com/watch?v=X2drgbESlR8
-
[youtube]http://www.youtube.com/watch?v=eGab9_1xF-U[/youtube]
-
^
lol shower
-
(http://www.chamsko.pl/demot/100_100_22971930_WYTYFY_przez_Fugens_middle.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/1034518d40c2082ecb688ccda60062de.jpeg?1326674276)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/da87d1c0e02877d784cdc327f6753603.jpg?1326756859)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/23e61aac245dc5fdfbd4dc987e5eeec4.gif?1326751336)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/8bca51d82132bd6faf4371f66ff0b48e.gif?1326749801)
-
(http://static.fjcdn.com/pictures/This+guy+.+WTF+Edit+HOLY+CRAP+TOP+40_2458ed_3184439.jpg)
terry crews ex-nfl/actor
-
[youtube]http://www.youtube.com/watch?v=_i_YHQ74dnY&feature=player_embedded[/youtube]
-
Yes its in dutch, but wait till that police dude goes crazy :L
http://www.dumpert.nl/mediabase/1948701/da1d1d92/classic_.html
-
this video isn't funny, you'll enjoy it anyway.
[youtube]http://www.youtube.com/watch?v=7LCjZehpdWM&feature=related[/youtube]
-
HARD GAME FOR YOU:
FOUND THE DIFFERENTS
(http://img845.imageshack.us/img845/7773/snoopyd.jpg)
Only for Pro :L :D
(http://www.bilgievi.gen.tr/Files/Content/100Dinara%20on-2004.jpg)
@mourad : nice one!
-
btw i'm on the right and the left is my twin
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=TIVijJWiIrQ[/youtube]
-
[youtube]http://www.youtube.com/watch?v=l5KECh9GkrA[/youtube]
epic
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=tWE2xjYodAE[/youtube]
-
[youtube]http://www.youtube.com/watch?v=6ntDYjS0Y3w[/youtube]
-
pod.
[youtube]http://www.youtube.com/watch?v=zS1cLOIxsQ8[/youtube]
-
hahahahaha
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/1948101_460s.jpg)
-
[youtube]http://www.youtube.com/watch?v=ZrK4llAu2T0[/youtube]
-
(http://i44.tinypic.com/255hsoh.jpg)
(http://i42.tinypic.com/1zgt4b8.jpg)
(http://i44.tinypic.com/mll7va.jpg)
(http://i40.tinypic.com/35mlh5j.jpg)
(http://i44.tinypic.com/2bv054.jpg)
-
[youtube]http://www.youtube.com/watch?v=ZrK4llAu2T0[/youtube]
lmao
-
(http://i44.tinypic.com/255hsoh.jpg)
:L
-
Check out body checks from this saison and last saison (NHL)
http://video.nhl.com/videocenter/console?hdpid=49&id=149852 (http://video.nhl.com/videocenter/console?hdpid=49&id=149852)
-
[youtube]-RFA0KBbPwQ[/youtube]
-
How do you crucify a spastic? On a swastika
-
(http://i1.kwejk.pl/site_media/obrazki/2012/01/4d663706008e4193027462ecebb21c5a.jpg?1327073967)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/de5dc99a1c77c02c7f0645fa38fb9349.jpg?1327008783)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/855d5436cb670e9c388f95db339e5b8c.jpg?1327077969)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/3a0c6e42300666eeda2693215a609042.gif?1326975133)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/01/3a0c6e42300666eeda2693215a609042.gif?1326975133)
AHHHHHHH!!
-
[youtube]http://www.youtube.com/watch?v=_Rju0rv7BQg&feature=player_embedded[/youtube][youtube]http://www.youtube.com/watch?v=dBCIgBnhY_E&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=HDaKdpfnYzk&feature=player_embedded[/youtube][youtube]http://www.youtube.com/watch?v=TZ9uuV2z8Gk&feature=player_embedded[/youtube]
-
How to eat pasta like Scorpion
[youtube]http://www.youtube.com/watch?v=2xEX3mkfTbQ&feature=related[/youtube]
-
How to eat pasta like Scorpion
[youtube]http://www.youtube.com/watch?v=2xEX3mkfTbQ&feature=related[/youtube]
yeah snoopy we eat spaghetti witch spoon and fork
-
[youtube]http://www.youtube.com/watch?v=aYV3alDTaGI[/youtube]
I'm also eating pasta at the same time as watching somebody else eat pasta on youtube videos, and my avatar is making me not want to eat pasta
-
scorpion, ma tu hai mai usato il cucchiaio per mangiare gli spaghetti? :o
neanche mio nonno lo faceva :L
-
scorpion, ma tu hai mai usato il cucchiaio per mangiare gli spaghetti? :o
neanche mio nonno lo faceva :L
si al sud si fa cosi il cucchiaio come sostegno per arrotolare meglio gli spaghetti :D :D non direttamente nel piatto :L :L
è piu comodo
[youtube]http://www.youtube.com/watch?v=aYV3alDTaGI[/youtube]
I'm also eating pasta at the same time as watching somebody else eat pasta on youtube videos, and my avatar is making me not want to eat pasta
I WANNA THAT FORK!!!!!!!!!!!!!!!!!!!1
-
loooool
[youtube]http://www.youtube.com/watch?v=GrKSWocbbdw[/youtube]
-
http://www.facebook.com/photo.php?v=2666320652418
-
[youtube]http://www.youtube.com/watch?v=zb8w8yiSUA4&feature=player_embedded[/youtube]
-
(http://i222.photobucket.com/albums/dd96/thunderianz/humor-x/toilet-pc-desk-set.jpg)
-
[youtube]http://www.youtube.com/watch?v=dJtYNHeQBuE&feature=player_embedded[/youtube][youtube]http://www.youtube.com/watch?v=oei2lB9MBo0&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=qdZCsXd9kIQ&feature=related[/youtube]
-
(http://i222.photobucket.com/albums/dd96/thunderianz/humor-x/toilet-pc-desk-set.jpg)
ah...... xD
-
lol xD
That is so psychodelic btw. :L
[youtube]http://www.youtube.com/watch?v=fljKx9nvrL4&feature=player_embedded[/youtube]
-
[youtube]http://www.youtube.com/watch?v=XF7b_MNEIAg[/youtube]
-
lmao :L
-
lolete
-
(http://img.chan4chan.com/img/2011-11-09/1320840144512.gif)
:L :L :L :L
-
[youtube]http://www.youtube.com/watch?v=LJP1DphOWPs[/youtube]
[youtube]http://www.youtube.com/watch?v=mbUVtfUWwF8[/youtube]
[youtube]http://www.youtube.com/watch?v=7IyOvF1ZNcY[/youtube]
-
NSFW!
though it's funny :L
http://i.imgur.com/CLw5y.jpg
-
ohhh, phobos.. fuuuuu :o :o
-
(http://i1.kwejk.pl/site_media/obrazki/2012/01/a8ba91777da59ff7a4855194b7dc554a.png?1327020410)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/ad2327d4329a4f5af577d13a1864bfef.jpg?1327224106)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/2c7e66982ce78e0c1b831d8820fb8ee6.jpg?1327262337)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/b477f15c4d6e2de15fc9dc39c263a2cd.jpg?1327224184)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/548d6f632fe1546ab35cdfc276b8f932.png?1327252236)
-
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/385923_10150444063041555_238688976554_9257318_550855100_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=OYpwAtnywTk&feature=related[/youtube]
-
NSFW:
http://a5.sphotos.ak.fbcdn.net/hphotos-ak-ash4/401987_351366594892963_100000588751230_1246237_450561771_n.jpg
-
NSFW:
http://a5.sphotos.ak.fbcdn.net/hphotos-ak-ash4/401987_351366594892963_100000588751230_1246237_450561771_n.jpg
dayyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyummmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm dodger :blank:
-
IKR, lets travel the galaxy with the help of those, the amount of fuel that pouch provides will take us all around
-
(http://img.chan4chan.com/img/2011-11-09/1320840144512.gif)
:L :L :L :L
LMAO
-
(http://i1.kwejk.pl/site_media/obrazki/2012/01/f8abf361cd96480bf57c247c81cf42df.jpg?1327304691)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/2dbe6dc9eed74b6acf0326dcb39ec2b8.jpg?1327301113)
-
(http://vader.joemonster.org/upload/qqk/512_72242130663a301.jpg)
(http://vader.joemonster.org/upload/qqk/512_7224221783dd7a2.jpg)
(http://vader.joemonster.org/upload/qqk/72242349ed4a1e3.jpg)
OH DEAR!
-
I'm glad I started at the bottom :L
-
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-ash4/398414_2895093629562_1626962547_2577990_1614928130_n.jpg)
-
(http://i39.tinypic.com/1418geu.jpg)
(http://i40.tinypic.com/dww5dc.jpg)
(http://i40.tinypic.com/wkoisg.jpg)
-
[youtube]http://www.youtube.com/watch?v=n6VtSDLHtz4&feature=related[/youtube]
-
(http://i.imgur.com/w9pN0.jpg)
-
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/407593_339682289389325_127628123928077_1224994_1746143568_n.jpg)
-
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-ash4/407626_296572603724081_281627601885248_735841_1809004137_n.jpg)
:blank: :blank: :blank:
-
EW wtf :o
-
bleeh
-
http://www.youtube.com/watch?v=Z4bmLWvf0O4
lol
-
http://www.youtube.com/watch?v=Z4bmLWvf0O4
lol
:L
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-snc7/396654_244522935622659_105651509509803_588064_565885955_n.jpg)
-
haha^
-
lol crom are these ur girlfriends ? :L :L :L
look like tranies imo
-
[youtube]http://www.youtube.com/watch?v=xIl45f6i1PU[/youtube]
[youtube]http://www.youtube.com/watch?v=DJxk3wpPoSw[/youtube]
[youtube]http://www.youtube.com/watch?v=mhdkrwECNGc[/youtube]
-
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-ash4/398414_2895093629562_1626962547_2577990_1614928130_n.jpg)
If Chuck Norris was so strong he would come now and push my head to the keayboar;kdhfaoidhfouaihdfkasdncm,n;lzxnc;vljknxcljkvn[aasdgadgalkvnpaionoeirhtq[
-
(http://www.demotivation.us/media/demotivators/demotivation.us_New-doesnt-mean-better_132673392346.jpg)
-
(http://www.demotivation.us/media/demotivators/demotivation.us_New-doesnt-mean-better_132673392346.jpg)
while thats true id like to see corning gorilla glass®(yeah, its how its called) to be smashed like that.
-
:L
http://www.ebay.co.uk/itm/ill-your-xbox-live-friend-/200703961065
-
(http://i1.kwejk.pl/site_media/obrazki/2012/01/df546b3cfd3041dda0b27be6db50f302.png?1327502638)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/5c76a52fa2933e19579fe6573973cf3a.jpg?1327497368)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/7a3f59675cbe46f565084e00898264d5.png?1327500544)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/5088c9f6e659af4f27bdffe4ab33c6f2.jpg?1327490488)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/b2c57110f4dc8dd8ff8eba36c809c7d6.gif?1327489826)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/0318ec644725b8af7f0d7ea8d4835f5e.jpg?1327447952)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/071a38f512832a35293f112fa18a785e.gif?1327450876)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/8e71099927ca3356a5319feded7d76fd.jpeg?1327452278)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/554f123873302a788f7ed7f1ee12438d.gif?1327367018)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/00ddb3ac5c9f0d9279936d141398bc33.jpg?1327403950)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/053a1695835de522a61c6b592d9a9512.png?1327393517)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/18be8f5c9f6588f7f4e3ee5d2609d69d.jpg?1327505100)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/de87989fe8007fdcd8eb48acb297f9d7.gif?1327497795)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/7d42a2d4ba1166037a0cb1329e63c09d.jpg?1327497195)
-
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/419292_329937827029122_174713512551555_1089023_1040835611_n.jpg)
-
(http://forgifs.com/gallery/d/195600-1/Cucumber_practice.gif?)
-
[youtube]LAImxeQpdsk[/youtube]
-
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/420790_174636022640326_100002817893372_227043_32729993_n.jpg)
-
hahaah good pictures max :L :L :L
-
(http://img.izismile.com/img/img4/20110222/original640/black_humor_640_23.jpg)
-
[youtube]http://www.youtube.com/watch?v=MNQWCxa-QfU[/youtube]
-
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-ash4/424195_231687070247215_145956122153644_492829_2034356275_n.jpg)
-
wtf xD
http://www.ebay.co.uk/itm/250982563719?redirect=mobile#ht_178wt_124
-
[youtube]http://www.youtube.com/watch?v=1zlNNllUYH4&has_verified=1[/youtube]
-
lmfao. it looks like a potato to me.
-
[youtube]http://www.youtube.com/watch?v=BjO7HP7KbGc&feature=related[/youtube]
-
lol
-
(http://i.imgur.com/2ox98.png)
lol
-
:L :L :L
-
[youtube]http://www.youtube.com/watch?v=RzHyeMaHm2s&feature=related[/youtube]
-
:L :L
-
(http://i1.kwejk.pl/site_media/obrazki/2012/01/5428348bc658d70c4179b23c20fb376d.gif?1327671205)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/73f9118b067f50816781940e40f14163.png?1327672077)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/ed650eeaaab9b8cb7989a183aa1dfb38.jpg?1327702769)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/5dbc0ff240b80735d41ae012ba354ba3.jpg?1327699887)
hahha this:
(http://i1.kwejk.pl/site_media/obrazki/2012/01/27d7a41e2501ccd8f1bf864d9c8676d1.gif?1327588537)
-
[youtube]http://www.youtube.com/watch?v=j9J1eC1SFSo&feature=related[/youtube] [youtube]http://www.youtube.com/watch?v=WIn2N0vuQrY&feature=related
[/youtube]
[youtube]http://www.youtube.com/watch?v=A0y9umgze-U&feature=related[/youtube]
-
(http://www.zjm.lt/paveiksliukai/smiley/lol2.png)
-
lol sig
-
:L
-
(http://i.imgur.com/3dnrN.png)
-
lukas, change sig(its too big) and stop double posting ffs your asslicking annoys me
-
avatar too. it's moomans lol
-
true.
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2192518_460s.jpg)
-
no sig can be too big on here anymore, it cuts them off automatically :D
-
Yea.. I saw it, but already deleted. ^^
-
[youtube]http://www.youtube.com/watch?v=phQaE8jVEl8&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=BJbSxMt7oH8&feature=player_embedded[/youtube]
-
He said "God" and God responded lol
[youtube]http://www.youtube.com/watch?v=ydQtsJcMde4[/youtube]
(http://i.imgur.com/HfaM1.jpg)
Couldn't have used a smaller box:
(http://i.imgur.com/iGJod.jpg)
(http://i.imgur.com/BqA9z.jpg)
Too big, but the title: "Once you see it, you'll shit bricks": http://imgur.com/UA0iM
2 best friends:
[youtube]http://www.youtube.com/watch?v=mYXH7ByZYiM[/youtube]
[youtube]http://www.youtube.com/watch?v=Cfw_H18ynCM[/youtube]
[youtube]
http://www.youtube.com/watch?v=DVX9dAj8e8w&feature=related[/youtube]
-
[youtube]
http://www.youtube.com/watch?v=DVX9dAj8e8w&feature=related[/youtube]
lol
-
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-snc7/399902_355811337781367_100000575126678_1274884_1124422362_n.jpg)
-
(http://i39.tinypic.com/351acyv.jpg)
(http://i43.tinypic.com/2w5lf2x.jpg)
(http://i44.tinypic.com/s49zs2.jpg)
-
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-ash4/421475_259736544099141_201021086637354_642268_2135652579_n.jpg)
-
(http://www.spankthellama.com/hashbrowns/main.php/d/2810-1/fat+kid+in+speedos+dancing+gif.gif)
-
Ye, Chuck Norris will never die of heart attack.
His heart isn't so stupid to attack him.
(http://i1.kwejk.pl/site_media/obrazki/2012/01/a3257318517f53acffec1dbcdb6909f1.jpg?1327687528)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/8a0cae69788407c7d08bb27e0770ad0b.jpg?1327863722)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/90777364f66cdda5a74f39ea9b4e69e6.jpg?1327855675)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/6701e35f54c720a541d22b39f9866603.jpg?1327754334)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/456711e8db64dcf7339cf0f66c2269e4.png?1327786834)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/833ff42582781e0d6b892603fda6d8c7.gif?1327867941)
(http://i1.kwejk.pl/site_media/obrazki/2012/01/9f44467af437de60148437a0c1b3862c.gif?1327862939)
-
aaaaaaaah this nail again, now Im gonna miss royal rumble because Im gonna be watching this...
-
ye, this guy literally 'nailed it' :L
-
Fuck that nail gif
(http://www.miscupload.com/upload/14461345140071256688396.gif)
-
Fuck that nail gif
^
(http://www.miscupload.com/upload/14461345140071256688396.gif)
What did he eat?
-
cinnamon
-
(http://forgifs.com/gallery/d/196715-1/Champagne-celebration-censored-F1.gif?)
-
xD
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=9vB47UNXo8Y[/youtube]
-
(http://static.fjcdn.com/gifs/Don+t+you+hate+when+this+happens..+.+I+do_8da6d1_3250905.gif)
(http://static.fjcdn.com/pictures/I+See+What+You+Did+There.+Oh+you+More+hilarious+content_822a8b_3246514.jpg)
-
I translated some jokes for you from polish language lol... Enjoy!
________________________________________________________________________
A young hippie gets on the bus and sees a young and very pretty nun.
So he sits down beside her and asks if she did not want to have sex with him.
- No! - Says the nun. - I'm married to God. - He gets up and
get out at the next stop.
The bus driver, who had heard all the stuffs called the hippie and says:
- If you really want to sleep with her, I can tell you how.
- Tell me! - Says hippie.
- She comes every day to the cemetery at midnight on the night prayer. Just
dress up in a white robe with a hood, beard with fluorescence
powder, eject suddenly and say that you are God!.
So it did hippie. Dressed up, jumped out from behind the tombstone and said,
that he is God and he wants to sleep with her.
The nun agreed to have sex without saying anything, but asked him to make it
anal, because she must remain a virgin. Hippie agreed and when he finished
threw off his hood and shouted:
- Ha, ha, I'm a hippie!
- Ha ha! - Shouted the nun. I am a bus driver!
________________________________________________________________________
Husband comes home, all pleased:
- Jadźka, I won the lottery! Pack up! - Said husband.
- We're going somewhere!? - Said woman.
- No, GTFO!
________________________________________________________________________
In line stand 6-year-old son and his father. Before them stands a thick woman around
with 150 kg minimum. Son says to his father:
- Dad, you see that woman? She is huuuuuuuuuuuuuuuuuge!
Father's face turned red, he was ashamed:
- Son, you can not speak about people this way.
- But she's so faaaaaaaaaaaaat? I have never seen such a fat baby.
- Okay, but it's rude to speak this way about others.
At this point, the woman at the bar received a call pi, pi, pi, pi
A son says:
- Dad! Watch out! She will reverse!
________________________________________________________________________
Husband and wife are eating dinner. His wife splits a soup:
- Look, how do I look! Like a pig!
- Well, and you have even split your soup...
________________________________________________________________________
Wolf caught the hare:
- Please wolf, do not eat me, I'll do what you want!
- Do me a blowjob!
- I can not!
- Snap!
- When I can not!
- Then at least try!!!
*** crunch, crunch, crunch... ***
________________________________________________________________________
Guy runs for departing train from the train platform, waving hands, screaming ... At the end the train slowly disappear in the distance, panting hard guy drops to the bench. railroad worker approaches him:
- What, you missed the train?
- No! I was expelling him from the station you idiot...
________________________________________________________________________
Professor conducts students lessons, one of the students suddenly yawns. Professor with a beautiful smile on his face says to her:
- Oh look! My size : )
________________________________________________________________________
It is a funeral. Coffin at the bottom, people throwing flowers. Suddenly something hits the coffin with hard sound. People look at each other. The guy standing at the bottom says:
- Excuse me, florist was closed, I bought a box of chocolates.
________________________________________________________________________
Plane crashed on a desert island. 1 woman and 100 men.
- Enough of these dirty tricks! - Screamed the woman and commits suicide.
After thirty days, the guys gathered for a conference
- Enough of these dirty tricks! You have to bury her.
Passes the next 30 days. subsequent removal of
- Enough of these dirty tricks! Dug it back.
-
These jokes are quite known here lol, though the first one I haven't heard yet :L
-
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-snc7/395220_167791779996163_165534606888547_253416_2035471808_n.jpg)
-
(http://i.imgur.com/ep6s8.jpg)
-
(http://desmotivaciones.es/demots/201108/dog_driving_car.jpg)
-
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-snc7/396268_244021602340636_100001983952866_552792_1470123652_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=ee925OTFBCA[/youtube]
[youtube]http://www.youtube.com/watch?v=CbuYb6lLHX8&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=-VVqbwfKyJ0&feature=related[/youtube]
-
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-ash4/407069_359882350689310_240011429343070_1430831_1521722_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=ggoseOLlkrc[/youtube]
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/2eb0f4bb34d123094eb6c218e64b416a.jpg?1328056773)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/adf72121085247c586d288c3b4457e6a.jpg?1328110687)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/234fd02ba275b6d9f5be6c507328c6d4.gif?1328107215)
-
lol max always has to post something that is dirty and not funny :L
-
[youtube]http://www.youtube.com/watch?v=-l76OJz4Ei0&feature=g-logo&context=G2ec6badFOAAAAAAAAAA[/youtube]
-
May I ask what is funny about that?
-
i think he referenced "dirty and not funny"
-
maybe not that funny, but still nice to see an intresting shit lol
-
someone get the wank roll, I'm in for a long night!
-
this is funny :L
http://www.dumpert.nl/mediabase/1979331/88eec8cf/hete_huls_in_je_nek.html
-
:L
-
pics from speed cameras:
http://www.radars-auto.com/humour/images/photos-droles.php
-
^lolwtf
-
(http://www.radars-auto.com/images/humour/motard_pied_radar.jpg)
FTW :L
-
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-snc7/409066_224695624283692_100002297686154_483564_746405525_n.jpg)
-
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-ash4/426264_177281555709168_100002819750781_248986_90456330_n.jpg)
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-snc7/408872_231420413612289_100002329974571_517151_1602452075_n.jpg)
(http://i23.one.lt/getAlbumImage?photoId=2196000000161363624&photoType=5)
NSFW: http://i1051.photobucket.com/albums/s421/Subsoldier/1328045122890.gif
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-snc7/408869_2387245454735_1658782440_1790191_42572155_n.jpg)
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-ash4/422239_341105202578816_100000380170566_1188036_852980172_n.jpg)
-
(http://www.supyo.com/home/crazypics/images_1/cowcat.gif)
(http://www.supyo.com/home/crazypics/images_1/wildsnuffy.jpg)
(http://www.supyo.com/home/crazypics/images_1/massage.jpg)
(http://www.supyo.com/home/crazypics/images_1/cookies.jpg)
(http://www.supyo.com/home/crazypics/images_1/Picture2.jpg)
(http://www.supyo.com/home/crazypics/images_1/pogo_small.jpg)
(http://www.supyo.com/home/crazypics/images_2/turbanator.jpg)
(http://www.supyo.com/home/crazypics/images_3/eggs.jpg)
(http://www.supyo.com/home/crazypics/images_10/believe.jpg)
(http://www.supyo.com/home/crazypics/images_20/untitled.jpg)
-
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-ash4/422397_10150573132612243_337747857242_8935077_250756607_n.jpg)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/b7567eb8cf9f2594563ec93011b077c0.gif?1328189029)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/51ac47d97590a75e24c491b5e5ed4a9b.jpg?1328095338)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/42b06d7632a2fafb6f412452bd132f6e.jpg?1328197564)
-
That joke about Simoncelli isn't funny max.
-
pic is supposed to show most famous things of italy and at end that failboat xDDDD
-
haha that's kinda cool :P
-
[youtube]http://www.youtube.com/watch?v=uplyr-XiEv0[/youtube]
YEAH.
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2307393_460s.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2276790_460s.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2302998_460s.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2289451_460s.jpg)
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2307393_460s.jpg)
haha I never realized that blind people can't see the tv :L (I already noticed these braille buttons on my remote control)
-
haha I never realized that blind people can't see the tv :L
I JUST HAD THE BEST LAUGH THIS YEAR
-
Haha I IRL lolled at the Twilight car one.
btw not to spoil the fun, the buttons are probably there for people who cannot see well: there are a lot of movies on Sky that have narration for people with poor sight etc.
-
Lmao great jokes :L
-
I have these bumps on every remote in my house :P and lol i just looked to the left and there is a roll of toilet paper on my desk,and i can't remember why i keep it there :L
-
we all know what the use of toilet paper on your desk is.
-
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-snc7/417209_330835850290501_100000922651045_930688_1107700936_n.jpg)
-
those grips there are if u want to turn tv in dark(not that average ppl would differ the symbols on the grips)
all keyboards/keypads have a grip at 5/f/j/onoff buttons/but not like these.
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/e398533b0e9df4a74a74d45c48c15f82.jpg?1328214662)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/f147e3ef180e9425153e09febea17d63.gif?1328214529)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/fa24508317b728b4a700da21134f4cae.jpg?1328212585)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/1daa9e2e83792f2cee5d65caa4d86f9b.jpg?1328211766)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/015ef8344ff481029c87d2e372f24e65.gif?1328208840)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/83cb830f7ac95efc95fff75d6f718749.jpg?1328207986)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/319591f4cf6ba763825de00d25d85453.gif?1328207882)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/482d021858a3624e725b35c5ba1df110.png?1328218897)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/c4d6255a172fe02342ae7240b3624dcc.jpg?1328216990)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=LG9G0kyzS4s[/youtube]
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/f147e3ef180e9425153e09febea17d63.gif?1328214529)
:L Best Reaction!!!
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/482d021858a3624e725b35c5ba1df110.png?1328218897)
Beach? BEACH?
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/f147e3ef180e9425153e09febea17d63.gif?1328214529)
thats epic :L
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2329384_460s.jpg)
-
so true :L
-
^ :L
-
[youtube]http://www.youtube.com/watch?v=eenQUwM7124&feature=player_embedded[/youtube]
-
[youtube]IuBRTtoQwL4[/youtube]
(http://26.media.tumblr.com/tumblr_lg4qw9y3yr1qcczkzo1_400.png)
(http://fc04.deviantart.net/fs71/f/2011/176/2/2/pedrobear_by_asanashina-d3k0inl.jpg)
(http://desmotivaciones.es/demots/201009/MexicanPedrobear.jpg)
(http://29.media.tumblr.com/tumblr_lg6delKJeb1qcczkzo1_500.png)
-
chujowy pies
(http://i1.kwejk.pl/site_media/obrazki/2012/02/7555e924a4e5461e5b881a18a1f89ea4.jpg?1328267131)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/d2874d1a311da72aec26d0a705fe8a85.jpg?1328287714)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/866d7b2b7e82759b12720504d1894735.jpg?1328297685)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/77a20501f663d6a3945c6ae5c32f3b3d.gif?1328297177)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/52d21b53af7c8e69d650ce928faeb6df.jpg?1328296817)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/e2d5efc3c8a5f03d8cdcfc507b5d56c8.jpg?1328296232)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/ad1bbe0ca688ac88e4363083c39d2973.gif?1328293127)
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2355592_700b.jpg)
-
:L
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2355592_700b.jpg)
I think it doesn't include Pit Stops. :L
-
Ha ha.
(http://s16.postimage.org/7b4sexs2d/386260_10150395557212874_673102873_8478929_11872.jpg)
-
:L
-
[youtube]http://www.youtube.com/watch?v=TFXdRd8N0Cw&feature=related[/youtube]
-
I suggest mooman to record himself eating cinnamon powder :L
-
[youtube]http://www.youtube.com/watch?v=KKrfTzXE7vc[/youtube]
-
cool CRT bro
-
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-ash4/392910_311490188863166_222806737731512_1365997_351132545_n.jpg)
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-snc7/302492_311490582196460_222806737731512_1366013_1939786561_n.jpg)
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc7/384283_311490172196501_222806737731512_1365996_1965101531_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=YAKmwrW9l9E&feature=related[/youtube]
-
anybody remember this?
(http://i.imgur.com/48PE7.jpg)
err...
[youtube]http://www.youtube.com/watch?v=7Osu4zew6pU&feature=related[/youtube]
i'm on the wrong side of youtube again :|||
[youtube]http://www.youtube.com/watch?v=uaxY3YkwpWs&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=V3ROsVTKVDw&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=h3DInKALGtg&feature=related[/youtube]
-
whoever seen 'Star Wars' (original trilogy) will easly get this one:
(http://i1.kwejk.pl/site_media/obrazki/2012/02/4b830b7c2ff0a8e33964578e2cce03a8.jpeg?1328468806)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/944b6b92a5739cc6c4ead1f98a924ed0.jpg?1328464268)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/9627a55d47b7ecb2f5fa0c28b8514c65.jpg?1328370306)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/efca1332c07894113533758298704376.png?1328351723)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/ede685189d161d1ea3210c3b50e72573.png?1328468107)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/534bfd1c18c697bb7c22b21f128cf219.jpg?1328371338)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/aa51e0b11060d1fb7b1e9d002f62a3f4.jpg?1328367364)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/78fab93f7315f6fbe9c343e47a6d7fdf.jpg?1328314265)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/a563edec5616a7d0d7a26eb8dd371ab5.gif?1328277111)
and at end:
take a guess >:D
(http://www.tikihumor.com/wp-content/uploads/tiki-humor/2011/11/the-difference-between-a-blonde-and-a-mosquito-479x500.jpg)
-
''Megatron getting fucked in the ass'' I literally LOL'd with that
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/efca1332c07894113533758298704376.png?1328351723)
[youtube]http://www.youtube.com/watch?v=q_phU1coQCU[/youtube]
-
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc7/424674_231972466889834_108312895922459_525086_1685635142_n.jpg)
-
[youtube]nh9OTl1vTho[/youtube]
-
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc7/424674_231972466889834_108312895922459_525086_1685635142_n.jpg)
haha
-
(http://www.chamsko.pl/demot/100_100_1444926882_KFC_przez_Vizard_middle.jpg)
(http://www.chamsko.pl/demot/100_100_2081661087_Ciasteczka_przez_alfred77_middle.jpg)
(http://www.chamsko.pl/demot/100_100_413602025_papiez_przez_kalendarz_middle.jpg)
(http://www.chamsko.pl/demot/100_100_242464104_Hitler_przez_alfred77_middle.jpg)
(http://img441.imageshack.us/img441/6782/100100231558080hmmprzez.jpg)
-
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-ash4/428231_334692513220320_174713512551555_1100684_1766640953_n.jpg)
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-snc7/422258_330621230294115_174713512551555_1090450_1640822850_n.jpg)
-
(http://i.imgur.com/hFmCg.jpg)
-
how to turn off a cat:
(http://i1.kwejk.pl/site_media/obrazki/2012/02/0b4a4a67498e293ae2b3480feb05d285.gif?1328529393)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/0cd553f8adc1fd0e3effdae75c268603.jpg?1328464226)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/eb6368f2f99121f3e63c93ac5bce4667.jpeg?1328441449)
-
how to turn off a cat:
(http://i1.kwejk.pl/site_media/obrazki/2012/02/0b4a4a67498e293ae2b3480feb05d285.gif?1328529393)
:o :o :blank:
-
[youtube]nh9OTl1vTho[/youtube]
FAP FAP FAP FAP
-
[youtube]http://www.youtube.com/watch?v=KeWsk_vPyKY[/youtube]
[youtube]http://www.youtube.com/watch?v=GHy1E7SkGgU[/youtube]
-
[youtube]http://www.youtube.com/watch?v=XOxwBvozhf4&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?v=IqxumHvUkWw[/youtube]
lol
pluma pluma gay
-
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-ash4/404257_203723419725232_122098557887719_370895_1687075177_n.jpg)
Entertainment for Peter Rolih’s pre-wedding buck’s party was inspired by that famous scene of the woman expelling the ping pong balls in the comedy film The Adventures of Priscilla, Queen of the Desert. But this time the projectiles were not little celluloid objects but something rather more solid. And when the scantily clad exotic dancer performed her party trick – shooting dildos at the guests from her private parts, best man Darwin architect Jure Skumavc, 31, found himself in the firing line. As the Rupert Murdoch ownedNorthern Territory News reports this morning, Mr Skumavc was injured by the bullet-shaped, pink, sex toy – measuring about 12cm in length.
Mr Skumavc was still sporting a scar on his forehead at Mr Rolih’s wedding nearly three weeks after being dinged by the artificial dong. The darting dildo drama unfolded on December 28 in a rented two-bedroom unit in Brisbane.
Mr Skumavc said about eight other friends joined Mr Rolih for the party. …
He said the pink projectile was flying an impressive 7m across the room and looping about 2m high.
“It wasn’t a strong shot (when it hit me in the head),” he said. “It probably just landed on an awkward sort of angle.”
“She was shooting it through the room from one corner to the other,” he said.
“Other people got it in their chest and knees. I was the only one bleeding. It was my turn and it landed straight on my forehead.
“She started apologising straight away but I just said it was fine … then I touched my forehead and there was blood.”
Mr Skumavc had difficulties describing the tearaway toy in detail.
“I don’t have a massive experience with dildos,” he said. The scars left by the offending object have since healed, but Mr Skumavc said the story was still very much alive.
“People keep asking how close my face was (to cause that sort of injury),” he said.
-
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-ash4/422509_235928789825930_150625068356303_510433_674247638_n.jpg)
-
rofllllllll merc
-
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-ash4/401487_235026833249459_150625068356303_508027_1367279472_n.jpg)
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-ash4/423116_234991639919645_150625068356303_507896_1450214371_n.jpg)
-
(http://i.imgur.com/VTrmS.jpg)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/b36a1ecaf68e0e6d9a7d9b143c4655da.jpg?1328613472)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/e1006bf48f0f5064a1edd0b4390555cd.jpg?1328572851)
(http://bitsandpieces.us/wp-content/uploads/2010/11/imagessubmarine-battle.jpeg)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/df3e0fccef645f335045a0b14394a00e.jpg?1328634656)
-
haha! you always find the funniest pictures
-
1. go to google maps
2. turn on satelite view
3. type 26.357865,127.783782
4. scroll max
5. see what's there
6. :L
-
haha :L
-
[youtube]http://www.youtube.com/watch?v=gz2hgEdGuqQ&feature=player_embedded#![/youtube]
-
(http://www.playfin.com/blog/wp-content/uploads/2011/09/Console-vs-PC.jpg)
-
there are even more funny things at google maps/view
http://funfunpics.blogspot.com/2010/07/40-bizzare-illustration-found.html
http://www.urlesque.com/2009/02/05/top-10-moments-caught-on-google-maps-street-view/
lol:
(http://studentpotrafi.pl//uimages/services/studentpotrafi/i18n/pl_PL//201201/1328021298_by_Doknic_500.jpg?1328021299)
(http://studentpotrafi.pl//uimages/services/studentpotrafi/i18n/pl_PL//201201/1328020708_by_Doknic_500.jpg?1328020709)
(http://studentpotrafi.pl//uimages/services/studentpotrafi/i18n/pl_PL//201201/1327957510_by_agunia442_500.jpg?1327957512)
(http://studentpotrafi.pl//uimages/services/studentpotrafi/i18n/pl_PL//201201/1327938728_by_Doknic_500.jpg?1327938728)
(http://studentpotrafi.pl//uimages/services/studentpotrafi/i18n/pl_PL//201201/1327858382_by_b4x_500.jpg?1327858384)
(http://studentpotrafi.pl//uimages/services/studentpotrafi/i18n/pl_PL//201201/1327677018_by_Break_500.jpg?1328059347)
(http://studentpotrafi.pl//uimages/services/studentpotrafi/i18n/pl_PL//201201/1327668302_by_FleXi_500.jpg?1327668302)
(http://studentpotrafi.pl//uimages/services/studentpotrafi/i18n/pl_PL//201201/1327577961_by_Doknic_500.jpg?1327577961)
(http://studentpotrafi.pl//uimages/services/studentpotrafi/i18n/pl_PL//201201/1327577859_by_Doknic_500.jpg?1327577860)
(http://studentpotrafi.pl//uimages/services/studentpotrafi/i18n/pl_PL//201201/1327577752_by_Doknic_500.jpg?1327577753)
(http://studentpotrafi.pl//uimages/services/studentpotrafi/i18n/pl_PL//201201/1327577222_by_Doknic_500.jpg?1327577222)
(http://studentpotrafi.pl//uimages/services/studentpotrafi/i18n/pl_PL//201201/1327335388_by_Break_500.jpg?1327335389)
(http://studentpotrafi.pl//uimages/services/studentpotrafi/i18n/pl_PL//201201/1326882764_by_Break_500.jpg?1326882764)
(http://studentpotrafi.pl//uimages/services/studentpotrafi/i18n/pl_PL//201201/1326293355_by_Break_500.jpg?1326293356)
-
[youtube]http://i.imgur.com/7EAfH.jpg[/youtube]
-
[youtube]http://i.imgur.com/7EAfH.jpg[/youtube]
own3d
-
:L
[youtube]http://www.youtube.com/watch?v=2Ig3qvcpR38[/youtube]
-
haha
-
http://www.youtube.com/watch?v=ZyhrYis509A&feature=related
lol i got many thumbs up
-
i added one for you :D
-
:L
[youtube]http://www.youtube.com/watch?v=2Ig3qvcpR38[/youtube]
[youtube]http://www.youtube.com/watch?v=rhrJry8iGFY&feature=related[/youtube]
-
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-snc7/407607_236265266458949_150625068356303_511049_1014938177_n.jpg)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/ec7925c6c2af48982cb61d0e9ae10c79.jpg?1328693315)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/dd46b44790a24dc81abaf113ce008051.jpg?1328706451)
movies covers 'creativity'
(http://i1.kwejk.pl/site_media/obrazki/2012/02/4b7be48e1982db35230aca01f6f77dd6.jpg?1328658758)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/8beb1d295659cb61e690d92bf5eb6d4e.jpg?1328658820)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/e4e362d86ce376e9ba30efc72634dd92.jpg?1328658836)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/cdb7130a53df70c5b9dad95fe1274d54.jpg?1328701777)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/0661d58e2cdac38e4f5c20e8ef448ce7.jpg?1328707834)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/6a5e0dc6af0411cd4824326b46e380a8.jpg?1328749471)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/c13323b5a503692a008c0291413c0c15.jpg?1328748444)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/253bcbe480821a1d81dada63cd8ce78e.jpg?1328743967)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/ddabb46cf75bc892feff365be23e350c.jpg?1328744050)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/2aed824c4d04b8587e47f89733d9b0b8.jpg?1328742934)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/ac597f6cd1599d3b163393fc2529aecd.jpg?1328739383)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/8a86541519f3fa47f289f2f3637a0f7e.png?1328733969)
-
erm... I got lost in youtube lol
[youtube]http://www.youtube.com/watch?v=QdCsYeolx6U&feature=fvwp&NR=1[/youtube]
-
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-ash4/422190_239310526154423_150625068356303_518917_1207366129_n.jpg)
-
lol
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2480465_460s.jpg)
-
hai ivan :D
-
LOL is that a female?
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/886db810a85d4bb80a3f9a61d1298e3d.jpg?1328785206)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/c47d6da6f08ee900d6f66b7a0245ff01.jpg?1328786613)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/1a328faf43e00758531255a0082974bf.png?1328685249)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/c61d42560559ea657b5471f837f559a5.jpg?1328820585)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/9be4c6194aaa2592b96dccd86b0c5f80.jpg?1328818288)
-
404
-
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-ash4/418665_345774738779433_100000407302611_1097462_1132158660_n.jpg)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/8c7a25f2d37769409882302bebe4a427.gif?1328774535)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/8f73f421277d69945c6d558976345c10.jpg?1328882548)
-
ONCE YOU SEE IT...
(http://i.imgur.com/UA0iM.jpg)
-
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-ash4/409436_365798666783484_100000600603356_1281106_772695497_n.jpg)
-
ONCE YOU SEE IT...
(http://i.imgur.com/UA0iM.jpg)
was looking 2 minutes
-
ONCE YOU SEE IT...
(http://i.imgur.com/UA0iM.jpg)
was looking 2 minutes
I already am an expert in ''shit brix'' photos :L
-
ONCE YOU SEE IT...
(http://i.imgur.com/UA0iM.jpg)
was looking 2 minutes
I already am an expert in ''shit brix'' photos :L
same lol saw it 1st sec
-
why is she not sitting on the couch
-
its photoshop lol
-
(http://www.moillusions.com/wp-content/uploads/2010/11/TGjem.jpg)
(http://i.imgur.com/cFe3J.jpg)
(http://i.imgur.com/d4bsZ.jpg)
(http://www.funnyflash.com/img/funnies/submissions/31/shoulder_or_butt.jpg)
(http://i.imgur.com/8uIsh.jpg)
(http://i.imgur.com/Tfl1Y.jpg)
(http://i.imgur.com/gN21F.jpg)
(http://i.imgur.com/SyQM7.jpg)
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2575779_700b.jpg)
-
(http://28.media.tumblr.com/tumblr_lz7p2oejWi1qcb5fko1_500.jpg)
(http://i.imgur.com/L4xdO.jpg)
(http://i.imgur.com/HAe38.jpg)
(http://i.imgur.com/EUdlN.gif)
(http://i.imgur.com/nu5GZ.jpg)
(http://i.imgur.com/Enh9R.gif)
-
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-ash4/405891_322061717829541_270282923007421_827979_1195996862_n.jpg)
-
(http://www.chamsko.pl/demot/100_100_950377817_911_amerykanow_nie_rozumie_tego_dowcipu_przez_alfred77_middle.jpg)
(http://www.chamsko.pl/demot/100_100_37735100_Co_zrobic_podczas_przez_karol1000_middle.jpg)
(http://www.chamsko.pl/demot/100_100_695795800_Milkszejk_przez_Fugens_middle.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/2b731a35a45f90ea17a0efb392fdd078.gif?1328841073)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/c68a4b6a7275ddb7726aa0d9ed0bf2b7.jpg?1328957414)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/b66321b45fdc7ed54ed561964c8eaa95.jpg?1329021169)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/48e9d19607a18adf2f23a1dff98ad46b.jpg?1329006294)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/2b731a35a45f90ea17a0efb392fdd078.gif?1328841073)
lol cunt punt :L
-
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-ash4/409417_10150667464272704_316573387703_11290669_882075751_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=uPttQmTRC38&feature=related[/youtube]
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/e510008e278f3d2c0288440ea0698193.jpeg?1329054860)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/a1b286160c18f30bfe601bd9eb90ba28.gif?1328987708)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/936e1f57beca1dd7e7abb656a8759843.jpg?1328986852)
-
look at today's email date
(http://i.imgur.com/GPGSI.jpg)
its already 25/12/2012 :o
-
czech tv news, when i saw it live with my own eyes a few days ago, couldn't fucking believe it :L
(http://i.imgur.com/UbRSQ.jpg)
(http://i.imgur.com/rrZA2.jpg)
(http://i.imgur.com/2MIBh.jpg)
(http://i.imgur.com/l2HHi.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2515875_700b.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2490543_700b_v1.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2456778_700b.jpg)
-
(http://a1.sphotos.ak.fbcdn.net/hphotos-ak-snc7/405870_237744009644408_150625068356303_514675_1950199510_n.jpg)
-
:L
-
pure awesomeness phobos :D
-
[youtube]http://www.youtube.com/watch?v=2qmbwY2LijQ&NR=1&feature=endscreen[/youtube]
O_o
-
Lol :O imagine that how it would look on AX :L
-
doesn't work properly on sa-mp. just tried it :( still good in single player though
-
(http://i.imgur.com/AkuAG.png)
(http://legacy-cdn.smosh.com/smosh-pit/112010/alone1.jpg)
-
poor krissi :L
-
poor krissi :L
-
[youtube]http://www.youtube.com/watch?v=nE-MQMOjes4&feature=endscreen&NR=1[/youtube]
-
haah nice one snoopy!
(http://tosh.comedycentral.com/blog/files/2011/02/forever-alone.jpg)
-
hahaha SAINT BALENTIN :L :L
-
(http://pics.kuvaton.com/kuvei/dogs10.gif)
-
^lmao,
poor krissi :L
-
(http://i44.tinypic.com/hw064j.gif)
-
(http://pics.kuvaton.com/kuvei/dogs10.gif)
Fuck yeah, salto. :L
-
(http://i44.tinypic.com/hw064j.gif)
+rainbow
=
Nyan Cat!
Antigravity Nyan Cat lol :L
-
happy valentines day lol
(http://i1.kwejk.pl/site_media/obrazki/2012/02/a3fabb0c6c44be788d8919a7eff8282f.gif?1329214205)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/87a2309c322a44aea79efdc753223cc0.jpg?1329222834)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/2ac9d914ea34cf026c25eede685290cb.gif?1329075130)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/676e6b64229bf530b5b1acf5b1bfbdbd.gif?1329233483)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/a7de42e1fd32349283053666666652b5.gif?1329240644)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/0d6f2830f21c16ebd1a03adf2f85d66c.jpg?1329239595)
NSFW:
http://i1.kwejk.pl/site_media/obrazki/2012/02/f73ed62c1b82d4f5dbcd9e1bfc785b40.gif?1329241871
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/2ac9d914ea34cf026c25eede685290cb.gif?1329075130)
8 years old
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/2ac9d914ea34cf026c25eede685290cb.gif?1329075130)
8 years old
Now 17 year. Next year he will be die. :L
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc7/404944_258362950905324_105651509509803_615317_1916882992_n.jpg)
Happy Valentines day! <3
-
[youtube]http://www.youtube.com/watch?v=Eub39NaC4rc&feature=related[/youtube]
-
dafuq?How could electronic things work under water?:L
-
it's not water
-
Oil?Anyways...that's still strange...
-
[youtube]http://www.youtube.com/watch?v=ii2orq2rvhM&feature=related[/youtube]
-
He says; "I wanna laugh for 5 minutes".
[youtube]http://www.youtube.com/watch?v=jvmyRO4L3WA[/youtube]
-
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-ash4/424721_214318588664989_206247326138782_386100_1676612742_n.jpg)
-
(http://pics.kuvaton.com/kuvei/cat116.gif)
[youtube]http://www.youtube.com/watch?v=ZWG5GAONj2Q[/youtube]
-
fire brigade ftw
-
[youtube]http://www.youtube.com/watch?v=YIAnkrPgTvY[/youtube]
-
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-snc7/398465_221728364585594_203142206444210_440975_1488827974_n.jpg)
Russian version :L :L
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/2ac9d914ea34cf026c25eede685290cb.gif?1329075130)
Michael Jackson was 50, Amy Winehouse was 27 and John F Kennedy was 46.
-
yeah justina baby is 17 not 18
-
(http://www.dodaj.rs/f/7/XT/1fLkuM7f/395355101505337528123442.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2644087_460s.jpg)
(http://i.imgur.com/mcGbQ.gif)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2575481_700b.jpg)
(http://www.wwtdd.com/wp-content/uploads/2000/08/giveafuck.gif)
(http://i40.tinypic.com/2yx5374.gif)
(http://slike.milf-hosting.info/images/1328263317.jpg)
(http://i39.tinypic.com/1jay6e.gif)
(http://a2.sphotos.ak.fbcdn.net/hphotos-ak-ash4/401135_3056874391773_1560766763_2810660_709151288_n.jpg)
^
-
(http://i39.tinypic.com/1jay6e.gif)
LOL
-
(http://i39.tinypic.com/1jay6e.gif)
LOL
:L :L
-
This is just....WTF?
[youtube]http://www.youtube.com/watch?v=7q1an0dZM-s[/youtube]
-
:o :o
-
:L :L :L
-
(http://www.part.lt/img/18db3c592d674289756fa6cc544d49de901.jpg)
-
This is just....WTF?
[youtube]http://www.youtube.com/watch?v=7q1an0dZM-s[/youtube]
haha I saw that one yesterday when I was stoned as fuck and I laughed for 5-10 minutes and replayed it 3 times :L :L
especially the chain saw is so random! LOL
-
[youtube]http://www.youtube.com/watch?v=7q1an0dZM-s[/youtube]
When I saw him fall, all I said in my mind is "Wtf were you thinking?"
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2685154_460s.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2686664_460s.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2688044_460s.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2659799_460s.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2673572_460s.jpg)
-
NSFW: http://www.youtube.com/watch?v=B3pXzpfqFxI&feature=player_embedded
-
Not funny but amazing:
Japanese Boeing taking off:
(http://i.imgur.com/IMA5v.jpg)
..
(http://i.imgur.com/zeEjp.jpg)
[youtube]http://www.youtube.com/watch?v=4B36Lr0Unp4[/youtube]
-
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-snc7/404876_10150565216871840_21785951839_9304465_2113358504_n.jpg)
-
http://lifeandtimes.com/99-problems-in-film
-
(http://a2.sphotos.ak.fbcdn.net/hphotos-ak-ash4/420816_325248684177511_270282923007421_835147_1500073381_n.jpg)
-
(http://i.imgur.com/cID24.gif)
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2685154_460s.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2686664_460s.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2688044_460s.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2659799_460s.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2673572_460s.jpg)
Supershit website is supershit.
Still, those pics own for 9gag's standard.
-
Oh also:
(http://i812.photobucket.com/albums/zz41/gtamyths1/goblin.png)
Whaddafuck.jpg
-
http://www.joemonster.org/filmy/42103/Spiacy_pasazer_i_Niemka
-
Off-Topic
For things that are nothing to do with the server
44,444 Posts
999 Topics
Last post by [MAF]Nikki
in Re: What`s Cookin`Doc!?
on Today at 09:15:07 AM
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2735687_700b.jpg)
lmao
-
(http://i.imgur.com/epz4I.jpg)
-
snoopy you apple
-
snoopy you apple
nuh-uh i'm a orange
-
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-ash4/423592_344659872224033_240907832599238_1085542_668303787_n.jpg)
-
http://http://t0.gstatic.com/images?q=tbn:ANd9GcS1byh81tHs0ImV8jSkbZFy9pM86R1fYL8sUofv3QzPLAKdlWyeeg
OMG, i have a twin!
-
[youtube]http://www.youtube.com/watch?v=mSjeTFx5JI4[/youtube]
-
(http://a5.sphotos.ak.fbcdn.net/hphotos-ak-ash4/420131_344732598899809_100000892168882_1009977_1595389069_n.jpg)
-
(http://www.chamsko.pl/demot/0_0_241636355_System_of_a_down_przez_Fudi84_middle.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/aefd4a13c4890dc35a25c630d4f4ff5a.gif?1329478441)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/552c5541836c03b2b33adbfede825807.gif?1329617125)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/13f439908c6681fca5315383b64d44b6.gif?1329617343)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/1a337e83132f5d8cca4fbabf7d00456e.gif?1329558330)
(http://www.chamsko.pl/demot/0_0_1483524036_cappucino_przez_melinkq_middle.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/9501386670ae2408ec42dbb3b82a39d2.gif?1329311313)
(http://www.chamsko.pl/demot/100_100_2051869795_Dom_nie_do_poznania_Africa_Edition_przez_Sapermiw_middle.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/fc8a0c817afe7ab0b61a7465fba7f07e.jpg?1329562588)
(http://www.chamsko.pl/demot/0_0_1842795075_CO_TO_JEST__przez_Dexter_middle.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/51f12bdf4355e4ed8286770b3b6a3651.jpg?1329562652)
(http://www.chamsko.pl/demot/100_100_1163983600_Haha_przez_krrryskaDzifffko_middle.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/814f3b2d1d52774dbb947f4a9fe60d05.jpg?1329464352)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/24e70964b374bf746f418218af3c591f.gif?1329408636)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/24e70964b374bf746f418218af3c591f.gif?1329408636)
[youtube]http://www.youtube.com/watch?v=m9-kM-guQtk[/youtube]
-
the fuck lmaoooooo
-
NSFW: http://a3.sphotos.ak.fbcdn.net/hphotos-ak-ash4/420430_275184472554608_177507798988943_694357_206335542_n.jpg
-
dude, stop posting pics like this, or at least tell us its nsfw...
-
Pic
Vid
I got a jackpot (http://africanlion.ru/Jackpot.gif)!
-
lol
-
hahaha
-
max heels and forks BLEH
-
down syndrome = not fun
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/13f439908c6681fca5315383b64d44b6.gif?1329617343)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/1a337e83132f5d8cca4fbabf7d00456e.gif?1329558330)
wtf :L :L
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/951663ac0cc19b2d010f7b69069bb05d.gif?1329666322)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/03065ac051318cdfe4bc50dcd430ce6e.gif?1329600474)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/a4fa11efc5506a0dcc7979c3eafe8812.jpg?1329674704)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/dc8ac2209e1ba48cbc648701139b3828.jpg?1329674371)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/c9163db59617fb0c5ce882e473b02fe6.jpg?1329673069)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/2fba9181c604e61b5b2267f4e666224b.jpg?1329658786)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/0b2269f555bd5c3d000d294279d2cc9f.jpg?1329653872)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/344ada1c2b7792673a0665a84c9ab5b1.png?1329667515)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/478fd5a11c3ca3a06fe615ce1fa91ed5.jpg?1329666062)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/2ce737f8a0938463563b3bbe086158c9.gif?1329664978)
-
MetalCockSolid :L :L :L
-
lmao :L
-
may i ask what ministry of healthiness has to do with those pics?
-
kind of 'joke' to not get addicted or die of laugh :L
-
dyingoflaughter@rip.co.uk
-
Johnny Cash , not Johnnie :o
-
[youtube]http://www.youtube.com/watch?v=ik1_VNbxxFg&feature=fvwrel[/youtube]
looooooooooooooooooooooooool.
-
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-ash4/419761_246601898758619_150625068356303_534823_572167483_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=ik1_VNbxxFg&feature=fvwrel[/youtube]
looooooooooooooooooooooooool.
still better than orginal
-
(http://pics.kuvaton.com/kuvei/failure_skater_kid.gif)
Quite old but ouch.
-
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-ash4/404775_253668388045429_109696872442582_567264_1661595376_n.jpg)
ADIDAS forever!
-
^^^^^^^^^^^^^^^^^^^^
(http://up.artificialanimation.com/images/untitled-3-1328566571.gif)
-
Like? :L :L
-
hit a deer? quick, take a nice photo for facebook
(http://www.chamsko.pl/demot/0_0_513024740_Jelonek_przez_xxxcyrulxxx_middle.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/c8faf041b1dd5da1800b1e1e4c870a5d.jpg?1329770581)
(http://www.chamsko.pl/demot/0_0_898842511_francuzi_przez_boxman_middle.jpg)
(http://www.chamsko.pl/demot/0_0_88419894_mudzin_parkour_przez_Vigosky_middle.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/46b097608f832ce7c6fdd65c860e2989.jpg?1329773800)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/e1d73e1b63e698083974d2a7bf58ab54.jpg?1329773320)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/a76e31cb954f6a62c370c8aceefcb201.jpg?1329770993)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/9eddfd11ebd48bab4c5dad46383d04d1.jpg?1329769966)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/783bc1ad6dace5fd8c6820120ec6c133.gif?1329768518)
evil popcorn
(http://i1.kwejk.pl/site_media/obrazki/2012/02/edc795b969a1b3907bedc8c29b953b43.jpg?1329771249)
i doubt this is NSFW anyway:
(http://www.chamsko.pl/demot/0_0_163882248_Marchewkowe_Bukkake_przez_Necromancienne_middle.gif)
but this one can be classified i thing:
http://i1.kwejk.pl/site_media/obrazki/2012/02/6e2e406f05e43a2bb674ae4a71e4670b.jpg?1329769069
-
Picture with deer sounds fake,there is no blood at all
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2781283_460s.jpg)
-
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-ash4/317605_311490972196421_222806737731512_1366027_305613951_n.jpg)
-
my new home , MOON :
(http://i.imgur.com/rjDUU.png)
-
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-ash4/431381_335465486496205_100000982681518_974568_1789514677_n.jpg)
-
pro monkey :
[youtube]http://www.youtube.com/watch?v=pR1Rp-Vin9A&feature=g-all-lik&context=G23d38afFAAAAAAAAAAA[/youtube]
-
lollllll
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2855805_700b.jpg)
-
:L
-
lmao :L
-
lol :L
-
Doctor House? :blank: :L
(http://a3.sphotos.ak.fbcdn.net/hphotos-ak-snc7/396972_244459292307818_108312895922459_554712_1659588420_n.jpg)
-
LMAO!
-
lollllll
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2855805_700b.jpg)
haha... actually I was playing SA single player once and some pedestrian complimented CJ about his haircut and I replied 'positively' and CJ said "to be honest, its a wig"
-
Hah :L and lol why this....uhm how I should call this barber dude....erm,oh yes!Morgan Freeman :D but...why his teeths are blue :O
-
moo and snoop used to have this in the sig.
http://escism.net/omfgdogs/
-
moops
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2883291_700b.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2666334_700b.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2776725_700b.jpg) (ham twice)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2255687_700b.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2274945_700b_v1.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2086637_700b.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2884276_700b.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2912508_700b.jpg)
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/2086637_700b.jpg)
why in 1st picture he drives Charger, and later is shown in some SUV/Pickup?
-
this is epic
[youtube]http://www.youtube.com/watch?v=aAMbD4zMvN4[/youtube]
-
smile guys :)
(http://i39.tinypic.com/29zd7us.jpg)
-
(http://i.imgur.com/n9hl1.jpg)
-
[youtube]8s7ROEBtFsg[/youtube]
not funny ¬_¬
-
offtopic... and my ears are bleeding
-
Homer, the great, found way to...
(http://i1.kwejk.pl/site_media/obrazki/2012/02/d5489ed717703b7e2a6b398eb49bb348.jpg?1330257090)
...cheap refueling!
-
I'm gonna shoot myself if people keep using 9GAG... it's the worst website in the history of everything!
-
9gag for the fucking win
-
None of that site is original.
-
I'm gonna shoot myself if people keep using 9GAG... it's the worst website in the history of everything!
yeah, funnyjunk FTW
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=r8R4p6t9250[/youtube]
brings back memories
-
respect his unlucky accurancy
(http://i1.kwejk.pl/site_media/obrazki/2012/02/48b82107d13325520320b3ede3dd2e49.gif?1330335319)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/b26e2205f4c524731957ae96f1ee8fcb.jpg?1330297262)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/4b810f7fc493f464c88b927531fff88f.gif?1330358006)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/7420ec2447c7a6abf290290701125d4c.jpg?1330355240)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/c91fc32210a7f63a30b58d1f4e3c8fe7.jpg?1330355129)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/06a76ab30fb43d85d9a0553c15ffe89a.jpg?1330354607)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/6d1fb82b55478e0cdf7b477137de5686.jpg?1330353941)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/3b8b5d33dde14d7d71b6cd762e8dbafd.jpg?1330352371)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/28f61f6280f582cc6fce64b6a214d790.jpg?1330351966)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/99afcaf38bfede981069ff6d24aec3ac.jpg?1330351094)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/3ad201f1ebe0eac6d8e4386ccd2c6dee.jpg?1330351067)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/831d0cff061d7a03f635a270aa98b5ec.jpg?1330350901)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/0f28c53fecabd6d7a3db06d7c0e32c30.gif?1330350717)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/a2d198deba2c4009d591048d209a83f4.gif?1330350700)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/dc43e7c289a7322f91bcf2b65b780565.jpg?1330350667)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/f851cac936b64e37f93acf3585611f4f.jpg?1330350150)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/f97ee89b92ecf174042c7bae975656ec.jpg?1330349893)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/4bff2aa52bd1edc0ff7187d50473f3db.jpg?1330341709)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/204b606de10a11126964a96806a718bb.jpg?1330304568)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/06a17c976a0c159551505061b8e7b542.gif?1330295318)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/e462ed274b02f5ac5e9f8e1831c60644.jpg?1330294241)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/02/48b82107d13325520320b3ede3dd2e49.gif?1330335319)
holy shit
-
^ :o
-
http://www.youtube.com/watch?feature=player_embedded&v=7n5zHxvKZF0
Description says that the man was an experienced driver and he was going to visit his kids. Died on scene.
-
I still don't understand why people think car crashes and people dying in them is fun
-
not very nice having to look at someone's sig and think of someone dying too :(
-
I still don't understand why people think car crashes and people dying in them is fun
Wait weren't you starting gore threads not too long ago? :P
-
(http://www.myinternetfinds.com/uploads/2011/09/Who-would-have-thunk-it.jpeg)
-
hahahahahaha
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=QZlv9Ekb9QA#![/youtube]
-
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-ash4/429272_251140701638072_150625068356303_545790_105410560_n.jpg)
-
(http://www.myinternetfinds.com/uploads/2011/09/Who-would-have-thunk-it.jpeg)
lmao.
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=QZlv9Ekb9QA#![/youtube]
owned. :L
-
I still don't understand why people think car crashes and people dying in them is fun
Wait weren't you starting gore threads not too long ago? :P
yes indeed I started a gore/death TOPIC I never posted a gore or death pic/video in a topic that is made for Funny Videos/Pictures wich is totally wrong in every single way ;)
-
what's defference
(http://i1216.photobucket.com/albums/dd363/Fresh95Prince/419176_368085133216406_100000447677405_1292074_1482076968_n.jpg)
-
the one in the right has wheels
-
The one on the left has hairs,the one on the right doesn't :L
-
Left boobies Right doesn't
-
left is hot, right isn't
-
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-ash4/427133_382508675095664_100000096030200_1558392_1789036297_n.jpg)
-
(http://www.chamsko.pl/demot/0_0_1417638998_Teletubis_przez_Psycholog_middle.jpg)
(http://www.chamsko.pl/demot/0_0_488079623_GTA_Racism_przez_Kebab512_middle.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/f12b444b67ba61a935fbd0b8415cf088.gif?1330360621)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/aa88dc063ae088ac74e724a3453d53c7.jpg?1330437686)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/5f6635e7f92ae0947f2ad9acc841ee4c.jpg?1330419845)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/1b39e1fe7e6b0b308b95468a8b02bfe0.gif?1330385891)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/4a5f7a2b8845847db23eb527d10b700d.jpg?1330429185)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/3aee8d0d3ddd9c2ed8f01dedfcd7d76f.jpg?1330375525)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/18fd525a848f8caac579930d272056e6.jpg?1330354760)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/625e21b09877591f4187c0fee831946d.jpg?1330449973)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/cbbd439c2be2859c4f0d676fda7e3d79.jpg?1330445788)
(http://i1.kwejk.pl/site_media/obrazki/2012/02/e3da098885cf25ba6f76c3b8814fc39a.gif?1330444502)
-
madmax & mooman = funniest pictures
-
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-ash4/427133_382508675095664_100000096030200_1558392_1789036297_n.jpg)
fake
-
That last one from Max, lmao wtf :L
-
(http://a6.sphotos.ak.fbcdn.net/hphotos-ak-ash4/427133_382508675095664_100000096030200_1558392_1789036297_n.jpg)
fake
of course it is fake, this is reality:
(http://cdn.vikitech.netdna-cdn.com/wp-content/uploads/2011/07/image8.png)
or this:
(http://funny-pictures-blog.com/wp-content/uploads/2011/08/firefox-vs-internet-explorer-vs-chrome-vs-safari.jpg)
-
hahahahahaha
^ sorry spam
-
hahahahahaha
^ sorry spam
lol
-
(http://s018.radikal.ru/i526/1202/6f/143563a17d93t.jpg) (http://radikal.ru/F/s018.radikal.ru/i526/1202/6f/143563a17d93.jpg.html)
Some say that he lives at oval. :L
-
lmao!!! :L
-
LOL, this is showing wrong totally
i live around 200 km away from there
anyway confirmed that shows wrong:
(http://i.imgur.com/dojfS.png)
-
hahahahha I live 16km from where it says, and apparently I live in someone's back garden:
(http://i.imgur.com/jHIUW.png)
-
I live where the arrow is.. :L about 1149 km's wrong :L
(http://i39.tinypic.com/17w9cg.png)
-
Around 35km away from me
and i live on the street says it :L
(http://i40.tinypic.com/2lig7xu.png)
-
apparently I live like 80Km away from where I actually live in some mountain lol
-
it says i live in the west while i live in the east.
-
It says I live in Reykjavík but I live in the middle of nowhere :L
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=g2lQJiB4Bws[/youtube]
-
lol :L
-
hahahahaha :PpPpP
-
hahahahaha :PpPpP
stop spamming :D
-
i ban your ass
-
im already banned :L
-
i unban your ass
-
[youtube]http://www.youtube.com/watch?v=flSKBYCOgKU[/youtube]
this old show :L
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/3086914_700b.jpg)
-
:L
-
Epic :L but the name shud' be changed to Meme Andreas :D
-
MTA
-
lol pic
-
[youtube]http://www.youtube.com/watch?v=3cWUa9kT4QA&feature=related[/youtube]
-
(http://i.imgur.com/d0y4R.jpg)
-
(http://i.imgur.com/pzOc6.jpg)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/03/073130034fb82cffd6bafe150f271695.gif?1330642656)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/03cb814ed7ac2e14db700d0bb595bbd4.jpg?1330638811)
-
lol mj
-
(http://i1.kwejk.pl/site_media/obrazki/2012/03/58ccd178a1c24b79a96490dfba16c0c4.jpg?1330772565)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/efc36b24a0e01e94a8ad6977f8dfe517.jpg?1330764248)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/be8e9f5a946bce3c841226aaf2025ee4.png?1330784689)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/e5ab0d9bc74c3ec1d7434ffebb795a2a.gif?1330781884)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/4c21193917c6e6c05532ebda2f780c5c.jpg?1330772553)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/d10bbc178d4524f05b1e35c9ccacb20b.jpeg?1330736929)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/12ed7392a0378ebaab5a5a9117cd3ba2.gif?1330737048)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/4495da4faed44456899f89c167851495.jpeg?1330762811)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/1190d8db81fef7cc66d626a80585f104.gif?1330764823)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/d589154556f1968b993e38886bf6ff2b.jpg?1330712587)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/468110d41527cc23d0abff25ca7ca843.jpeg?1330697970)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/ccbb70e7ce9a28cf7e6828dde57c4cf2.jpg?1330818959)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/d0b28b2ac27d1e3e3a23d1221f75f413.jpg?1330814232)
-
Madmax won 1st award for posting funniest pictures
-
(http://i1.kwejk.pl/site_media/obrazki/2012/03/12ed7392a0378ebaab5a5a9117cd3ba2.gif?1330737048)
from what is this
-
from remake of 'Last House on the Left'
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/3126944_460s.jpg)
(http://d24w6bsrhbeh9d.cloudfront.net/photo/3126852_460s.jpg)
-
^I don't get the second set of pics :L
-
lol Sweden
-
The little house on the left, I think.
-
[youtube]http://www.youtube.com/watch?v=gfAGzUIkyDU[/youtube]
-
haha nice
-
[youtube]http://www.youtube.com/watch?feature=v=QYjaSLmwBP4[/youtube] total ownage :L :L
-
sssshhhhhiiiiiitttt did that GK commit suicide that same day?
-
omg what a shitty team ...
even Albania is better :L
-
(http://img16.imageshack.us/img16/1570/gdfgdfgs.png)
XDDDDDDDDD
-
haha
-
another load:
(http://i1.kwejk.pl/site_media/obrazki/2012/03/8228c9042d463099e718fc210addc026.jpg?1330954803)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/9b5f1faf54b7f8c7aa7990833aee167d.png?1330952151)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/09772b88b4a92c10459cb652a9fee639.gif?1330983991)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/be29acbb4bb5e3fe26c35d9943e7baa6.jpg?1330983237)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/e5ff021fd38bdb278bf934273d57d38f.png?1330983015)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/2fad7b3cb44c90fd181ee87657b849d3.gif?1330982230)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/a310b7483fc18f93dbc1d433e4c05995.jpg?1330960782)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/821c1d3344ee9c161d4ecc889405087f.jpg?1330981885)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/5e267b71a65b219bbcf716e711cc36bc.jpg?1330980795)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/ed68890acae898d1f4a70390d469094b.jpg?1330978339)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/c8b5113a8e7eb3214565923d8dfd845e.jpg?1330977067)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/8bdc99d2867a5c7c7f55b5fe45f5d602.jpg?1330985736)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/9f9a7e76acc3f2de3d8928770a5dc21f.jpg?1330984759)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/9c4e05cef83ca94c528d98f61ef8ad4e.jpg?1330984331)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/e6d1c15bc119ea86461782dbc01e0915.jpg?1330980114)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/ab13a00971e545093378c612bad98fc4.jpg?1330979517)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/ace671bde0ff7ae71e6adc49b3e6a21a.gif?1330875841)
-
another day, another fun:
[youtube]http://www.youtube.com/watch?v=t4_dZPVg8KI[/youtube]
(http://i1.kwejk.pl/site_media/obrazki/2012/03/b76afff5de61f7b6aaed3a322ee65465.jpg?1331042545)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/aa4d9feb6c9c6f945a90baa5b8839cff.jpg?1331050842)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/756e906083715b5121c31c1689f7c193.jpg?1331026480)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/aa8baedf25bc825089be16fd8a6fae89.jpg?1331053825)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/6c4b46f3b7a28607495e25336df7b335.jpg?1331052726)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/3b9e8b4c27e7eceb2eb3b61a6ac373fe.jpg?1331052518)
remember the singing shark?
(http://i1.kwejk.pl/site_media/obrazki/2012/03/f0308d8ecb8e46623b5165ed27ed3ee9.gif?1331053224)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=8iEoyse-3Ow[/youtube]
pro
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=8iEoyse-3Ow[/youtube]
^
$$$$$$$$$$$
-
hahaha it just could be from ARGENTINA O0
-
(http://i1.kwejk.pl/site_media/obrazki/2012/03/f0308d8ecb8e46623b5165ed27ed3ee9.gif?1331053224)
epic :L :L
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=8iEoyse-3Ow[/youtube]
pro
That's my team :L (EST)
-
that explains everything :D
-
Mine is the one that recieved the goal, not the guy who did it xD
-
lol , trezeguet plays for estudiantes ? or not ...
-
nope, in River Plate
-
[youtube]ZIGzpi9lCck[/youtube]
-
i kept seeing that video on my recommendations but and i never watched it lol
-
[youtube]http://www.youtube.com/watch?v=-oB6DN5dYWo&feature=player_embedded[/youtube]
dont mess with security ^^ :L :L
-
[youtube]ZIGzpi9lCck[/youtube]
i don`t see it funny but fascinating
-
[youtube]ZIGzpi9lCck[/youtube]
i don`t see it funny but fascinating
-
LOL !
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=G2cK2D2Iams#[/youtube]
-
Dusan Kecman!!
watched that game live on tv. just epic O0
-
pr0 parking
(http://i1.kwejk.pl/site_media/obrazki/2012/03/3101716597c4261f29940f2c92d32690.gif?1331299012)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/6d794e40513320ecb9095ed8fd8c34dd.jpg?1331128898)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/5b75fb4881ba52dea33b765f0800f325.png?1331244612)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/fd85045b0d4a1293fe18e51c181f3302.jpg?1331241215)
-
"The great Cola escape"
(http://i.imgur.com/NXYi6.gif)
-
[youtube]http://www.youtube.com/watch?v=TWfph3iNC-k[/youtube]
[youtube]http://www.youtube.com/watch?v=xmlAW_1hgT8&NR=1&feature=endscreen[/youtube]
[youtube]http://www.youtube.com/watch?v=sFk6hxHIR0Q&feature=share[/youtube]
"Corliss, one of the best BASE jumpers in the world, was being filmed by HBO when the accident happened. Jeb reportedly leaped safely from Table Mountain when he was either blown off course by a gust of wind, or got too close to the mountain.
It was his second jump from the Cape Town landmark. After the first one, he posted this picture on his Facebook wall, with a caption: "How low can you go :) Table mountain day two :)"
A Table Mountain spokesperson said Corliss was lucky to be alive after he fell more than 200 feet before hitting the rocks. He managed to release his emergency chute, otherwise he'd be dead.
He was recovered by air ambulance and taken to a private hospital, where he was admitted to intensive care. A spokesman for the hospital said that he remained in good spirits, and instructed her to tell well-wishers: "I feel the best I ever have."
This video, shot from a distant angle, shows what happened. Corliss is wearing a black suit, cameraman Jeff Nebelkopf is in blue"
-
[youtube]http://www.youtube.com/watch?v=sFk6hxHIR0Q&feature=share[/youtube]
horrible
-
1st vid 1.15 => 1.45 !! 8)
-
best ending ever !:
[youtube]http://www.youtube.com/watch?v=YBeguUvuDzs[/youtube]
vvvvEPICvvvvv
[youtube]http://www.youtube.com/watch?v=4d6Ak7K34f4&feature=related[/youtube]
-
[youtube]VudJpH-ytH4[/youtube]
-
today very poor, but still:
(http://www.chamsko.pl/demot/0_0_1926635845_Kony_2012_przez_BelieverNot_middle.jpg)
(http://www.chamsko.pl/demot/0_0_1638699265_oesu_przez_jakdroid_middle.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/7f26aca379ea05f9d5e74b335f78daee.gif?1331384822)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/0f02400946a19845e875abd20311f7cb.gif?1331436591)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/f298bb1db48f3b86fb849e105262cea6.jpg?1331434417)
-
[youtube]http://www.youtube.com/watch?v=SQV1Sk7C6Ms[/youtube]
(http://yampotw.files.wordpress.com/2008/08/clap-copy_011.jpg)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/03/76ca97f8579f9b935faf1265dedcd60d.jpeg?1331491417)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/5293975bc7b280a7f288ed34744f1422.jpg?1331464981)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/9af3d7f9797aef65aa3fa16027915224.jpg?1331468588)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/3a604099ea19cb78cb27e18e83024051.gif?1331465703)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/2f0a4a63f44c91e70de4be61fa328f4d.gif?1331465816)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/d502b69498bf72c92c233e4b1a61199f.jpg?1331465044)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/d650384c9eab99713fa771bac511f682.jpg?1331499896)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/aadb2445295d75e411e0426995a3cb8e.jpg?1331499318)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/0f0e1c91c6bc598532dc5b8cebac03ef.jpg?1331498391)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/dc4a8338d63d289a4c6aeb8f93ca9307.gif?1331497559)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/8e54d4859c995f0d5e5df5bfd6202c0f.jpg?1331497645)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/15e080296f6a35c3efc798ecf1aeb5e8.png?1331496701)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/1ee09db222a960b127e1ffc9e9dad0da.jpg?1331495480)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/d35d02daaa37366b287e817da6061264.jpg?1331493879)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/84b727ba6d860e64802fcd9d200ce6ea.jpg?1331491793)
gta reality:
(http://i1.kwejk.pl/site_media/obrazki/2012/03/e00bf734321f66db4d909c0ac29b619b.jpg?1331462233)
-
hahahaha nice! :L
found some
(http://slike.milf-hosting.info/images/1331135582.jpg)
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-ash4/428597_402968829716768_100000109641675_1660671_1899637449_n.jpg)
(http://www.meh.ro/wp-content/uploads/2012/02/meh.ro9398-455x636.jpg)
(http://30.media.tumblr.com/tumblr_lxvp04pXFI1qdlh1io1_250.gif)
(http://i.imgur.com/6j7Rf.gif)
(http://www.funny-pictures-blog.com/wp-content/uploads/2011/11/Funny-GIF-MR-Bean1.gif)
(http://1.bp.blogspot.com/-6T6H2lV-IzE/TzgbMstkJwI/AAAAAAAAbI4/DiSNhf-juXk/s1600/0FGwhatyoulookinatmom.gif)
(http://i718.photobucket.com/albums/ww181/Cleb360/FergieBus-1.gif)
(http://i.minus.com/ibatbgylXVkS7l.gif)
-
hahah last one is epic
-
(http://coats-wholesale.com/wp-content/uploads/2011/12/square-bike.jpg)
-
seems like the staff/users of kwejk.pl visit 9gag quite often
-
That bike would work if it had a freecoaster
-
(http://i1.kwejk.pl/site_media/obrazki/2012/03/0a67270718280bd14c5ea81951530cf9.gif?1331290051)
-
lmao
-
seen this guy lots of times on my bus :L
[youtube]http://www.youtube.com/watch?v=g5OOANeYIHw&feature=related[/youtube]
-
your dad?
and you talking? :L
-
lol no :(
-
do dat jumpin ting agen mon
-
is he drunk or just retarded?
-
the old guy is drunk. the kid talking is retarded.
-
:L
-
(http://www.yapfiles.ru/files/305966/01.gif)
does anyone know what movie is this? :L
-
^hm no,,
(http://i1.kwejk.pl/site_media/obrazki/2012/03/0a67270718280bd14c5ea81951530cf9.gif?1331290051)
lmao.
-
LOOOOOOOOOOOOOOOOOOOL
[youtube]http://www.youtube.com/watch?v=_xRI4gamaco[/youtube]
-
(http://www.yapfiles.ru/files/305966/01.gif)
does anyone know what movie is this? :L
its an indian film, dont remmeber name
-
LOOOOOOOOOOOOOOOOOOOL
[youtube]http://www.youtube.com/watch?v=_xRI4gamaco[/youtube]
woooooooooooooooooow
-
3:22 hahahahaa
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/3300587_460s.jpg)
-
lmao
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/3300587_460s.jpg)
Just look at the watermark, I swear 9GAG is run by a group of twelve year olds?
-
People insert stuff from other sites like reddit.com there and 9gag put a watermark on it.
-
Just look at the watermark, I swear 9GAG is run by a group of twelve year olds?
(http://i445.photobucket.com/albums/qq176/i_am_snow/you-seem-upset-47621936553.png)
-
(http://www.yapfiles.ru/files/305966/01.gif)
does anyone know what movie is this? :L
that movie is called "Singham" :L
this one is also hilarious lol
[youtube]http://www.youtube.com/watch?v=_Z3j3IIMCYs[/youtube]
-
People insert stuff from other sites like reddit.com there and 9gag put a watermark on it.
Which is what I hate about that site. They have an "original content only" rule, and people seem to think that adding a watermark makes it fit the criteria.
seems like the staff/users of kwejk.pl visit 9gag quite often
Also if you're referring to the fact that a lot of pictures are on both sites, it's most likely stolen by 9GAG, not the other way round...
-
Was Jeremy Clarkson the director of the movie?
-
[youtube]wvN6FT4npKk[/youtube]
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/3351646_460s.jpg)
-
(http://www.yapfiles.ru/files/305966/01.gif)
does anyone know what movie is this? :L
that movie is called "Singham" :L
this one is also hilarious lol
[youtube]http://www.youtube.com/watch?v=_Z3j3IIMCYs[/youtube]
thanks :D
check this
[youtube]http://www.youtube.com/watch?v=_K9AxO5t4BE
[/youtube]
-
and this [youtube]http://www.youtube.com/watch?v=-E6q-m1tLn8[/youtube]
-
what ?
[youtube]http://www.youtube.com/watch?v=3Yc0OESVEQI[/youtube]
-
Just look at the watermark, I swear 9GAG is run by a group of twelve year olds?
(http://i445.photobucket.com/albums/qq176/i_am_snow/you-seem-upset-47621936553.png)
Nope, I just have some knowledge of internet culture and am older than six. Also, clear your cache and try looking at the pic again. GG!
-
People insert stuff from other sites like reddit.com there and 9gag put a watermark on it.
Which is what I hate about that site. They have an "original content only" rule, and people seem to think that adding a watermark makes it fit the criteria.
seems like the staff/users of kwejk.pl visit 9gag quite often
Also if you're referring to the fact that a lot of pictures are on both sites, it's most likely stolen by 9GAG, not the other way round...
watermarks are not added by people, they automatically appear in the direct link of the image after being on 9gag
-
People insert stuff from other sites like reddit.com there and 9gag put a watermark on it.
Which is what I hate about that site. They have an "original content only" rule, and people seem to think that adding a watermark makes it fit the criteria.
seems like the staff/users of kwejk.pl visit 9gag quite often
Also if you're referring to the fact that a lot of pictures are on both sites, it's most likely stolen by 9GAG, not the other way round...
watermarks are not added by people, they automatically appear in the direct link of the image after being on 9gag
Yeah but I've seen 9FAGs actually editing watermarks into the pics, and I've also seen people uploading pics to 9GAG before sharing them just to get the watermarks...
-
downloaded : rage maker on my phone on android.
just tried to make one :
(http://img687.imageshack.us/img687/6546/beachepicpooh.jpg)
-
haha lol nice one boots :L
-
(http://i.imgur.com/caAzF.png)
-
[youtube]jpZw_Vj_RAQ[/youtube]
-
(http://i1.kwejk.pl/site_media/obrazki/2012/03/a524797d0fc02f3876e5ba3073e49ec5.gif?1331840896)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/8b6a6b9b334f08fdf341b3376d7eaa73.jpg?1331897626)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/85507bf24b1ff06fafdc494cb8b98be7.gif?1331847570)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/387e2e5ea9dd82d79d87c0037feb2209.jpg?1331645987)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/82be3ef59068d7aec5b4ab50745e6510.jpg?1331561017)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/a5cc73426ff808d2872e75bd8c2f6e33.jpg?1331895705)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/9bbb8cfd59894c927ade3f7c91403284.gif?1331899806)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/d0db301fb8aa54cf0c16c4ec673da956.gif?1331762214)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/10cfc4b764285b5b7fcdafe5d1111e9a.jpg?1331733602)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/1be5002f2657d9206b41049dcc7a2f5e.jpg?1331728723)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/819a42e381c7f722c70d9c1f47f32385.jpg?1331581235)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)(http://i1.kwejk.pl/site_media/obrazki/2012/03/b85949bf35e9c5b7b1abd87571519f48.gif?1331658060)
-
AIGHT PEOPLE GET POSTIN
-
i thought max posted so many images then i noticed this spam
-
[youtube]http://www.youtube.com/watch?v=jlSF0dtDRD8&context=C41b9210ADvjVQa1PpcFOmWq2AVXpBK0n70uzK4WO-5mLog8hvvSE=[/youtube]
-
(http://)http://images.uncyc.org/pt/6/6d/Worldwar2RTS.gif
:L :L :L
http://images.uncyc.org/pt/1/1e/Bin.gif
^ Fatality
-
(http://i.imgur.com/HTgX5.jpg)
-
(http://i3.kym-cdn.com/entries/icons/original/000/006/216/7nTnr.png)
-
(http://i44.tinypic.com/2z557if.jpg)
My city! lol
-
You can watch the whole vid or skip to 0:30 where the lol is :laugh:
[youtube]http://www.youtube.com/watch?v=L09M8TSRzgU[/youtube]
-
[youtube]8edwWVSHsrY[/youtube]
-
[youtube]8edwWVSHsrY[/youtube]
http://erif.org/code/Hell/
-
[youtube]_KzPwtl8mZs[/youtube]
-
lmao
-
ROFL!Portal+Mario+Co-op=Mario in the Portal Co-op FTW!
-
ever wondered what was the correct way to pronounce certain car names?
here they explain how! :L
[youtube]http://www.youtube.com/watch?v=NaFAhEf7oF8[/youtube]
btw its not moor-che-lAÁÀgo or whatever.... its moor-see-É-lago
-
[youtube]http://www.youtube.com/watch?v=0k3_tV7vYVQ[/youtube]
-
Pino!
-
Pino!
-
Aivo!
-
(http://www.chamsko.pl/demot/0_0_1917295067_Sieg_fail_przez_Patuska_middle.jpg)
(http://vader.joemonster.org/upload/qsb/765554865c5d2b01.jpg)
(http://vader.joemonster.org/upload/qsb/7655569c07951503.jpg)
(http://vader.joemonster.org/upload/qsb/765558a57be0ca05.jpg)
(http://vader.joemonster.org/upload/qsb/7655592997081206.jpg)
(http://vader.joemonster.org/upload/qsb/7655607bf7d9f207.jpg)
(http://vader.joemonster.org/upload/qsb/7655615b8b8e1b08.jpg)
(http://vader.joemonster.org/upload/qsb/76556257f8a75209.jpg)
(http://vader.joemonster.org/upload/qsb/765563b2687b3210.jpg)
-
what the fuck is this lol :L :L
[youtube]http://www.youtube.com/watch?v=RXiJcFVds0E[/youtube]
oh and nice pictures, max :L
-
valentin and bettina?
-
(http://i.imgur.com/kf4UN.jpg)
-
i ve heard about this before. so impossible lol
-
(http://i.imgur.com/4erlv.png)
-
(http://a4.sphotos.ak.fbcdn.net/hphotos-ak-ash3/539308_10150631130489053_769879052_9185928_1027465253_n.jpg)
(http://img96.imageshack.us/img96/6651/cartefranceville.gif) | (http://www.elysee.fr/president/root/bank/images_elysee_contenu/Sarkozy_23.JPG) | (http://media.rtl.fr/online/image/2012/0305/7744914507_claude-gueant-ministre-de-l-interieur-de-l-outre-mer-des-collectivites-territoriales-et-de-l-immigration-l-islam-n-est-pas-du-tout-une-obsession.jpg) |
omg lol ^^ sarko (president) gueant (minister of interior)
too lose ^^
i m wondering if its real or a fake (it wouldnt surpise me if it s real )
-
toololz
-
why mooman??? why???
(http://www.mathematik.com/Dreieck/animation.gif)
-
Because the longer triangle when it's moved on top, stretches out the 2 irregular components that are below it more than the small one does when that's on top, therefore there is a block of space left? The area of actual space that all the components actually take up is still the same, it's just spaced out more. Looking at it for quite a while now and that's what I've come up with :L
-
because they are not the same, the one with missing square is not even a triangle its a quadrilateral figure....
-
(http://i.imgur.com/WQlQ6.png)
(http://i.imgur.com/yjyd6.png)
(http://i.imgur.com/sZXKL.png)
-
someone had to do it :L
-
why mooman??? why???
(http://www.mathematik.com/Dreieck/animation.gif)
so easy, took me 20sec to figure :P
look at [8;5], the angles are not the same.
-
[youtube]http://www.youtube.com/watch?v=i4G8Wo6UCx4[/youtube]
Assassins Creed , Indian Version :D
-
(http://i.imgur.com/3cn6z.png)
-
ROYAL LOVES ALL
http://www.facebook.com/photo.php?v=166449933456778
-
(http://i.imgur.com/3cn6z.png)
fast
-
(http://i1.kwejk.pl/site_media/obrazki/2012/03/fc94e323afb447376069edd517d3119e.gif?1332500108)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/60d58e9d4fe5d187f447563fe6a5e389.gif?1332501485)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/3fe35ed95ce2a9785364f1d9a0063428.jpg?1332453538)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/a74f0f2ba53f382733ecf6ca9394a9cb.jpg?1332510610)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/3c3c6237bfc86c91921f253600e543a4.jpg?1332500592)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/27e234e9705cfd60f7052e881d48cf37.gif?1332497105)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/fd42d44a9efbc2d05f7239ba525dad27.jpg?1332455446)
(http://i1.kwejk.pl/site_media/obrazki/2012/03/9a7c8382d27de4db83a7a3cb2422267e.jpg?1332445464)
anyone not as lazy as me to check is this true: ?
(http://i1.kwejk.pl/site_media/obrazki/2012/03/a09022192b2e80f3f1349193a87de2fa.jpeg?1332444299)
-
only works for a few:
(http://i.imgur.com/OlzNt.png)
i forgot to highlight some like 54-59
-
(http://www.demotivation.us/media/demotivators/demotivation.us_Anti-cheat-device_133243889375.jpg)
-
(http://images2.wikia.nocookie.net/__cb20120210165206/himym/images/3/3f/True-story-neil-patrick-harris.png)
Found this on The Walking Dead wiki lol.... :L
(http://images3.wikia.nocookie.net/__cb20120323023042/walkingdead/images/9/99/Farewell_to_Walking_Dead.jpg)
-
lmfao r
(http://i.imgur.com/Eg1Nj.png)
-
grandmaster's arrogance right there lol
-
(http://www.gran-angular.net/wp-content/img_gran_angular_net2/2011/02/af1.gif)
(http://www.gran-angular.net/wp-content/img_gran_angular_net2/2011/02/af2.gif)
(http://www.gran-angular.net/wp-content/img_gran_angular_net2/2011/02/af3.gif)
(http://www.gran-angular.net/wp-content/img_gran_angular_net2/2011/02/af4.gif)
(http://www.gran-angular.net/wp-content/img_gran_angular_net2/2011/02/af5.gif)
(http://www.gran-angular.net/wp-content/img_gran_angular_net2/2011/02/af6.gif)
(http://k15.kn3.net/55A120F78.gif)
-
(http://a2.sphotos.ak.fbcdn.net/hphotos-ak-ash3/526571_282707011804251_105651509509803_672693_1909165187_n.jpg)
-
(http://i.imgur.com/FM95d.jpg)
-
[youtube]http://www.youtube.com/watch?v=FO8MyXDYHqk[/youtube]
-
lmaoooooooo :L
-
1 hour of fails ftw
[youtube]http://www.youtube.com/watch?v=nAVp_pGjNy8&feature=related[/youtube]
-
(http://i.imgur.com/1YmTU.png)
-
[youtube]http://www.youtube.com/watch?v=AijEQN6AuRs[/youtube]
[youtube]http://www.youtube.com/watch?v=OWgO9-AIROI[/youtube]
-
haha the second one :L
-
lol @ second
-
(http://i.imgur.com/nYWWI.jpg)
-
I use to love this song as a kid :L :L :L :L
[youtube]http://www.youtube.com/watch?v=FCARADb9asE[/youtube]
-
(http://i.imgur.com/nYWWI.jpg)
strange how the blood ends up on the rearwindow lol
-
even more strange things
whats on rear of this charger? is it a rack ? (if you look closer)
and i guess there were at least 2 ppl in charger, coz driver wouldn't have that long arm lol
-
ahahahahahahahaha
-
lol
-
lmao max :L
-
whats on rear of this charger? is it a rack ? (if you look closer)
looks like a bottom of engine to me
-
no i mean this:
(http://i.imgur.com/KbfAL.jpg)
-
a bad spoiler without friction increase effect
-
looks more like this kind of rack:
(http://www.web-cars.com/images/vette_img/DSC_7574_a.jpg)
-
looks more like this kind of rack:
(http://www.web-cars.com/images/vette_img/DSC_7574_a.jpg)
Let's make a barbecue
-
[youtube]PjgSdc7Qe5Q[/youtube]
-
omg that's fucking epic
-
was waiting about 3-4 hours then this happened :-\
(http://i.imgur.com/i91fG.png)
http://www.youtube.com/watch?v=F1OByd1zlUI
-
omg I hate it when you wait for something and it totally fucks up D:
-
[youtube]http://www.youtube.com/watch?v=rxK3XlH3NhE[/youtube]
-
Thiev... Our server player ZBIGIS
Watch by 36:30
[youtube]http://www.youtube.com/watch?v=U1hV12L-Cwk&feature=uploademail[/youtube]
It's lithuanian tbh :/
-
(http://www.shy22.com/upfiles/Kb610098.jpg)
(http://i1216.photobucket.com/albums/dd363/Fresh95Prince/11241275018.jpg)
-
http://img9.xooimage.com/files/4/e/a/k-285fdf5.swf
-
Lol wtf?
(http://i43.tinypic.com/25p1zc8.png)
-
same
-
http://img9.xooimage.com/files/4/e/a/k-285fdf5.swf
OMGGGG WHY YOU KEEEP DOING THAAAT ?? :'(
-
http://img9.xooimage.com/files/4/e/a/k-285fdf5.swf
OMGGGG WHY YOU KEEEP DOING THAAAT ?? :'(
Hahah :L
-
by now i see that link without opening it just like with rick roll.
-
by now i see that link without opening it just like with rick roll.
;)
(http://i.imgur.com/AebEW.png)
-
http://img9.xooimage.com/files/4/e/a/k-285fdf5.swf
OMGGGG WHY YOU KEEEP DOING THAAAT ?? :'(
Just reconize the link :P It ends with .SWF
Edit:
I found this on 9gag... About Iceland
(http://i.imgur.com/z8P04.jpg)
All of those pics are from Iceland :L
-
You only have 1 woman on the island? :L
-
lol
-
They forgot a picture with trees Krissi :L Remember when I thought Iceland had no trees at all? :L
-
(http://i.imgur.com/N23RP.jpg)
(http://i.imgur.com/Cw93k.jpg)
Trees :D
-
lol these are not trees :L
-
(http://a8.sphotos.ak.fbcdn.net/hphotos-ak-ash3/525522_324320294298631_323773577686636_933161_980746541_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=OWgO9-AIROI&feature=player_embedded#![/youtube]
-
ehmm
[youtube]http://www.youtube.com/watch?v=OWgO9-AIROI[/youtube]
-
real commercial in Japan...
[youtube]lDUOmY80GhU[/youtube]
-
***NSFW***
http://i.imgur.com/BZ2HE.jpg
nikki's mum and tom's goat
-
LOL
-
lmao
-
***NSFW***
http://i.imgur.com/BZ2HE.jpg
nikki's mum and tom's goat
not funny at all dude, would you like someone to say something like that about your mom?
-
***NSFW***
http://i.imgur.com/BZ2HE.jpg
nikki's mum and tom's goat
you're taking it too far dude
-
lmfao. trying to lighten up the mood you bunch of boring fucks
it's called a JOKE
-
I found it funny because of how relevant it was :L
It's porn but fuck it, it had the NSFW label
-
would you like someone to say something like that about your mom?
lol you don't know me at all. i wouldn't give a shit :L
-
Your mum wouldn't give a shit if I fucked her :P
-
I found it funny because of how relevant it was :L
you find everything funny.......
-
Stop defending people just becouse they are your friends in real life, this is pushing it too much, isn't funny at all
-
because people have sense of humours lol.
it was just a joke i was making towards nikki and tom lol because of that thread
-
well you're taking "sense of humour" to a whole other level
-
I found it funny because of how relevant it was :L
It's porn but fuck it, it had the NSFW label
you're called a JOKE
you took it too far this time, admit it.
-
Stop defending people just becouse they are your friends in real life, this is pushing it too much, isn't funny at all
I'm not, I found it genuinely funny :L
also, andy's my friend in real life?
-
also, andy's my friend in real life?
brothers from another mother
-
You should take distance of these provocations as you're having admin status @ JOE.
-
speak for yourself ^ lol
-
I took distance of your idiotic joke above.
-
You should take distance of these provocations as you're having admin status @ JOE.
I wasn't actually trying to be provocative at all, I explained why I found it funny to clear that.
-
yet you are replying lol nice distance
-
You misunderstand me Snoopy, but I am used to that from your side.
-
there's nothing to misunderstand about somebody who likes to threaten to ban people for no reason then actually goes and does it @ Ush
-
Is that the description of you when you had admin status? it fits well. @ snoppy
-
yeah but i can and have admitted it lots of times ;)
the difference between me and you is that i can admit my mistakes and say i abused my power. you can't :)
-
because I didn't abuse it. :) it's just a thing that clogged up in your mind
[youtube]http://www.youtube.com/watch?v=6zXDo4dL7SU[/youtube]
-
lol if i quote everything you've said and done over the course of when this war between me and you when it started i would be here all night making you look hypocritical and stupid
but you proved my point. you do something wrong and you can't face it like a man.
-
The war you started :L
(http://alexplorer.net/guitar/text/guitar/porkins.jpg)
-
yep! i could have handled it better but i was just pissed because you were deleting my posts before telling me to stop
-
I didnt like that joke.
-
(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)(http://cache.blippitt.com/wp-content/uploads/2011/03/Popcorn-02-Stephen-Colbert.gif)
-
cake enjoy your madness :L :L :L
-
Was it worth looking up beastiality for a cheap gag?
inb4 :ppPPpPP
-
yep it was :)
-
(http://i.imgur.com/xOfBM.png)
-
haha mooman :L
-
:P :P :P :P :P :P :P :P :P :P :P :P
-
yep! i could have handled it better but i was just pissed because you were deleting my posts before telling me to stop
I tried to prevent you from your own stupid actions but in the end it didn't help it even made you mad.
-
you shouldn't delete people's posts just because you can. you should be a man not a girl and tell people to stop first instead of being sneaky about it
anyway why don't you be a "good admin" like you claimed you were and ban dabar from the forum already?
you are the worst admin ever tbh. if you're going to do something then do it right.
some things you should learn:
1: learn the meaning of the word hypocrite
2: learn the meaning of the word contradictions
3: learn the difference between good and bad because you ban people for no reason and you don't ban people who break the rules (dabar on here)
4: learn to be calm when you run out of weed
5: learn to stop ass kissing mooman and other guys when you know you've done something wrong
6: leave me alone as you requested we should do on the server, clearly you can't stick to that!
7: stop provoking me just so you have a reason to ban me
that is all for now
-
you shouldn't delete people's posts just because you can. you should be a man not a girl and tell people to stop first instead of being sneaky about it
anyway why don't you be a "good admin" like you claimed you were and ban dabar from the forum already?
you are the worst admin ever tbh. if you're going to do something then do it right.
some things you should learn:
1: learn the meaning of the word hypocrite
2: learn the meaning of the word contradictions
3: learn the difference between good and bad because you ban people for no reason and you don't ban people who break the rules (dabar on here)
4: learn to be calm when you run out of weed
5: learn to stop ass kissing mooman and other guys when you know you've done something wrong
6: leave me alone as you requested we should do on the server, clearly you can't stick to that!
7: stop provoking me just so you have a reason to ban me
that is all for now
here i will help you guys to work down that list! use this wisely!!!!
✔
[color=green][size=50pt]✔[/size][/color]
-
i don't need to learn anything from that list
i make sure i don't contradict or be a hypocrite in all of my responses to ush
if you can find something where i may have then show me. but ush does it in every single post of his
i have no problem being friendly with ush at all. it's always him in the end that starts something off
and fastcake can you post something relevant? you always reply with something spammy and useless. at least say your opinion or something
-
would you like someone to say something like that about your mom?
lol you don't know me at all. i wouldn't give a shit :L
same here
-
[youtube]http://www.youtube.com/watch?v=24FS-I67EPY&feature=player_embedded[/youtube]
LOOOOOOOOOOOOOOOOOOOOOOOOOOOL
-
http://www.youtube.com/watch?v=24FS-I67EPY&feature=player_embedded
LOOOOOOOOOOOOOOOOOOOOOOOOOOOL
It's such a tricky question :L ofc it's 'A' , but in C it was A , damn!I'm getting soooo confused!I bet that guy was more confused than me :o
-
hahahahaha
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=FvANmxeiA5Y#![/youtube]
He is epic lol
-
drogba had right to be mad there tho :P
-
(http://cdn.memegenerator.net/instances/400x/17861683.jpg)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/04/c1b12a49590432c56ddb05556e753dc2.jpg?1333570199)
(http://i1.kwejk.pl/site_media/obrazki/2012/04/a9711e4586a9ce659e6a389aa40ea387.jpeg?1333559204)
(http://i1.kwejk.pl/site_media/obrazki/2012/04/1753ba296e75fe12ea02b203d257ec44.gif?1333460323)
(http://i1.kwejk.pl/site_media/obrazki/2012/04/7d36bbd1f35d13160480e63720f98715.jpg?1333526937)
(http://i1.kwejk.pl/site_media/obrazki/2012/04/a4d658669b163214bfac31869a423dbd.jpg?1333399681)
-
[youtube]AGbo50Ar420[/youtube]
-
Good news about the consoles is that both sony and xbox next gen consoles will have AMD cpu's and gpu's ( PS4 will have brand new crossfire design tho ), meaning same architecture as PC meaning hopefully the end of terrible ports like GTA IV, L.A. Noire etc. Their hardware will be terribly outdated by time they release tho ( like 2 years to go ).
-
[youtube]http://www.youtube.com/watch?v=FEWrpSzogOo&feature=related[/youtube]
-
Good news about the consoles is that both sony and xbox next gen consoles will have AMD cpu's and gpu's ( PS4 will have brand new crossfire design tho ), meaning same architecture as PC meaning hopefully the end of terrible ports like GTA IV, L.A. Noire etc. Their hardware will be terribly outdated by time they release tho ( like 2 years to go ).
The hardware of consoles is always tremendously outdated..
-
[youtube]http://www.youtube.com/watch?v=FEWrpSzogOo&feature=related[/youtube]
haha, that made me laugh a lot :L
-
Part 2 is nice too
[youtube]http://www.youtube.com/watch?v=xEzeybl3kTY[/youtube]
-
(http://25.media.tumblr.com/tumblr_m109foLfap1qkvbwso1_500.png)
-
Was it you, fc? :L
-
who knows
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=fPmV1NNX7TM[/youtube]
-
:L :L
-
LOL the BEST FRIENDS ZONE is very dangerous.. never enter there
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_01.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_02.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_03.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_04.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_05.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_06.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_h260e_640_high_26.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_high_09.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_10.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_11.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_12.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_13.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_14.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_16.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_18.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_19.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_21.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_22.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_23.jpg)
(http://img.izismile.com/img/img5/20120409/640/guys_doomed_to_the_friend_zone_640_high_24.jpg)
-
LOOL :L
-
reminds me of [2f2f]dodger most certainly
-
reminds me of [2f2f]dodger most certainly
:L
I really lol'd at the 3rd one
-
hover hands ftw :L
-
^ :L :L
-
(http://upload.slike.com/slike/p9QYF.gif)
Scarlett Johansson
(http://www.zaslike.com/files/9c561l3jl7fxq5u17j.jpg)
(http://www.zaslike.com/files/im2e1t5qlm4ycoebyn5.jpg)
(http://www.zaslike.com/files/mhnsabb8tebz3n9zag42.jpg) :L :L ;_;
-
(http://i.imgur.com/T4PfT.jpg)
(http://i.imgur.com/hVNN1.jpg)
(http://i.imgur.com/nrRE5.jpg)
(http://i.imgur.com/z6Ity.jpg)
(http://i.imgur.com/5nL46.jpg)
(http://i.imgur.com/dxzoF.jpg)
-
(http://media.tumblr.com/tumblr_m29rtfglXB1qlkly8.gif)
(http://27.media.tumblr.com/tumblr_m1q3rewBFi1qdlh1io1_400.gif)
(http://30.media.tumblr.com/tumblr_m1ir0ibTmc1qdlh1io1_400.gif)
(http://k43.kn3.net/taringa/7/0/0/2/5/9/1/_maxnorris_/251.gif?2568)
(http://k45.kn3.net/taringa/1/5/2/5/6/7/99/-taringaporinga-/34B.gif?9221)
(http://k43.kn3.net/taringa/1/5/6/3/1/4/65/lily_carp/C8A.gif?1165)
(http://forgifs.com/gallery/d/195364-1/Dog-eats-standing-up.gif)
(http://forgifs.com/gallery/d/195120-1/Backward-hand-reversed-fingers.gif)
(http://forgifs.com/gallery/d/195124-1/Cat-strikes-defensive-pose.gif)
(http://forgifs.com/gallery/d/195171-1/Track-race-came-first.gif)
(http://forgifs.com/gallery/d/194087-1/Mime-jogger-invisible-wall.gif)
(http://forgifs.com/gallery/d/193824-1/Angry-cobra-cat.gif)
(http://forgifs.com/gallery/d/195010-1/Cheater-Cyclist-justice.gif)
(http://forgifs.com/gallery/d/194191-1/Parkour-long-double-kong.gif)
(http://forgifs.com/gallery/d/195401-1/Bear-waves-to-human.gif)
-
LOL at everything :L
-
(http://i.imgur.com/AsFJG.png)
-
(http://i.imgur.com/AsFJG.png)
:L
-
lmao :L
-
[youtube]http://www.youtube.com/watch?v=4j4ZWAlPBG8&feature=player_embedded[/youtube]
-
(http://i.imgur.com/AsFJG.png)
just epic
-
:(((((((((((((((((((((((((((((
patience guys , im gonna overtake lex :L
-
(http://i.imgur.com/AsFJG.png)
:L
-
if anri wouldn't join it would look far more comedic.
btw, take a look at maf list, didn't know we have 30 members, including two Me's :D
-
haha lots of old mes on there :)
-
(http://i.imgur.com/AsFJG.png)
:L
-
AYE anri umad son
[15:25:52] Anri Bardhi: ILL FUCK YOUR MOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOM
[15:26:00] Anri Bardhi: U MOTHERFUCKING IDIOT GERMAN
[15:26:05] Anri Bardhi: btw did u get banned ?
[15:26:11] fastcake // ~rapido ~pastel: LOL no
[15:26:12] fastcake // ~rapido ~pastel: why
[15:26:23] Anri Bardhi: because i got BANEED U STUPID MOFO
[15:26:25] Anri Bardhi: FUCK U
[15:26:27] fastcake // ~rapido ~pastel: lol
[15:26:28] fastcake // ~rapido ~pastel: ur fault
[15:26:31] fastcake // ~rapido ~pastel: for jokin bout ma mama
[15:26:41] Anri Bardhi: FUCK U AND YOUR HORNY MOM
EDIT: talk bout love n respect reddragon :L
-
(http://i.imgur.com/AsFJG.png)
i can't understand what's funny about this, a group of underestimated players made a Clan so they can unite and improve their racing skills, i know were not fast as LSR or pro as MAF or successful as the FSR and 2F2F but we have somthing that non of the groups above has, which is Love and Respect to the server and other clans, FAP And PR are made by a very strong players but they fell apart, while SFX Still rising!
keep laughing guys, but you'll never break our well of becoming theee best players in adrenalinex, might sound impossbile but with love and respect we'll defenitly dominate server ;)
SPEED FREAKS X
-
(http://www.projectcargonetwork.com/usermemberimages/510/ush-logo.JPG)
(http://www.lola-ed.com/wp-content/uploads/2012/01/Key6Cover.jpg)
(http://www.deviantart.com/download/38891780/USH_CREW_by_clideone.jpg)
-
http://www.incredibox.fr/en/#/application
-
/me doesn't like clicking on links you post lololol
-
lmao
-
/me doesn't like clicking on links you post lololol
same, i won't open a fastcake link ever again :'(
-
:L
im approving that link is safe :police:
-
seal of aproval or gtfo!
edit:
something like
(http://i.imgur.com/0iXpH.gif)
-
:L :L
-
i thought it was StarFoX?
-
(http://i.imgur.com/Ei87S.png)
-
[youtube]http://www.youtube.com/watch?v=_7sjaTI-RDU[/youtube]
-
old but still funny as hell :L
-
nfsw!
http://www.youtube.com/watch?v=GrKSWocbbdw
lol @ 1:35-1:52
-
I will be able to watch it on May 11 :'( , I already have an account and cba to make another just to watch this xD
-
There's a way to go through that, you don't even have to login:
http://www.breakthesecurity.com/2010/12/how-to-watch-adult-videos-in-youtube.html
Normally that should work (just tried it)
http://www.youtube.com/v/GrKSWocbbdw
-
I am one year older on youtube than I am in real because of that :L
-
Thanks ouzo, it worked haha
-
funny cheaters http://forum.adrenalinex.co.uk/index.php/topic,4557.0/topicseen.html
all server noticed he was hacking lol
-
(https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash3/s720x720/582320_3607913805646_1507732408_33184489_1715191074_n.jpg)
-
lol
-
http://www.youtube.com/watch?v=GrKSWocbbdw
wtf :L :L
-
[youtube]http://www.youtube.com/watch?v=mSDfxde8fSg&feature=related[/youtube]
-
U should live here :L
[youtube]http://www.youtube.com/watch?v=C8HZX61gvIQ&feature=player_embedded[/youtube]
-
haha :L
-
(http://static.fjcdn.com/pictures/Gorilla+warfare_d41bd9_3543352.jpg)
(http://static.fjcdn.com/pictures/Red+Bull+gives+you+wings_2a960f_3600806.jpg)
(http://static.fjcdn.com/large/pictures/d1/3d/d13d60_3594864.jpg)
(http://static.fjcdn.com/pictures/Bus+is+stoping_423ffd_3589592.jpg)
(http://static.fjcdn.com/pictures/Combined+Motorsport.+And+you+said+motorsport+wasn+t+a+legitimate+sport_156ed2_3563198.jpg)
(http://static.fjcdn.com/pictures/well_263147_3567941.jpg)
-
lol
(http://i1.kwejk.pl/site_media/obrazki/2012/04/837ea56830802a2f4f50a9db929d6d7b.jpeg)
-
haha black humour ftw :L
-
lóóól
[youtube]http://www.youtube.com/watch?v=2WT8_G3oa2A[/youtube]
-
[youtube]http://www.youtube.com/watch?v=UtBeuIjFotU&feature=related[/youtube]
-
[youtube]BaltnJ6OETg[/youtube]
-
(http://imageshack.us/photo/my-images/845/lolniceocseansssey646e4.png/)
i don't know why the pics dont show
-
:L
(http://desmond.imageshack.us/Himg845/scaled.php?server=845&filename=lolniceocseansssey646e4.png&res=landing)
-
hahahahah good one :L
-
Yo dawg' we heard you like ships, so we put a ship on your ship so you can... whatever...
[youtube]http://www.youtube.com/watch?v=mL4CB4SZieo&feature=player_embedded[/youtube]
-
lol :L
-
http://www.dumpert.nl/mediabase/1393951/937e28a2/tupac_zou_erelid_buma_zijn.html
-
http://www.dumpert.nl/mediabase/1393951/937e28a2/tupac_zou_erelid_buma_zijn.html
maan that's mean but can kinda hilarious when he's yelling "my tapes, give me my tapes" lmaao !
-
indian/pakistan people selling his FAKE SELFMADE tapes so he got mad at them and told them to remove them :D they probably had no idea he was 2pac.
-
indian/pakistan people selling his FAKE SELFMADE tapes so he got mad at them and told them to remove them :D they probably had no idea he was 2pac.
oww now i got it :P !! :L
-
[youtube]http://www.youtube.com/watch?v=d7NES48ed8U&feature=youtu.be[/youtube]
-
(http://yadalol.com/cdn/pictures/2012/03/it-s-a-dell-rolling-_1330717271_epiclolcom.png)
-
FAP And PR are made by a very strong players
we'll defenitly dominate server ;)
This post actually made my day :L
-
FAP And PR are made by a very strong players
we'll defenitly dominate server ;)
This post actually made my day :L
Glad that The SFX Nation made your day! :), keep updated on whatever we say so you don't miss anything! ;)
-
You didn't get what Joe said, did you :L
-
You didn't get what Joe said, did you :L
You didn't get what i said, did you :L
-
You didn't get what Joe said, did you :L
You didn't get what i said, did you :L
(http://i0.kym-cdn.com/entries/icons/original/000/000/554/facepalm.jpg)
-
http://www.dumpert.nl/mediabase/1393951/937e28a2/tupac_zou_erelid_buma_zijn.html
Tupac went hard on them niggas
-
Omg haahah lol:
[youtube]http://www.youtube.com/watch?v=agTDR7fG1T8[/youtube]
-
ahah epic
-
Mario galaxy :L
-
lol :L
-
[youtube]http://www.youtube.com/watch?v=5fEjr8tfb2k&feature=related[/youtube]
-
Omg haahah lol:
[youtube]http://www.youtube.com/watch?v=agTDR7fG1T8[/youtube]
ahh ive got these mods lol hilarious
-
(http://i.imgur.com/8cyG1.jpg)
lol and wtf
-
I have these games
-
wow those are really old games then
-
[youtube]http://www.youtube.com/watch?v=CxeKQHeTfug&feature=results_main&playnext=1&list=PL0C9942D7E9E631FE[/youtube]
-
FOR MOOMAN
[youtube]b8ezQMdtyW4[/youtube]
[youtube]OTstknzqWQs[/youtube]
-
wrong topic.......
-
[youtube]uhfpZZ4Ll8w[/youtube]
-
[youtube]uhfpZZ4Ll8w[/youtube]
This seems how when you ride on bull :L
-
Rofl ur avatar Shelby :L :L
-
(http://upload.slike.com/slike/XP200.png) :L
-
[youtube]http://www.youtube.com/watch?v=V98O6cxohcU[/youtube]
-
haha wtf :L
http://answers.yahoo.com/question/index?qid=20101013034434AA1VSS6
-
lmao :L
-
Real is my favourite football club but Sergio Ramos killed this penalty.... :L :L
[youtube]http://www.youtube.com/watch?feature=endscreen&NR=1&v=9RLnAHZqmoc[/youtube]
[youtube]http://www.youtube.com/watch?v=ggUdWaada00[/youtube]
-
:L --> (http://upload.slike.com/slike/y1Oqh.jpg)
-
LMAO
-
(http://img6.imageshack.us/img6/5787/beztytuudnl.jpg)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/04/2dc2a87eb6b23c6224203c5a7b5fbcc3.jpg?1335692723)
(http://i1.kwejk.pl/site_media/obrazki/2012/04/e7e655586e23f1c174da07ba70a6e301.gif?1335693544)
(http://i1.kwejk.pl/site_media/obrazki/2012/04/0d8d0e9cc443edcd0684216e8e693ee8.gif?1335698201)
(http://i1.kwejk.pl/site_media/obrazki/2012/04/5d06e000e0987c98dd3c745a35e16792.jpg?1335633852)
-
haha :L
-
(http://cdn.smosh.com/sites/default/files/bloguploads/test-answer-ninja.jpg)
(http://cdn.smosh.com/sites/default/files/bloguploads/test-answer-NO.jpg)
(http://cdn.smosh.com/sites/default/files/bloguploads/test-answer-what-love.jpg)
(http://cdn.smosh.com/sites/default/files/bloguploads/test-answer-perry-platapus.jpg)
(http://cdn.smosh.com/sites/default/files/bloguploads/test-answer-close-enough.jpg)
(http://cdn.smosh.com/sites/default/files/bloguploads/test-answer-killer-vagina.jpg)
(http://legacy-cdn.smosh.com/smosh-pit/062011/internet-titanic.jpg)
(http://legacy-cdn.smosh.com/smosh-pit/062011/internet-sparta.jpg)
(http://legacy-cdn.smosh.com/smosh-pit/012011/facebook-history-1.jpg)
(http://cdn.smosh.com/sites/default/files/bloguploads/comic-fail-rock-hard.jpg)
(http://cdn.smosh.com/sites/default/files/bloguploads/comic-fail-butt-in.jpg)
(http://cdn.smosh.com/sites/default/files/bloguploads/comic-fail-ironman-fist.jpg)
(http://cdn.smosh.com/sites/default/files/bloguploads/funny-youtube-comments-ants-pee.jpg)
(http://cdn.smosh.com/sites/default/files/bloguploads/funny-youtube-comments-pony.jpg)
(http://cdn.smosh.com/sites/default/files/bloguploads/funny-youtube-comments-one-handed.jpg)
(http://cdn.smosh.com/sites/default/files/bloguploads/funny-youtube-comments-skyrim-knee.gif)
-
Phobos these pics maked lmo :L
-
Same, I really lol'd :L
Btw are the first ones from http://funnyexam.com/ (http://funnyexam.com/)?
-
I found them somewhere else but the original source is from there I guess :D
-
(http://static4.fjcdn.com/comments/3641325+_4fa1941f0ecdb7b64685be178ed674f7.jpg)
(https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/392490_266846500077546_100002565952280_562574_494933205_n.jpg)
(http://static.fjcdn.com/pictures/Blowed+in+the+bathroom_2598d2_3642219.jpg)
check avatar pic
-
(http://i.imgur.com/gWZPB.jpg)
-
the lucky guy with that white car.
-
welcome on albania.
-
(http://i.imgur.com/YxBPK.jpg)
-
[youtube]NvXleDSkB-g[/youtube]
poor guy who would get this instead of psp lol
-
^ haha :L
and this is a tractor simulator in north korea
(http://i.imgur.com/n3UG8.jpg)
-
[youtube]http://www.youtube.com/watch?v=jx6nYP_eDDg&feature=channel&list=UL[/youtube]
-
[youtube]http://www.youtube.com/watch?v=jx6nYP_eDDg&feature=channel&list=UL[/youtube]
I love that show :L I've watched every single episode of this :police:
-
(http://i1.kwejk.pl/site_media/obrazki/2012/05/2a29efaa1f6541b1588a59e7b14ecd6f.jpg?1335896559)
epic sandwich
[youtube]http://www.youtube.com/watch?v=yuV_dscvmmc[/youtube]
epic coffie
[youtube]http://www.youtube.com/watch?v=lAeY8jHznXg&feature=relmfu[/youtube]
and chocolade shake:
[youtube]http://www.youtube.com/watch?v=l590cD9bfGU&feature=relmfu[/youtube]
how to open yoghurt easly
[youtube]http://www.youtube.com/watch?v=CaUMhGlvUUA&feature=relmfu[/youtube]
and pancakes!
[youtube]http://www.youtube.com/watch?v=FpjFmb3LNdM&feature=relmfu[/youtube]
-
im downloading faster then transferring a file from pc to usb :(
(http://i.imgur.com/eLLLq.jpg)
-
your USB flash drive got slow speed
btw when we talk about USB. i washed my 16 GB USB flash drive together with laundry and its still works lol :L :L
-
[youtube]http://www.youtube.com/watch?v=e7XeRiYs2PQ&feature=youtu.be[/youtube]
:L :L :L :L :L :L
-
[youtube]http://www.youtube.com/watch?v=hajUhUdnuaM[/youtube]
-
lol ^
-
[youtube]http://www.youtube.com/watch?v=D_pUXJYZtCA&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=mkAqK4YW474[/youtube]
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/4053065_700b_v1.jpg)
-
he'd hammer it.
btw 9gag :-[
-
NSFW??
http://i1.kwejk.pl/site_media/obrazki/2012/05/5a9e1c6697032fee43fd48a8398543d3.gif?1336168400
(http://i1.kwejk.pl/site_media/obrazki/2012/05/f1acafcd2886ae65cfda6dd7fcc41aba.jpg?1336214608)
-
[youtube]http://www.youtube.com/watch?v=S3Tx5jMRgPc&feature=plcp[/youtube]
-
Agus and Ouzo
(http://www.stupidgifs.com/images/full/171.gif)
-
lol, similar to argentina :L
-
[youtube]Pv45h3xmZwE[/youtube]
i know its old but i still like it and makes laugh :L
1:40
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/4053065_700b_v1.jpg)
Ewww 9FAG
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/4053065_700b_v1.jpg)
Ewww 9FAG
lets cry together?
-
How funny, I quickly made a video of a prank call, then today someone posted saying they made a video (It's my friggin video).
http://forum.sa-mp.com/showthread.php?p=1849632#post1849632
-
obvious troll is obvious
-
Dude you're fucking lame.. you stole my video and went back in time to post it 2 years before I did simply to troll me, get a life..
lol
-
Dude you're fucking lame.. you stole my video and went back in time to post it 2 years before I did simply to troll me, get a life..
lol
haha :L
-
rofl :L
-
(http://i.imgur.com/icru1.png)
-
Dude you're fucking lame.. you stole my video and went back in time to post it 2 years before I did simply to troll me, get a life..
lol
haha
-
no one posted it yet :L
[youtube]http://www.youtube.com/watch?v=IfeyUGZt8nk[/youtube]
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/4130954_700b_v1.jpg)
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/4130954_700b_v1.jpg)
unrealistic and doesn't consider possibilities within full explanation of depth... for instance, "He is a decorated war hero" that's not what everyone thinks is it?...
completely dislike and find that these types of stupid shit is complete and utter useless... i guess it only appeals to those who are moved by this and are gullible without making an inference of some sort
-
Not to mention that the ark never existed. ::)
-
shit, I killed Beethoven and voted for Hitler XD
-
Not to mention that the ark never existed. ::)
well...................
-
[youtube]http://www.youtube.com/watch?v=GAe9Sd4M9JI[/youtube]
-
bethoven was deaf at the end of his life
-
[youtube]http://www.youtube.com/watch?v=1fVrholQnLY&feature=related[/youtube]
-
(http://24.media.tumblr.com/tumblr_lhy121GIyF1qcu83eo1_500.jpg)
(http://ani.me/site_media/media/articles/2012/04/27/true_story_jpg_650x10000_q85.jpg)
-
(http://us13.memecdn.com/Epic-troll_o_146400.jpg)
(http://eu3.memecdn.com/counter-trolling_o_177027.jpg)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=nVihWG_oe1M#![/youtube]
Scumbag Steve ft Chuck Testa, Your Argument Is Invalid.
-
(http://i.imgur.com/ZRVsK.png)
:o what i did to you?
-
haha lol, maybe he clicked it by accident or something like that
-
(http://i1.kwejk.pl/site_media/obrazki/2012/05/56f31c72c7d2612ecefc7754a19863ec.gif?1337036290)
(http://i1.kwejk.pl/site_media/obrazki/2012/05/8ebd63359efb8931136ca387e716d865.jpg?1336841504)
(http://i1.kwejk.pl/site_media/obrazki/2012/05/02e1adcd0f6ea8e776282670278f7de4.jpg?1336903289)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/05/56f31c72c7d2612ecefc7754a19863ec.gif?1337036290)
ONE WORLD INFERNUS NITRO RACE
-
[youtube]o8_CBEw6QvE[/youtube]
-
[SFX]Vennessa 10 years ago ......
(http://i1216.photobucket.com/albums/dd363/Fresh95Prince/533050_358687457511118_173237926056073_1014380_502887159_n.jpg)
I'do anything to avoid having a shower, i mean ANYTHING !
(http://i1216.photobucket.com/albums/dd363/Fresh95Prince/387787_266849933377399_100001571829759_748949_1723447898_n.jpg)
Every Student's dream
(http://i1216.photobucket.com/albums/dd363/Fresh95Prince/535701_343151819074917_284145041642262_954788_775642288_n.jpg)
-
[youtube]a0Ve2eNfgPQ[/youtube]
-
wtf how do you crash like that lol
-
mods
-
:L
-
(http://i.imgur.com/XRLD9.png)
9Fag, this is why the internet hates you.
-
I generally like 9gag, but I have to agree on that
-
[youtube]http://www.youtube.com/watch?v=j6PyDfvIZV8&feature=related[/youtube]
-
[youtube]http://www.youtube.com/watch?v=j6PyDfvIZV8&feature=related[/youtube]
I FUCKING LOVE THIS !
-
[youtube]http://www.youtube.com/watch?v=pf0Fcbk_2t0&feature=fvwrel[/youtube]
-
[youtube]http://www.youtube.com/watch?&v=kl7_x8kmqOk#![/youtube]
-
(http://i1.kwejk.pl/site_media/obrazki/2012/05/56f31c72c7d2612ecefc7754a19863ec.gif?1337036290)
ONE WORLD INFERNUS NITRO RACE
:L :L :L :L LOL M4 :L but true....:D
-
hahahaha
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=Exy_ztdpAoI[/youtube]
-
I generally like 9gag, but I have to agree on that
+1
(http://i.imgur.com/qAPZp.png)
-
lol :L
i was laughing so hard
[youtube]http://www.youtube.com/watch?v=yAmzjAXAfec[/youtube]
-
:L
[youtube]http://www.youtube.com/watch?&v=vLcvCH1h1qk[/youtube]
[youtube]http://www.youtube.com/watch?&v=PfhcefT_Vws[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=whyWodsRhhE[/youtube]
-
(http://www.chamsko.pl/demot/0_0_232336507_Slownik_engielsko-polski_przez_alfred77_middle.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2012/05/8797c9b9f4377d3e982e5141fb01a46f.png?1337331139)
(http://i1.kwejk.pl/site_media/obrazki/2012/05/44653858acdaf7d4f9b9de3feb2e6bf4.jpg?1337419598)
(http://i1.kwejk.pl/site_media/obrazki/2012/05/94b37217c1553799d82407c1beb0a36b.jpg?1337408182)
(http://i1.kwejk.pl/site_media/obrazki/2012/05/008445bc7a4df7f9e31da7ebad0a9a6c.jpg?1337437904)
-
buahahaha
http://forum.adrenalinex.co.uk/index.php/topic,802.0.html
-
buahahaha
http://forum.adrenalinex.co.uk/index.php/topic,802.0.html
lmao!
Tinypic sucks!
-
lmao, ill never use tinypic again.
-
buahahaha
http://forum.adrenalinex.co.uk/index.php/topic,802.0.html
lol, it took me some time to understand :L
-
(http://i.imgur.com/vGr91.jpg)
-
buahahaha
http://forum.adrenalinex.co.uk/index.php/topic,802.0.html
http://forum.adrenalinex.co.uk/index.php/topic,431.msg12255.html#msg12255 :L
-
buahahaha
http://forum.adrenalinex.co.uk/index.php/topic,802.0.html
http://forum.adrenalinex.co.uk/index.php/topic,431.msg12255.html#msg12255 :L
http://forum.adrenalinex.co.uk/index.php/topic,431.msg12290.html#msg12290 Hilarious
-
we have to dig all falky posts :L
-
haha, what I've found :L
ENB on SAMP ;D
(http://img370.imageshack.us/img370/4641/pwned20by20mjos3.png)
(http://i39.tinypic.com/2zzlqp3.jpg)
(http://i39.tinypic.com/2zqr4a0.jpg)
(http://i42.tinypic.com/24n38mq.jpg)
(http://i39.tinypic.com/9r0nbc.jpg)
(http://i42.tinypic.com/54tzee.jpg)
(http://i39.tinypic.com/25iy7m1.jpg)
(http://i42.tinypic.com/dnn1ih.jpg)
(http://i40.tinypic.com/34in3fm.jpg)
lol @ chat.
(http://i41.tinypic.com/33y5nrt.jpg)
Look at top 5.
(http://i42.tinypic.com/22avmf.jpg)
(look @ chat) lol.
(http://i40.tinypic.com/2q8bvis.jpg)
MOAR ENB !
(http://i40.tinypic.com/2vj8jnp.jpg)
(http://i40.tinypic.com/xp4l5y.jpg)
(http://i44.tinypic.com/dcg0ed.jpg)
(http://i39.tinypic.com/2mri0r4.jpg)
(http://i40.tinypic.com/2ms1ngk.jpg)
(http://i43.tinypic.com/8xlz5l.jpg)
I banned you cuz' your name appeared on the AutoAdmin alert then when I checked your weapons you had a Dildo.
(http://i42.tinypic.com/2emk1tg.jpg)
-
haha its starting to look as if someone changed the pictures intentionally to make falky's posts look gay and hilarious :L
-
yeah, stupid tinypic did :P
-
[youtube]9XC5VYXYNEI[/youtube]
-
hahaha
-
[youtube]http://www.youtube.com/watch?v=GGzGeK3kLaw&list=FLO_GNooxDNzt_FU0QCmrszw[/youtube]
[youtube]http://www.youtube.com/watch?v=lxdnJjN-UCM&list=FLO_GNooxDNzt_FU0QCmrszw[/youtube]
[youtube]http://www.youtube.com/watch?v=A-iFLBhny4w&list=FLO_GNooxDNzt_FU0QCmrszw[/youtube]
[youtube]http://www.youtube.com/watch?v=a0Ve2eNfgPQ&list=FLO_GNooxDNzt_FU0QCmrszw[/youtube]
-
WTF!
[youtube]http://www.youtube.com/watch?v=ICEVY5Sbbp0&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=mQMNPzYmiEM&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=VdeHsvCJ6-U&list=FLO_GNooxDNzt_FU0QCmrszw&index=4&feature=plpp_video[/youtube]
nice work meze :L
-
[youtube]http://www.youtube.com/watch?v=LEymSFY_eKc[/youtube]
[youtube]http://www.youtube.com/watch?v=S5qUMK-TzOg[/youtube]
[youtube]http://www.youtube.com/watch?NR=1&feature=endscreen&v=TC6JhvM0jWM[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=-1ssOqmAOFY[/youtube]
-
lol :o
-
(http://i1.kwejk.pl/site_media/obrazki/2012/05/3dfaa13574598021f283b05325333230.jpg?1337751315)
(http://i1.kwejk.pl/site_media/obrazki/2012/05/6e68272cad3ea52022b585bb895fe656.jpeg?1337678854)
(http://i1.kwejk.pl/site_media/obrazki/2012/05/5e61c34f20aa8bfa19827d84332ad356.jpg?1337627148)
(http://i1.kwejk.pl/site_media/obrazki/2012/05/e0fa68fe1eb6bd12f5a3026b7016c3d1.jpg?1337618530)
(http://i1.kwejk.pl/site_media/obrazki/2012/05/40b65df921c84eb2f96a2e41a93fac5f.jpg?1337619418)
(http://i1.kwejk.pl/site_media/obrazki/2012/05/27c640faf51bc5d392331c3c06ea6f94.jpg?1337637232)
(http://i1.kwejk.pl/site_media/obrazki/2012/05/eebf9a59d173794edc3b10f15f50570d.jpg?1336325372)
(http://i1.kwejk.pl/site_media/obrazki/2012/05/fe3ed543bb876ff680522a7a06a4eddd.jpg?1337642561)
(http://i1.kwejk.pl/site_media/obrazki/2012/05/450d8f2e8f785175119e9d197c009d1c.jpeg?1337664632)
(http://i1.kwejk.pl/site_media/obrazki/2012/05/6e15602d21edf2a5f28bdec7d55d5827.jpg?1337599336)
(http://i1.kwejk.pl/site_media/obrazki/2012/05/477f15676dda2fdfc435ab3d4f330146.jpg?1337465284)
(http://i1.kwejk.pl/site_media/obrazki/2012/05/ebe6f76bcdc3dc828c849b980f07fc09.gif?1337807984)
-
[youtube]http://www.youtube.com/watch?v=EQnZsJIJfIw[/youtube]
-
(http://upload.slike.com/slike/XP200.png) :L
(http://i.imgur.com/eRS7x.jpg)
-
lada commercial
[youtube]http://www.youtube.com/watch?v=XcN1zT8hFEo[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=rfQqh7iCcOU[/youtube]
Buy it here lol ;L
http://www.kickstarter.com/projects/joylabs/makey-makey-an-invention-kit-for-everyone
-
http://memegenerator.net/Anri-Ax?urlName=Anri-Ax&browsingOrder=New&browsingTimeSpan=AllTime
WOO ANRI :-*
(http://cdn.memegenerator.net/instances/400x/20984460.jpg)
(http://cdn.memegenerator.net/instances/400x/20984478.jpg)
(http://cdn.memegenerator.net/instances/400x/20984406.jpg)
(http://cdn.memegenerator.net/instances/400x/20984380.jpg)
-
:L :L :L
-
for: sale pute stephanie
turn on CC
[youtube]gu70wQYrdG4[/youtube]
-
WEREVERTUMORRO FTW!
-
I reminded myself something :L "Glory Hole"
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=D0EGozm1TsA[/youtube]
If you know what I mean :L
(http://upload.wikimedia.org/wikipedia/commons/a/aa/Glory_hole_in_washroom_(155966507).jpg)
-
(http://www.thebuzzmedia.com/wp-content/uploads/2008/08/female-transvestite-bodybuilder.jpg)
-
(http://i.imgur.com/5jWQP.gif)
-
Lol^ :L
-
(http://static.fjcdn.com/pictures/Windex_1f5d34_3732227.jpg)
(http://static.fjcdn.com/pictures/When+you+see+it_e1879c_3732288.jpg)
(http://static.fjcdn.com/pictures/Simpsons_222896_3732302.jpg)
(http://static.fjcdn.com/pictures/Yawn+rape_082add_3732359.jpg)
(http://static.fjcdn.com/pictures/Logic_5b9aa2_3732297.jpg)
(http://static.fjcdn.com/pictures/guns+over+women+xD.+top+ten+reasons+why+guys+prefer_9640ef_3732645.jpg)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=Dr9f7VNqCxk#![/youtube]
-
(http://www.thebuzzmedia.com/wp-content/uploads/2008/08/female-transvestite-bodybuilder.jpg)
(http://rainbowsparklesims.files.wordpress.com/2012/01/shocked_fans_omg.gif)
-
[youtube]e-LE0ycgkBQ[/youtube]
-
(http://static.fjcdn.com/comments/I+m+Atheist+and+even+I+can+see+that+this+is+_e61c61154627b269ce6029a50894782f.jpg)
-
(http://i.imgur.com/e6t2q.png)
(http://i.imgur.com/DFZ6s.png)
-
well, at least its famous.
[youtube]mB1zWEhgrLs[/youtube]
-
(http://www.chamsko.pl/demot/0_0_484523129_kotki_przez_prezes1pencon_middle.jpg)
-
(http://www.fishing.net.nz/asp_forums/uploads/62598/Frustration.gif)
(http://www.usageorge.com/Animated-Gif/gif/funny.gif)
(http://netanimations.net/Moving-animated-picture-of-girl-blowing-a-bubble.gif)
(http://s3.favim.com/orig/44/funny-gif-humor-lol-wtf-Favim.com-367733.gif)
8)
-
[youtube]http://www.youtube.com/watch?v=UdYIQ0k2jXM[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=l72eF9Rxa38#![/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=OT2m70FVTU8[/youtube]
-
(http://i1.kwejk.pl/site_media/obrazki/2012/06/e59ef248c693dd577c18f99029943552.jpg?1338551401)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/2ef50efba872cf17dce267968c01bfc4.jpg?1338552363)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=kkxYao1kkKI[/youtube]
-
[youtube]http://www.youtube.com/watch?v=Kdrbd3MZFk0&feature=g-all-u[/youtube]
-
(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)(http://i812.photobucket.com/albums/zz41/gtamyths1/wtfff.gif)
-
[youtube]http://www.youtube.com/watch?v=Jnqp9IJc1Sk&feature=related[/youtube]
-
LOL!!!!!!!!!!! :L :L :L :L :L :L
-
i really laughed hard :L
-
hahaha :L
-
We should have this on aX :L
-
ROFL :L
-
1:45 at http://www.sadistic.pl/kotokopter-vt119654.htm
-
I think Snoopy looks like this guy, recently i saw this movie and i though to myself: WTF ??? ITS SNOOPY!!!
dont lose ur chance to see it, GREAT MOVIE.
PS: its from 2011. -__- ikr
[youtube]uE1tqMUd4R8[/youtube]
[youtube]_z5LXyWn3-w[/youtube]
-
Haha yeah. I have seen the movie and thought he looked a bit familiar. :L
-
(http://i.imgur.com/ye7Ra.jpg)
-
(http://i.imgur.com/ye7Ra.jpg)
:L :L
-
(http://img.izifunny.com/pics/20111213/original/izifunny-gifdump-10-gifs_5.gif)
(http://slackstack.com/wp-content/uploads/2012/03/funny-gifs-shaqs-magic.gif)
-
(http://i.imgur.com/FZwSg.jpg)
-
(http://i.imgur.com/FZwSg.jpg)
Weird to see you posted this, this is something someone would post in 9gag xD
-
:D, gone bit overboard after row 5
-
(http://i.imgur.com/FZwSg.jpg)
Weird to see you posted this, this is something someone would post in 9gag xD
Nope, most of 9gag would fall under the "mac" list (especially the last box)
-
(http://i.imgur.com/FZwSg.jpg)
Weird to see you posted this, this is something someone would post in 9gag xD
Nope, most of 9gag would fall under the "mac" list (especially the last box)
Haha :L
-
[youtube]http://www.youtube.com/watch?v=JLUSyxRnUGw[/youtube]
-
LOL
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=auiJvBdentY[/youtube]
-
Hahahhaha^ :L
-
Chatting with Pino in PM!
(http://img689.imageshack.us/img689/7968/senzanomesz.png)
(http://img513.imageshack.us/img513/4218/iltruccodiumathurmannel.jpg)
:L :L :L :L :L :L :L
-
lol
he is so epic
-
Pino pino pino?Pino pino! :L hahah xDDD
-
A movie about video games. Coming to the cinemas this summer. Pacman sitting in a circle like an alcoholic made me laugh lol:
[youtube]http://www.youtube.com/watch?v=b35zsIbGLsM&feature=player_embedded[/youtube]
-
lol epic
(http://i.imgur.com/qXCAK.jpg)
-
(http://upload.slike.com/slike/HnMQq.jpg)
(http://upload.slike.com/slike/vnAWq.jpg)
(http://upload.slike.com/slike/OhPKJ.jpg) :L
-
(http://www.epiclol.com/cdn/pictures/2012/06/hotdogs_1338542678_epiclolcom.jpg)
(http://www.epiclol.com/cdn/pictures/2012/04/batman-s-boy-sidekic_1335076181_epiclolcom.jpg)
HOVER HAND
(http://www.epiclol.com/cdn/pictures/2012/01/mclovin-s-hover-hand_1327206313_epiclolcom.jpg)
(http://www.epiclol.com/cdn/pictures/2012/06/am-i-re-posting-this-right_1338542678_epiclolcom.jpg)
(http://www.epiclol.com/cdn/pictures/2012/06/take-that-migration_1338542678_epiclolcom.jpg)
(http://www.epiclol.com/cdn/pictures/2012/03/how-to-tell-if-you-a_1333148614_epiclolcom.png)
(http://www.epiclol.com/cdn/pictures/2012/06/wife_1338542678_epiclolcom.png)
(http://www.epiclol.com/cdn/pictures/2012/06/swag_1338542678_epiclolcom.jpg)
(http://www.epiclol.com/cdn/pictures/2012/06/rubeus-hagrid-more-like-rubeus-crossposted-in-harrypotter_1338542678_epiclolcom.gif)
gingerfro
(http://www.epiclol.com/cdn/pictures/2011/12/giant-ginger-afro-red-hair-fro.png)
(http://www.epiclol.com/cdn/pictures/2012/05/every-girls-way-of-s_1337194962_epiclolcom.png)
(http://www.epiclol.com/cdn/pictures/2012/06/fill-in-the-blank_1338542678_epiclolcom.jpg)
(http://www.epiclol.com/cdn/pictures/2012/01/time-to-turn-ma-swag_1326953053_epiclolcom.jpg)
-
(http://i.imgur.com/mhviQ.jpg)
-
:L
-
[youtube]http://www.youtube.com/watch?v=njos57IJf-0&feature=plcp[/youtube]
-
[youtube]http://www.youtube.com/watch?v=zUnVLELDzzI&feature=player_embedded[/youtube]
-
Best ones:
:L
[youtube]http://www.youtube.com/watch?v=Veg63B8ofnQ[/youtube]
[youtube]http://www.youtube.com/watch?v=kfchvCyHmsc[/youtube]
[youtube]http://www.youtube.com/watch?v=he2a4xK8ctk[/youtube]
[youtube]http://www.youtube.com/watch?v=_1VgJfiZISc[/youtube]
[youtube]http://www.youtube.com/watch?v=tGzZ29-7Q7g[/youtube]
[youtube]http://www.youtube.com/watch?v=yTSUCSPseLU[/youtube]
[youtube]http://www.youtube.com/watch?v=CmC62Eg82E8[/youtube]
-
(http://2.bp.blogspot.com/-yvzv7Q6uxRw/TwHt_p8ouDI/AAAAAAAABGA/pi3lwuffyw4/s400/dad-i-m-hungry-serious-troll.jpg)
(http://2.bp.blogspot.com/-d99uIjYbX_k/TuX1xzEJKtI/AAAAAAAAAc0/d9y4KhhG89Y/s400/trollface-infinite-money.png)
[youtube]http://www.youtube.com/watch?v=KaqC5FnvAEc&feature=player_embedded[/youtube]
-
(http://i.imgur.com/FGJNh.jpg)
-
(http://chzfailnation.files.wordpress.com/2012/06/epic-fail-access-fail.gif)
-
[youtube]vTuOBXZ3upA[/youtube]
[youtube]Ig1xKFLrpaY[/youtube]
[youtube]zYH2cueCW-w[/youtube]
-
(http://chzfailnation.files.wordpress.com/2012/06/epic-fail-access-fail.gif)
haha epic fail, head on crash! :L
-
NSFW: http://img857.imageshack.us/img857/6313/19979.jpg
(http://img62.imageshack.us/img62/7219/yd83a583a.jpg)
(http://desmond.imageshack.us/Himg9/scaled.php?server=9&filename=y9d5fe326.jpg&res=landing)
(http://img444.imageshack.us/img444/4180/a5d1t.jpg)
(http://desmond.imageshack.us/Himg442/scaled.php?server=442&filename=xb94dc1be.jpg&res=landing)
(http://img689.imageshack.us/img689/7416/chacke.jpg)
(http://desmond.imageshack.us/Himg855/scaled.php?server=855&filename=x6ecbc387.jpg&res=landing)
-
EDIT: now that you labeled it as nsfw, i should remove my quote lol
-
thats definitely NSFW
http://forum.adrenalinex.co.uk/index.php/topic,2499.0.html
-
(http://i1.kwejk.pl/site_media/obrazki/2012/06/3f5d1c9419d34b11b000c5ef31bb33be.gif?1339787518http://i1.kwejk.pl/site_media/obrazki/2012/06/3f5d1c9419d34b11b000c5ef31bb33be.gif?1339787518)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/f8bbc5634c6eb907cfbc510b9c3cb733.jpg?1339800419)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/0056868cd43420ef30bacf1378b6bd62.gif?1339755452)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/309e99902ec45967fdb120759cb22368.jpg?1339787960)
-
nsfw
https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash3/535886_396363337067032_1399208017_n.jpg
:L :L :L :L :L :L :L :L :L :L
-
lol these pics and videos are epic
-
http://z0r.de/L/z0r-de_4014.swf :L
-
not really a picture or video, someone posted it on facebook, kinda funny :L
http://www.amazon.co.uk/product-reviews/B000KKNQBK/ref=cm_cr_pr_top_link_1?ie=UTF8&showViewpoints=0
-
[youtube]http://www.youtube.com/watch?v=rDmdtcyDVlg&feature=related[/youtube]
[youtube]http://www.youtube.com/watch?v=RSS1zh45Fts&feature=related[/youtube]
-
http://www.cda.pl/video/270208d/Fap-Fap-Fap-Fapore
Translate lyrics lol "FAP FAP FAP FAPPORE"
-
[youtube]http://www.youtube.com/watch?v=x4U4Pm1GApY[/youtube]
-
[youtube]http://www.youtube.com/watch?v=x4U4Pm1GApY[/youtube]
Got better:
[youtube]http://www.youtube.com/watch?v=FIwSjDSxcts&feature=related[/youtube]
-
(http://mistrzowie.org/uimages/services/mistrzowie/i18n/pl_PL//201206/1339939539_by_Lupus28.jpg?1339939539)
-
haha :L
-
hahaha
(http://mistrzowie.org/uimages/services/mistrzowie/i18n/pl_PL//201206/1339070586_by_sillu.jpg?1339973059)
-
hahaha
(http://mistrzowie.org/uimages/services/mistrzowie/i18n/pl_PL//201206/1339070586_by_sillu.jpg?1339973059)
Ohai Gen. Sõida kaine peaga ;)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/06/6f886886f014aade0d585dd86163c552.jpeg?1340105776)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/a72521b2bdf1dd359537f0057a04af23.jpg?1340101550)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/8558d61f901e00cfc3327b86ecae7b97.jpeg?1340051735)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/de3588feb4fd96d40b1e4fe3aef13aaa.jpg?1340047576)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/5a44b90908e76cc5acffb39996dcabbc.jpg?1340054248)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/54f41aa1f3bec8b27ee0239e77acbe48.jpg?1339851920)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/20d7b38f17c799160d1b1d614a2ed068.jpg?1340008443)
at end, little test/poll:
(http://i1.kwejk.pl/site_media/obrazki/2012/06/3d86be128eae8f5c747dd5b38feddb79.jpg?1339928811)
oh shit, according to this, I'm John Lennon, so bit dead atm... :-\
-
[youtube]http://www.youtube.com/watch?v=RG0Y46duQdM[/youtube]
-
(http://3.bp.blogspot.com/-hr7l9F-Gy8k/TyCHFoKLl2I/AAAAAAAABdw/7SYu5dhq8G0/s640/staredad-ojciec-i-syn-lsd-smoki-w-kuchni.jpg)
(http://3.bp.blogspot.com/-oATN9B4xGR4/TyCHGy4ApGI/AAAAAAAABd4/uOMsXJ50xcw/s640/staredad-ojciec-i-syn-mama-w-kuchni-plonie.jpg)
(http://3.bp.blogspot.com/-Qjr21c_eQWY/TyCHMG9l-EI/AAAAAAAABeM/bvijyD6l8Z4/s400/staredad-ojciec-i-syn-nie-moge-znalezc-mamy-wyjdz.jpg)
(http://2.bp.blogspot.com/-LfLsvIBh2zU/TyCHEsXpeuI/AAAAAAAABdo/ZEEXjybBpbE/s640/staredad-ojciec-i-syn-hitler-ludzie-z-gazowni.jpg)
____________________
If you think you will be somehow touched by this do not read please
(http://3.bp.blogspot.com/-aGLG5ydO0xE/T4Df2PLyv-I/AAAAAAAACtg/om3_bQpWNho/s320/lol-jesus-jesus-dj-zmartwychwstajace-bity.jpg)
(http://4.bp.blogspot.com/-Gennpd33AZY/T4Df8CYrVWI/AAAAAAAACt8/aGsmjVUEgJc/s320/lol-jesus-jezus-chrystus-mem-brb-lol.jpg)
(http://2.bp.blogspot.com/-6q0ay_AfAEY/T4DgCd4Br_I/AAAAAAAACuY/fgwcyFGqnxo/s320/lol-jesus-jezus-chrystus-mem-eric-goes-to-hell.jpg)
(http://2.bp.blogspot.com/-jBaoIz_k_Ok/T4Df6dlMxeI/AAAAAAAACt4/xNYoYKPH9zM/s320/lol-jesus-jezus-chrystus-mem-boing-trampolina.jpg)
(http://2.bp.blogspot.com/-4CGTwv95Qn0/T4DgFiEUc2I/AAAAAAAACuk/hArtGH8E6rE/s400/lol-jesus-jezus-chrystus-mem-hipster-people-followed-me-before-twitter.jpg)
(http://i0.kym-cdn.com/photos/images/original/000/246/351/d14.gif)
(http://i3.kym-cdn.com/photos/images/original/000/039/483/abcb6b586f4d17b0f425b0059858ded6.gif)
Some old ones LOL :L
(http://1.bp.blogspot.com/-LtTvt_xjeeg/T1jNqVoLoeI/AAAAAAAACNQ/B9WATd9DMLc/s320/sfw-porn-safe-for-work-porn-bezpieczna-pornografia-w-pracy-sluchanie-muzyki.jpg)
(http://i2.kym-cdn.com/photos/images/newsfeed/000/039/485/RoughRider_pianist.gif)
(http://2.bp.blogspot.com/-lbTA98XiQZY/T1jPUwBk9NI/AAAAAAAACNc/fYMyyXG8syI/s320/sfw-porn-safe-for-work-porn-bezpieczna-pornografia-w-pracy-hamburger.jpg)
(http://3.bp.blogspot.com/-Hq7HeZVPWqM/T1jPW04eyrI/AAAAAAAACNw/QnhLMdd7pYo/s320/sfw-porn-safe-for-work-porn-bezpieczna-pornografia-w-pracy-szycie-spodni.jpg)
(http://2.bp.blogspot.com/-duJSdaYcJoI/T1jt5o9J2AI/AAAAAAAACN8/nT2xtzvZwXU/s400/sfw-porn-safe-for-work-porn-bezpieczna-pornografia-w-pracy-pizza.jpg)
(http://4.bp.blogspot.com/-_8ytLQFTqmI/T1jt6GlC-XI/AAAAAAAACOA/222OFHhiM7s/s400/sfw-porn-safe-for-work-porn-bezpieczna-pornografia-w-pracy-waz.jpg)
__________________________________________________
(http://3.bp.blogspot.com/-voV1Ln3yHsM/T75rVDMJuyI/AAAAAAAADjc/YZJliohx-AA/s400/nieomal-politycznie-poprawny-wiesniak-almost-politically-correct-redneck-mem-kolorowi.jpg)
(http://2.bp.blogspot.com/-B7SD7wj9uPI/T75rV8NY-SI/AAAAAAAADjg/VrALLNO1pGw/s400/nieomal-politycznie-poprawny-wiesniak-almost-politically-correct-redneck-mem-lesbijki.jpg)
(http://2.bp.blogspot.com/-wpXGAoRS1Kw/T75rWYbhL6I/AAAAAAAADjs/VEXMS3c5200/s400/nieomal-politycznie-poprawny-wiesniak-almost-politically-correct-redneck-mem-malzenstwa-gejow.jpg)
(http://4.bp.blogspot.com/-RHjwAzuRKGA/T75rXuQbVXI/AAAAAAAADj0/NUqD2xW7ctA/s400/nieomal-politycznie-poprawny-wiesniak-almost-politically-correct-redneck-mem-ocena-kolor-skory.jpg)
(http://2.bp.blogspot.com/-B-qW_jfWszE/T75rYat4_qI/AAAAAAAADj8/Eo32-nQmalE/s400/nieomal-politycznie-poprawny-wiesniak-almost-politically-correct-redneck-mem-olimpiady-specjalne.jpg)
(http://2.bp.blogspot.com/-DYgolNT95hA/T75rapY2rbI/AAAAAAAADkQ/3ex9ldnF7F8/s400/nieomal-politycznie-poprawny-wiesniak-almost-politically-correct-redneck-mem-zydzi-bekon.jpg)
-
lmao :L
-
(http://oi49.tinypic.com/34dt01k.jpg)
:L :L :L
-
lmaoo :L
-
wtf
[youtube]GVcy8UL9PbE[/youtube]
-
i don't get it, whats funny in this?
also why mostly sa-mp videos have so shitty music (many cs servers have that too)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/d2d617e86b7962cec0154da9a1b838f9.jpg?1340462942)
any ideas what car this hamster got there?
-
Scion TC. :blank:
-
guess this is NSFW lol
http://i.imgur.com/ZleNO.jpg
(http://i.imgur.com/oTqTt.jpg)
(http://i.imgur.com/HdVYq.jpg)
(http://i.imgur.com/zUpmB.jpg)
(http://i.imgur.com/hxSWj.jpg)
(http://i.imgur.com/sCCQP.jpg)
-
miniature body part jewelry
(http://www.stylist.co.uk/resource/binary/1853b064bfc9c1f795d8615ad775d479/Little-Third-Ear.jpg)
(http://www.stylist.co.uk/resource/cache/binary/d1143d1e32461b268e1e21b98de5420a/615x330_Little-Mouth-Ring.jpg?m=1340279150)
(http://www.stylist.co.uk/resource/binary/7f01278b6e1d20a196e038c6f9e40401/Little-Nose-Necklace.jpg)
(http://www.stylist.co.uk/resource/binary/b02e4b109d56e2df40f0db55f241b45c/Little-Ear-collar-clips.jpg)
-
i seen this before, and isn't at least 1 image missing from this set?
-
I think it was another pic of the ear-earing so I didn't post it coz there already one picture of that.
-
[youtube]http://www.youtube.com/watch?v=CGkW0fFRtMs[/youtube]
[youtube]http://www.youtube.com/watch?v=NcFr7zYwI_I&feature=relmfu[/youtube]
-
(http://i.imgur.com/y94SN.jpg)
-
(http://dailypicksandflicks.com/wp-content/uploads/2012/01/china-12000-km-sign.jpg)
(http://www.geekologie.com/2012/02/03/expert-mode-toilet.jpg)
-
(http://i.imgur.com/y94SN.jpg)
That watermark...
-
I was waiting for it :L should have cut it off in paint
-
i always do it so joe doesn't bitch about it :P
-
[youtube]86p62pKVtO4[/youtube]
-
simply, epic:
[youtube]http://www.youtube.com/watch?v=rp8hvyjZWHs&feature=player_embedded[/youtube]
Front:
(http://mintscreen.com/wp-content/uploads/2011/09/kfc_logo_file_www_ComVort.png)
Back:
(http://www.chamsko.pl/demot/0_0_1251809651_A_tymczasem_w_KFC_przez_Derletztetag_middle.jpg)
(http://www.chamsko.pl/demot/0_0_255319747_Lessi_przez_Dexter_middle.jpg)
-
lol @ the engineer song
-
Messi :L
-
[youtube]http://www.youtube.com/watch?v=rp8hvyjZWHs&feature=player_embedded[/youtube]
awesome song :L
-
(http://24.media.tumblr.com/tumblr_m62bwpSi291qdlh1io1_250.gif)
-
(http://www.chamsko.pl/demot/0_0_342056491_WSB_przez_xxxcyrulxxx_middle.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/13473f7f4ad03d21685405fcf1741c49.jpg?1340883868)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/c64d86899c11bb8748d85c4e064a1da4.jpeg?1340882717)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/8c1b5b45e37d99c3e7f72ec76d0cf7a2.jpg?1340881153)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/c35c089bfc85bcd9979de138a02d23fd.jpg?1340822028)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/c77d767e80cdb955db4c64791455dedc.png?1340739626)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/4ad4e1f359ec2b459318d6d56bc71239.jpg?1340886740)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/701e4a7799b89dcbabd09dcb2765d3ba.gif?1340801975)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/9f381adf28838fc4121b65dccb0cf1cd.gif?1340799318)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/5260a1fd3d74fed5ce5ebe549c2e7574.gif?1340799543)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/eda0b1583655c9fb0d9140c10b8780d9.gif?1340828660)
(http://i1.kwejk.pl/site_media/obrazki/2012/06/09349d7733daee4c0b49abcfd7b21fd1.jpg?1340791963)
-
lol why did i click on the motherfucking pi symbol :L
-------------------
(http://i.imgur.com/4t25G.jpg)
-
[youtube]http://www.youtube.com/watch?v=hCp741-MVIw[/youtube]
haha :L
-
:L
[youtube]ygiV-FQ7ths[/youtube]
-
lmao :L
-
(http://www.chamsko.pl/demot/0_0_1701439786_Gowniany_zarcik_przez_hounsagar_middle.jpg)
-
or:
1. "accidentally" leave that picture on your computer so everyone sees it
2. do it with real shit
-
HAHA :L
-
[youtube]http://www.youtube.com/watch?v=vqeNRH87KyY[/youtube]
-
Max nice picture :L
-
She is 72 years old:
[youtube]http://www.youtube.com/watch?v=reiepxxc3Cg[/youtube]
-
[youtube]http://www.youtube.com/watch?v=AxhJ-h__X7U[/youtube]
[youtube]http://www.youtube.com/watch?v=sMMmPJYqZE0[/youtube]
[youtube]http://www.youtube.com/watch?v=dQ8iAuFoQzw[/youtube]
-
last one, why hand at 0:02 is in 'skin' colour, and at 0:04 is kinda deadly 'blue'?
-
last one, why hand at 0:02 is in 'skin' colour, and at 0:04 is kinda deadly 'blue'?
Good question Max O_O
This is some misterious, or good videotrick xd
-
^video editing anyone?
________________________________
this is probably NSFW lol but I don't think any of you is at work so who gives a shit?
[youtube]http://www.youtube.com/watch?v=Wl1CXn60XCw[/youtube]
:L
-
:L
-
(http://i50.tinypic.com/1zn0in7.gif)
-
:L :L :L
-
[youtube]t_cc_nRQlec[/youtube]
-
[youtube]t_cc_nRQlec[/youtube]
^ how the..? :D
anyway
9gag haters gonna hate
(http://d24w6bsrhbeh9d.cloudfront.net/photo/4708715_460s.jpg)
-
haha
btw in some latin spanish places it's ''double-v'', but I think that in Spanish (from Spain) it also is ''double-u'' :L
-
lmao :L :L
-
dont remember if i posted this before
[youtube]Up5abDNjD20[/youtube]
-
Reminds me of meme mod a bit :L Max would love it, especially if you've put photo with him and his alfa.
-
download link pls i wanna make top1s O0 O0 O0 O0 O0
-
Yeah... With so slim alfa you will avoid every lamp.
I know it will not work...
-
download link pls i wanna make top1s O0 O0 O0 O0 O0
have fun O0 http://forum.adrenalinex.co.uk/index.php?action=dlattach;topic=1999.0;attach=3926
-
ha
-
lmao :L
-
so realistic, looks just like a real car :L
-
Jur1z nice car dude :L :L
-
heh we also say doble u in Costa Rica
-
^same in Mexico
-
Mum, I'm black!!!
[youtube]http://www.youtube.com/watch?v=zmpKBAXuVjg[/youtube]
-
Lol jur1z you should post that to GTAForums here: http://www.gtaforums.com/index.php?showtopic=267333&st=7180
-
Balotteli in Uk adrenaline X
(https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-ash4/380664_396158543776403_1378503770_n.jpg)
-
Hahah ^^
-
powerful weapon in bf
[youtube]http://www.youtube.com/watch?v=Z_1H-iSEgTA&feature=player_embedded[/youtube]
(http://static.fjcdn.com/pictures/Jesus_212a55_2094698.jpg)
-
I use this tactic too.
-
[youtube]http://www.youtube.com/watch?v=7cdkqJN2rxI[/youtube]
-
[youtube]http://www.youtube.com/watch?v=7cdkqJN2rxI[/youtube]
[youtube]http://www.youtube.com/watch?v=iemD6QVx2Mw&feature=related[/youtube]
-
(http://mistrzowie.org/uimages/services/mistrzowie/i18n/pl_PL//201207/1342091727_by_FixedCharlie.jpg?1342091728)
-
well, Bieber > gaga, ruchana, adele
-
how dare you put Adele below Bieber
-
her songs sucks and she screams too much
-
wow man, tell me, you do like reggaeton right?
-
lol just checked it in wikipedia, hell no!
i listen to classic rock from 60's to 90's and metal and sometimes electronic music but without any words.
modern music is total shit especially pop, worst times in music
for example,wtf is that shit:
http://www.youtube.com/watch?v=qrO4YZeyl0I
http://www.youtube.com/watch?v=wiad0cl_BC8
http://www.youtube.com/watch?v=owldT-fyq90
[i didn't put youtube tags on purpose]
-
modern music is total shit especially pop, worst times in music
Couldn't agree more
PS: Seems like we like the same kind of music :L
-
i also mostly rock and bit of 90s pop, but there are some exceptions.
but there are so many cool beats/tunes spoiled by unbelievably stupid lyrics.
-
I listen to some 70's stuff, some 80's rock/metal, a lot of 90's rock/metal and some 00's stuff, I totally agree on the fact that music has changed a lot, and for bad (have in mind that reggaeton is not music, its anti-music). What gaga does, well, let's just say it makes me feel sick, but on the other hand I think Adele is a great soul singer and has a great future. Not everything is bad, and the fact that The Darkness is back, makes me feel music can still be saved.
-
i have respect for adele because shes one of the few singers today that doesnt use too much bass and drums in her songs and sings without auto-tune
-
I have respect for Adele but I dislike her songs because I agree with Krzysiek that she screams and shouts too much, it gets tiring to listen to.
-
I have respect for Adele but I dislike her songs because I agree with Krzysiek that she screams and shouts too much, it gets tiring to listen to.
even though i rap and you guys think i'm a doohbag, but whenever adele screams and shouts she touches my emotions and i go through all those mixed up emotions .... deep stuff. respect for adele
-
(http://i1.kwejk.pl/site_media/obrazki/2012/07/02e8fd1492c9c2552a5f9eb5320e2836.jpg?1342266915)
(http://i1.kwejk.pl/site_media/obrazki/2012/07/7b255f62e70a571ba8466395a45b248c.png?1342343722)
(http://i1.kwejk.pl/site_media/obrazki/2012/07/35cb72db3ea32c877c4060a5d6c00407.gif?1342341356)
(http://i1.kwejk.pl/site_media/obrazki/2012/07/f33adf1e3048dfd00e89a521f27a6aad.gif?1342169660)
(http://i1.kwejk.pl/site_media/obrazki/2012/07/b47282c6505656b045b548669d85523d.jpg?1342169660)
(http://i1.kwejk.pl/site_media/obrazki/2012/07/3e41620e70c7885c32a1d145488bd290.jpg?1342176291)
(http://i1.kwejk.pl/site_media/obrazki/2012/07/37bcb59116c4295fc4842f8436d4c389.jpg?1342336464)
(http://i1.kwejk.pl/site_media/obrazki/2012/07/4ebe45dd2c0bbfe7bf04d7cf96657d4a.jpg?1342113137)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/07/37bcb59116c4295fc4842f8436d4c389.jpg?1342336464)
what subject is this fake test supposed to be for?
-
Who wants to be a millionaire
-
(http://i1.kwejk.pl/site_media/obrazki/2012/07/7b255f62e70a571ba8466395a45b248c.png?1342343722)
[youtube]http://www.youtube.com/watch?v=t3uAdC6xkEY[/youtube]
-
lmao :L
General knowledge?
btw moo why do you have an elephant as an avatar? lol
-
1st question is kinda pointless, Napoleon did not die in any battle
-
maybe thats the point..
-
http://www.youtube.com/watch?v=w1gusAIRN8M&feature=share
-
(http://i1.kwejk.pl/site_media/obrazki/2012/07/37bcb59116c4295fc4842f8436d4c389.jpg?1342336464)
what subject is this fake test supposed to be for?
This is incredible. Required really good level of sarcasm to write this. Anyway sometimes I'm afraid to do something like THAT in school. Writing whole examine like that may get you in troubles lol. Depends to who you do it. :L
-
(http://i1.kwejk.pl/site_media/obrazki/2012/07/37bcb59116c4295fc4842f8436d4c389.jpg?1342336464)
what subject is this fake test supposed to be for?
This is incredible. Required really good level of sarcasm to write this. Anyway sometimes I'm afraid to do something like THAT in school. Writing whole examine like that may get you in troubles lol. Depends to who you do it. :L
Quote from: MadMax
:o
-
(http://i1.kwejk.pl/site_media/obrazki/2012/07/37bcb59116c4295fc4842f8436d4c389.jpg?1342336464)
that's how i got my ass suspended in 10th grade .... it int that funny when you'r parents take a look at it ...
-
(http://i1.kwejk.pl/site_media/obrazki/2012/07/37bcb59116c4295fc4842f8436d4c389.jpg?1342336464)
what subject is this fake test supposed to be for?
This is incredible. Required really good level of sarcasm to write this. Anyway sometimes I'm afraid to do something like THAT in school. Writing whole examine like that may get you in troubles lol. Depends to who you do it. :L
This guy must be a legend.
-
(http://assets.pornsfw.com/hashed_silo_content/silo_content/992/resized/sfw-porn-1225101632-16390.jpg)
(http://assets.pornsfw.com/hashed_silo_content/silo_content/1034/resized/sfw-porn-1225944305-10539.jpg)
(http://assets.pornsfw.com/hashed_silo_content/silo_content/1007/resized/sfw-porn-1225141902-50411.jpg)
(http://assets.pornsfw.com/hashed_silo_content/silo_content/2436/resized/2q44234.jpg)
(http://assets.pornsfw.com/hashed_silo_content/silo_content/14549/resized/09.jpg)
(http://assets.pornsfw.com/hashed_silo_content/silo_content/1028/resized/sfw-porn-1225145344-26129.jpg)
(http://assets.pornsfw.com/hashed_silo_content/silo_content/1065/resized/sfw-porn-1228102431-49557.jpg)
(http://assets.pornsfw.com/hashed_silo_content/silo_content/1082/resized/-1233815564-20401.jpg)
(http://assets.pornsfw.com/hashed_silo_content/silo_content/3385/resized/drunk.jpg)
(http://assets.pornsfw.com/hashed_silo_content/silo_content/5507/resized/scream.jpg)
(http://assets.pornsfw.com/hashed_silo_content/silo_content/991/resized/sfw-porn-1225101481-21003.jpg)
(http://assets.pornsfw.com/hashed_silo_content/silo_content/988/resized/sfw-porn-1225101108-5692.jpg)
(http://assets.pornsfw.com/hashed_silo_content/silo_content/11041/resized/sausageparty.jpg)
(http://assets.pornsfw.com/hashed_silo_content/silo_content/2360/resized/gostosa.jpg)
(http://assets.pornsfw.com/hashed_silo_content/silo_content/15946/resized/Go_for_a_short_swim.jpg)
(http://assets.pornsfw.com/hashed_silo_content/silo_content/1014/resized/sfw-porn-1225142673-92452.jpg)
-
hahaha :L
-
www.youtube.com/watch?v=ZqtMOYm1AwE
-
[youtube]http://www.youtube.com/watch?v=ifU67deNr8A&feature=youtu.be[/youtube]
-
[youtube]Q2SJXQ7w1Zk[/youtube]
-
www.youtube.com/watch?v=ZqtMOYm1AwE
haha that guy is so epic
-
[youtube]Q2SJXQ7w1Zk[/youtube]
and how to get your order like a boss:
(http://www.fun-blog.pl/sites/default/files/images/mcdrive.gif)
-
[youtube]http://www.youtube.com/watch?v=dBM7i84BThE
[/youtube]It's a trap!
-
(http://www.chamsko.pl/demot/0_0_2080996876_Super_Mario_Bross_cala_prawda_przez_bambo93_middle.jpg)
(http://www.chamsko.pl/demot/0_0_1148752125_Nigglets_przez_Harakiri_middle.jpg)
-
nigglets :L
-
lool
-
(http://i1.kwejk.pl/site_media/obrazki/2012/07/825c8856c69657fcd5b3348994769d46.gif?1342704182)
(http://i1.kwejk.pl/site_media/obrazki/2012/07/580b4acdd3a68ad94f7b360cce3fd8bb.jpeg?1342718723)
(http://lolsheaven.com/wp-content/uploads/2012/02/The-Continents-can-be-Formed-to-Shape-Like-a-Chicken.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2012/07/c633178e05136c8088fa8b31dfe8d8c9.jpg?1342688749)
(http://i1.kwejk.pl/site_media/obrazki/2012/07/d6075370c047aed7ac45ddb03fcda396.jpg?1342681786)
(http://i1.kwejk.pl/site_media/obrazki/2012/07/42c673ccf6719341b896d2b00fb926f2.jpeg?1342681886)
(http://i1.kwejk.pl/site_media/obrazki/2012/07/dc53c44d7dd2d0f63c9e1b2c772293ee.gif?1342681786)
(http://kwejk.pl/obrazek/1316618/przez-most.html)
(http://i1.kwejk.pl/site_media/obrazki/2012/07/4f8935bf0bcf4796bafa506a0d1fa439.jpg?1342601099)
(http://i1.kwejk.pl/site_media/obrazki/2012/07/61cb5d9ba4993e6f4f6a0fd3ee5bad6f.jpg?1342515132)
(http://i1.kwejk.pl/site_media/obrazki/2012/07/a035b8631926e8ec699ca7100fa2a1c1.jpg?1342441762)
-
(http://i.imgur.com/schdE.jpg)
-
Old but still cool
[youtube]http://www.youtube.com/watch?v=tj7UwiuzaKA[/youtube]
-
Old but still cool
[youtube]http://www.youtube.com/watch?v=tj7UwiuzaKA[/youtube]
"...so I give a fuck, wait what?"
Jon Lajoie ftw :L
-
[youtube]http://www.youtube.com/watch?v=6P1vf_7DoLA&[/youtube]
-
[youtube]http://www.youtube.com/watch?v=6P1vf_7DoLA&[/youtube]
LEX very funny video :D
-
ive been using that trick for years
-
do u eat kangaroos? :o
-
lol :L
-
lol not me, but people do. but it's tough meat cause kangaroos jump around a lot.
-
kangaroo beef is nice
-
but kangaroo isn't beef :(
-
For Vertigo/Charles Manson
[youtube]http://www.youtube.com/watch?v=6P1vf_7DoLA&feature=youtu.be[/youtube]
-
[youtube]mDBi6FczkHs[/youtube]
(http://farm5.staticflickr.com/4115/4883930520_6bd32d9db8_z.jpg)
(http://www.demotivationalposters.org/image/demotivational-poster/0910/fueled-by-pizza-and-milk-ascii-porn-is-hot-demotivational-poster-1254508469.jpg)
(http://losingterry.com/images/food/february/pizza%20and%20milk.jpg)
-
lmao
-
eeeeeeeeeeeeewwwwwwwwwwwwwww pizza goes with coca cola not milk
-
eeeeeeeeeeeeewwwwwwwwwwwwwww pizza goes with coca cola not milk
-
eeeeeeeeeeeeewwwwwwwwwwwwwww pizza goes with coca cola not milk
-
[youtube]Q2SJXQ7w1Zk[/youtube]
he uploaded new video in KFC (btw, i advise u to stop the video at around 0:50 ;D )
[youtube]KfRaVU3v7D0[/youtube]
-
lol dafuq is this shit :L
[youtube]http://www.youtube.com/watch?v=wrswvbJfLS8[/youtube]
btw is it NSFW or not ??? lol
-
wtf did I just watch lol
-
wtf did I just watch lol
-
aaaaaaaaaaaaahhhhhhhhh my eyyyyeeeeeesssss, they're bleeeeeding!!!!!!!!!
-
[youtube]http://www.youtube.com/watch?v=1Hm96rAlZ9I[/youtube]
-
haha poor people :L
-
NSFW?
[youtube]http://www.youtube.com/watch?v=hcBUwnoZNDM[/youtube]
-
what the fuck is that lol
-
It's vagina day :L
-
haha :L
-
vid has been removed :(
-
[youtube]http://www.youtube.com/watch?v=HYguhI_oRSs[/youtube]
-
possibly NSFW.. http://www.youtube.com/watch?v=4s0_QKL3O8s
take on meeeeeeee :L
-
possibly lol
somehow this is even worse than the first one
-
looooooooool f*cking shave that crap
-
possibly NSFW.. http://www.youtube.com/watch?v=4s0_QKL3O8s
take on meeeeeeee :L
OMFG!
-
omg what did i start.... :L
-
Well, at least you have disproved "no boobs on Youtube."
I managed to keep my history so clean until now. :L
-
History has a remove button :P
-
(http://i.imgur.com/ClTnb.jpg)
-
the walking dead (cat edition)
[youtube]http://www.youtube.com/watch?v=x5MPH1BX6MI[/youtube]
-
Why give drugs to cats.. to test them?
-
(http://i.imgur.com/ClTnb.jpg)
ha!
-
I tried clicking "ok" -_-
-
ok
-
the walking dead (cat edition)
[youtube]http://www.youtube.com/watch?v=x5MPH1BX6MI[/youtube]
the one who did this should be impaled and burned while still alive
-
They are not on LSD, I have seen that video before and it is a guy who adopts unwanted cats with a certain nervous/muscular disorder (I forget the name). So yeah, he's actually a pretty nice guy. :D
-
(http://i.imgur.com/vXeu3.jpg)
-
lol
-
[youtube]http://www.youtube.com/watch?v=PK8dsAeMmPk&feature=player_embedded#![/youtube]
-
^Awesome. 8)
-
Slow motion is awesome
-
They killed me :(
-
Lol Jarno :L
I jumped out of my chair when it exploded
-
(https://fbcdn-sphotos-a.akamaihd.net/hphotos-ak-snc7/311654_454562751250613_817779374_n.jpg)
-
i recommend this LAUGHING YOGA FOR STRESS for after getting rammed by noobs in server.
[youtube]31TTcjYw0hQ[/youtube]
Ok now serious things..
[youtube]YpA_TO8blDE[/youtube]
[youtube]ZYAFoso0CLk[/youtube]
[youtube]ztpbyj9v_0s[/youtube]
-
:L :L :L :L maybe nsfw
http://www.youtube.com/watch?v=FdMjZHp2NpA&feature=youtu.be
-
[youtube]http://www.youtube.com/watch?v=pi-z7GHUj8Y[/youtube]
-
http://fc01.deviantart.net/fs13/f/2007/077/2/e/Animator_vs__Animation_by_alanbecker.swf
Pretty epic
-
Cool :D
-
When mooman says somthing on chat
https://www.youtube.com/watch?v=P1lUB90UwMw
-
wtf
-
:L
-
lol so true
-
Hellish russian train [youtube]http://www.youtube.com/watch?v=zr6GN1Jx8g4[/youtube]
-
O_O scary
-
kinda looks like my diesel car going uphill (smoke)
-
that guy made another vid
[youtube]Xelyx-TMTX0[/youtube]
[youtube]3PUibM7OYmc[/youtube]
-
(http://photos-d.ak.fbcdn.net/photos-ak-snc7/v85005/47/368943629825783/app_109_368943629825783_534835471.png)
i found this photo on fb :L
-
(http://www.chamsko.pl/demot/0_0_892679964_nigga_please_przez_Derletztetag_middle.jpg)
[spoiler=NSFW](http://www.chamsko.pl/demot/0_0_1561616736_Srajaca_jazda_przez_geraltsw_middle.gif)[/spoiler]
(http://www.chamsko.pl/demot/0_0_778209280_Piraci_przez_rav21l_middle.jpg)
(http://www.chamsko.pl/demot/0_0_782465114_Nowoczesna_sztuka_przez_geraltsw_middle.jpg)
if gta 4 had polish realities...
(http://www.chamsko.pl/demot/0_0_866105063_poscig_przez_tatanka88_middle.jpg)
-
nsfw: http://www.chamsko.pl/demot/0_0_1561616736_Srajaca_jazda_przez_geraltsw_middle.gif
WTF :blank:
-
ffs man, thats nsfw, just had fucking lunch...
-
ffs man, thats nsfw, just had fucking lunch...
agree :-\
-
(http://i.imgur.com/B1tVq.jpg)
-
(http://25.media.tumblr.com/tumblr_m8cxmhqvcB1qat986o1_500.gif)
(http://k38.kn3.net/taringa/1/8/2/7/8/0/02/_the_boss/C4B.gif?336)
(http://25.media.tumblr.com/tumblr_m8a8uwEpIV1qdlh1io1_400.gif)
[youtube]SCoUBnsgPqk[/youtube]
-
:L
(http://i.imgur.com/lYyWc.jpg)
:L
-
Pr0 graffiti skills.
-
olympics
(http://s2.lemde.fr/image/2012/08/01/518.28220858896x660/1741223_6_72dc_oleg-verniaiev-of-ukraine-competes-in-the-vault_3f48f0b608827271cbc8b36018d922ed.jpg)
(http://s1.lemde.fr/image/2012/08/02/952x648.921875/1741861_6_67e7_china-s-jiao-liuyang-reacts-after-winning-her_bf60588dd085a4d87a463f8a28b201f3.jpg)
wut ???
(http://s2.lemde.fr/image/2012/08/01/904.73895582329x660/1740879_6_2511_non-le-judoka-russe-ivan-nifontov-n-est-pas-du_2b9a1eebc35ce5b701ac1d9da533d496.jpg)
(http://s2.lemde.fr/image/2012/07/31/925.80821917808x660/1740435_6_2ae3_les-plongeurs-tom-daley-et-peter-waterfield_1f670add995e1e380ca5a9615d8b6028.jpg)
-
oh dodger
(http://i.imgur.com/6xXlk.png)
-
[youtube]0SBR8XmE4PA[/youtube]
-
lol
[youtube]http://www.youtube.com/watch?v=YyIhDFNzVEk&feature=plcp[/youtube]
and again lol @ 5:28
[youtube]http://www.youtube.com/watch?v=tD0PKDGlwiw&feature=g-u-u[/youtube]
-
[youtube]http://www.youtube.com/watch?v=aSc35sAi19s&feature=relmfu[/youtube]
-
[youtube]http://www.youtube.com/watch?v=W_L-nt0rmqU&feature=g-vrec[/youtube]
-
Reminds me of IV mode lol
(http://i.imgur.com/Kq7oI.jpg)
-
(http://eu7.memecdn.com/who-needs-a-title-for-this_o_618631.gif)
-
(http://static.fjcdn.com/gifs/this_39abb0_1115769.gif)
(http://i50.tinypic.com/9qb3pc.gif)
(http://static.fjcdn.com/gifs/The+most+epic+gif+of+all+time+.+Found+it+in_1690c6_3612406.gif)
(http://25.media.tumblr.com/tumblr_m5phvgD6te1rwcc6bo1_400.gif)
-
(http://cs316326.userapi.com/v316326157/5499/FIexPctsNOQ.jpg)
-
Spain only has two people :( did the bull eat the other one
-
Spain only has two people :( did the bull eat the other one
:L :L :L :L :L
-
loooool
[youtube]http://www.youtube.com/watch?v=MTRHbfjNmEg[/youtube]
-
LOL
-
(https://p.twimg.com/An4zEG6CEAA_cKM.jpg:large)
-
probably re-post, but couldn't find any intresting one
(http://www.chamsko.pl/demot/0_0_87234145_Spierdalaj_chuju_przez_geraltsw_middle.gif)
(http://www.chamsko.pl/demot/0_0_702152939_USB_przez_xxxcyrulxxx_middle.jpg)
-
(http://i.wp.pl/a/f/jpeg/29652/f8.jpeg)
(http://i.wp.pl/a/f/jpeg/29652/f11.jpeg)
(http://i.wp.pl/a/f/jpeg/29652/f9.jpeg)
(http://i.wp.pl/a/f/jpeg/29652/f7.jpeg)
(http://i.wp.pl/a/f/jpeg/29652/f3.jpeg)
(http://i.wp.pl/a/f/jpeg/29652/f14.jpeg)
(http://i.wp.pl/a/f/jpeg/29652/f17.jpeg)
(http://i.wp.pl/a/f/jpeg/29652/f10.jpeg)
(http://i.wp.pl/a/f/jpeg/29652/f4.jpeg)
-
(http://i.imgur.com/kKmmg.png)
-
Sad
-
but true
-
LOL, reading that made me laugh irl :L (maybe because I totally agree with him)
btw I love it how they put a black label on his name and then at the bottom of the letter you can see it anyways
-
Who is Nicki Minaj?
-
don't know if you're serious but it's this thing :L
(http://hiphopwired.com/wp-content/uploads/2011/11/nicki-minaj-versace-500x360.jpg)
-
lol, true
was like wtf when saw clip of one of the songs, IS IT EVEN A SONG?
-
omg!
kill it before it lays eggs!
-
Who is Nicki Minaj?
(http://i.imgur.com/yKIPA.jpg)
-
lol the fuck?
http://z0r.de/17
-
Who is Nicki Minaj?
(http://i.imgur.com/yKIPA.jpg)
I don't get it.
-
Living under a rock. Everybody should know who Nicki Minaj is :L
-
id rather live under a rock then :-X
-
if you don't know what living under a rock is, you obviously live under a rock.
-
Haters!
-
if you don't know what living under a rock is, you obviously live under a rock.
how could you live somewhere and not know about it?
-
if you don't know what living under a rock is, you obviously live under a rock.
how could you live somewhere and not know about it?
kidnapped in a basement since you were born, in total darkness :L
-
if you don't know what living under a rock is, you obviously live under a rock.
how could you live somewhere and not know about it?
thats the irony in it
-
\M/ :o
(https://fbcdn-sphotos-f-a.akamaihd.net/hphotos-ak-ash4/427008_290986024350364_380026430_n.jpg)
-
(http://kwejk2.pl/img/upload/20120807204246.jpg)
(http://kwejk2.pl/img/upload/20120813145315.jpg)
(http://www.sadistic.pl/pics/5b915a68915c.gif)
(http://www.sadistic.pl/pics/055cc56457b0.gif)
(http://kwejk2.pl/img/upload/20120803191510.jpg)
lol, fucking rammer!
(http://img.myepicwall.com/i/2012/08/01816ec5ac5395571f1cfbc764200400.gif?1344441087)
new part for cysios signature:
(http://img.myepicwall.com/i/2012/08/8cc41e5eb3a5735b4c1f201a81f58000.gif?1344428365)
(http://kwejk2.pl/img/upload/20120725105829.gif)
NSFW ? http://img.myepicwall.com/i/2012/08/dbcb35048e352741400d0773d7a5d7e3.gif?1344632817
this too? http://kwejk2.pl/img/upload/20120717190614.jpg
-
lol, fucking rammer!
(http://img.myepicwall.com/i/2012/08/01816ec5ac5395571f1cfbc764200400.gif?1344441087)
new part for cysios signature:
(http://img.myepicwall.com/i/2012/08/8cc41e5eb3a5735b4c1f201a81f58000.gif?1344428365)
thx :)
both are cool but do you have video for second gif?
-
[youtube]http://www.youtube.com/watch?v=f0sis-ZL7w8&feature=player_embedded[/youtube]
-
lol stupit bicz
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=sjQwLOA-hBs[/youtube]
-
(https://fbcdn-sphotos-c-a.akamaihd.net/hphotos-ak-ash4/s480x480/300709_392424110823719_1957570116_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=dJzarxtDUUY&feature=g-high-lik[/youtube]
-
(http://img.myepicwall.com/i/2012/08/8cc41e5eb3a5735b4c1f201a81f58000.gif?1344428365)
That is so unfair on the black car driver (FSO? Skoda?), I hope he is okay.
-
Looks like a Volvo to me and i dont think he still lives.. :-\
-
isnt it lada?
-
I hope he is okay.
hard to survive crash like that lol
-
(http://git.pl/resource_image/git.pl-5348.gif)
(http://www.chamsko.pl/demot/0_0_1310640242_Trasa_Europejska_przez_tatanka88_middle.jpg)
(http://www.chamsko.pl/demot/0_0_1917524807_Olllllyeeeeeaaaach__przez_zryta1_middle.jpg)
(http://www.chamsko.pl/demot/0_0_375827185_McDonald_vs_KFC_przez_mamamniebije345_middle.jpg)
-
isnt it lada?
No. It is IZH http://upload.wikimedia.org/wikipedia/commons/thumb/2/21/Izh_2126.jpg/300px-Izh_2126.jpg
We call this car the coffin on wheels. It is very unsafe.
-
imho that driver on SUV should stay in prison forever
And i still can't understand why posting deadly crash accidents is so funny :blank:
-
this topic changed to Interesting Videos/Pictures long time ago just like Fucking Snow topic changed to overall weather discussion
-
very funny video
[youtube]3zegCK7LRlE[/youtube]
[youtube]YEKYeu_2ohU[/youtube]
-
very funny video
[youtube]3zegCK7LRlE[/youtube]
hot
-
Good to know that dispite the dancing, they are using seatbelts. Safety first.
btw the girl in the left in the video is like watching porn with clothes on
-
and condom on lolipops
-
LOOOOOOOOOOOOOOOOOOOOOL
[youtube]7PDeK6rprA4[/youtube]
[youtube]zz-Lupbn7mc[/youtube]
[youtube]x7A5xfZgBz8[/youtube]
-
genius!
-
lol how's that possible :o
-
reading the comments was hilarious, top notch troll.
2nd one should work on superconductors tho :O (jk)
-
Haha, he does a good job of hiding how he really gets them to work. I can imagine lots of 10 year old kids trying these tricks right now lool. :L
-
[youtube]http://www.youtube.com/watch?v=K0OrZobhSQE[/youtube]
[youtube]http://www.youtube.com/watch?v=PHnt56NewQs&feature=relmfu[/youtube]
ahaha wtf :L
-
(http://i.imgur.com/7T79j.jpg)
-
NSFW VIDEOS
[youtube]HFHjwuXxBn0[/youtube]
[youtube]Tr-ZvfxnAnw[/youtube]
[youtube]wn-RYsrUy-0[/youtube]
[youtube]PTScpAaBE14[/youtube]
-
(http://www.joemonster.org/i/e/jak_przylap01.jpg)
(http://www.joemonster.org/i/e/jak_przylap02.jpg)
(http://www.joemonster.org/i/e/jak_przylap03.jpg)
(http://www.joemonster.org/i/e/jak_przylap04.jpg)
-
OH GOD, I'M DYING OF LAUGHTER HERE!! :L :L
[youtube]http://www.youtube.com/watch?v=b5phzWW2Bmw[/youtube]
-
0:54 i came
-
Haha it's really funny, and he is totally right :L
-
[youtube]8t_Us159gSA[/youtube]
[youtube]yuZJAC911Tc[/youtube]
[youtube]HaYWGwHIQYU[/youtube]
[youtube]Hq-qrByDreQ[/youtube]
[youtube]aYIczu0waMk[/youtube]
[youtube]royv-0PozbM[/youtube]
-
(http://i.imgur.com/EP7jS.gif)
(http://i.imgur.com/sj8Jx.gif)
(http://i.imgur.com/QtJx2.gif)
-
it was a good simulation
http://www.youtube.com/watch?v=_gYNkMzZM3s
-
nice idea lol
[youtube]http://www.youtube.com/watch?v=ISEGDWpKAeY[/youtube]
-
[youtube]http://www.youtube.com/watch?v=qnT8hICaiNM[/youtube]
:L
-
nice idea lol
[youtube]http://www.youtube.com/watch?v=ISEGDWpKAeY[/youtube]
reminds me of Ferdinand GT3:
[youtube]http://www.youtube.com/watch?v=GaQB_tgS7f0[/youtube]
-
yeah, it's made by the same guys
[youtube]http://www.youtube.com/watch?v=qnT8hICaiNM[/youtube]
:L
haha best scene :L
-
http://raz.z0r.de/L/z0r-de_3814.swf
-
(http://img822.imageshack.us/img822/8606/29706749001351434269182.jpg) (http://imageshack.us/photo/my-images/822/29706749001351434269182.jpg/)
-
:L :L
-
http://raz.z0r.de/L/z0r-de_3814.swf
? da fuq razzor
-
http://raz.z0r.de/L/z0r-de_3814.swf
? da fuq razzor
Oh god , I've just clicked on the link , AND IT SCARED THE SHIET OUT OF ME!
-
swf = I will never open those links
-
wat
(http://i.imgur.com/KmfOX.png)
-
omg she plays CS for Pi years
-
lol 338 hours is exactly 14 days, does she/he ever sleep? :L
-
actually 14days is 336hours....
-
2 weeks are 15 days on steam, that guy must be idling 24/7 lol
-
actually 14days is 336hours....
whatever..
-
I wish I knew how many hours I've spend on Ax server. must be damn much, lol
-
few k for each of us at least i think
-
there has to be some way to find out lol
-
only assuming we would still have logs from day 1, then many interesting things would be possible to be found out, but unless moo, R or pod has complete backups, they're gone.
-
LOL read it all
http://forum.bodybuilding.com/showthread.php?t=120921191
-
:L :L :L :L :L :L :L :L :L :L :L :L WTF DID I READ LMAO
-
WTF DID I READ LMAO
-
poor guy ( if not trolling) :L
-
I feel sorry for him. :-\
-
lol so thats what they listen in korea
[youtube]9bZkp7q19f0[/youtube]
-
haha :L
-
lmao :L
-
[youtube]http://www.youtube.com/watch?v=qKLGaT08M4s[/youtube]
[youtube]http://www.youtube.com/watch?v=YnFtvx1ujg8[/youtube]
[youtube]http://www.youtube.com/watch?v=ZBvLswh2gYM[/youtube]
[youtube]http://www.youtube.com/watch?v=0IHbE1ae_vk[/youtube]
-
lol so thats what they listen in korea
[youtube]9bZkp7q19f0[/youtube]
haha yeah, this shit is epic :L
-
[youtube]http://www.youtube.com/watch?v=3LxtO_vMokk&feature=share[/youtube]
I would back the fuck up as well haha
-
lmfao I saw that yesterday, epic win
-
LOL read it all
http://forum.bodybuilding.com/showthread.php?t=120921191
Haha, I remember that, one of the true internet classics. :L
-
LOL read it all
http://forum.bodybuilding.com/showthread.php?t=120921191
Haha, I remember that, one of the true internet classics. :L
:L i knew what it would be before i clicked
-
[youtube]http://www.youtube.com/watch?v=3LxtO_vMokk&feature=share[/youtube]
I would back the fuck up as well haha
I would have run over the asshole
-
^
[youtube]http://www.youtube.com/watch?v=epVDutrGlDU&feature=g-vrec[/youtube]
-
[youtube]http://www.youtube.com/watch?v=jzbLTS_eg5c[/youtube]
-
looooooooooool his face should have been splatted over the windshield instead of the beer. wasting beer...
-
reddit.com/r/gifsounds compilation of Gifs with sounds added to them!
[youtube]http://www.youtube.com/watch?v=KR0EHW6IpSw[/youtube]
-
this guy ftw lol
(http://i.imgur.com/NXGAL.jpg)
(http://i.imgur.com/afgpA.jpg)
(http://i.imgur.com/omaCF.jpg)
(http://i.imgur.com/ZwAV6.jpg)
(http://i.imgur.com/fflol.jpg)
(http://i.imgur.com/28zJn.jpg)
(http://i.imgur.com/J2naU.gif)
(http://i.imgur.com/dk83C.gif)
(http://i.imgur.com/mPmtl.gif)
(http://i.imgur.com/seSan.gif)
(http://i.imgur.com/3iXf0.gif)
-
this guy ftw lol
(http://i.imgur.com/NXGAL.jpg)
wtf my father!!
-
(http://i.imgur.com/mPmtl.gif)
Final Destination!
-
(http://img4.imageshack.us/img4/7198/54734636718378335243114.jpg) (http://imageshack.us/photo/my-images/4/54734636718378335243114.jpg/)
-
(https://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-ash4/381014_434708909904742_797516388_n.jpg)
(https://fbcdn-sphotos-h-a.akamaihd.net/hphotos-ak-snc6/262247_434583303250636_374241879_n.jpg)
-
I'm lawful evil lol and a bit of chaotic neutral
-
in the eyes of the adrenaline x i'm all chaotic evil xD
-
And now I got mixed feelings...
According to the anniversary of this event, this joke may be taken badly...
but from other hand this nearly 'killed' me when seen...
So.. I'm spoilering it, even tho I don't think it is NSFW:
[spoiler](http://www.chamsko.pl/demot/0_0_1832995144_Z_okazji_nadchodzacej_rocznicy_przez_geraltsw_middle.jpg)[/spoiler]
-
lmao
[youtube]http://www.youtube.com/watch?v=6hgeKJaByeY[/youtube]
-
[youtube]http://www.youtube.com/watch?v=t41sITT4ap8&feature=related[/youtube]
-
http://www.youtube.com/watch?v=SIaFtAKnqBU
-
(http://i.imgur.com/5r0gi.jpg)
-
(http://a7.sphotos.ak.fbcdn.net/hphotos-ak-prn1/74840_10151462236296164_192828576_n.jpg)
-
[spoiler=NSFW!][youtube]http://www.youtube.com/watch?v=cs1j-iZc34g[/youtube][/spoiler]
-
27 seconds of fun ;D
[youtube]http://www.youtube.com/watch?v=blgM0En-aXA&feature=player_embedded[/youtube]
-
haha the end
-
(https://fbcdn-sphotos-a-a.akamaihd.net/hphotos-ak-ash4/423905_365971083477216_1240094358_n.jpg)
-
daaaamn thats hard choice,
after long time i would chose Megadeth in this case tho....
-
Mustaine Solos > Kirk Solos
-
[spoiler=nsfw](http://cdn.motinetwork.net/demotivationalposters.org/image/demotivational-poster/1107/the-all-time-question-fap-sex-boobs-girl-woman-demotivational-posters-1310721686.jpg)
:L :L :L :L[/spoiler]
-
How girls think they walk
,
,
,
,
,
http://bit.ly/Plcsob
,
,
,
,
How guys think they walk
:
http://bit.ly/TWa4Zo
’
’
’
’
’
That's how me and my friends walk
:
http://bit.ly/U5WSQb
lol :):'(</
-
lol
-
lol
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=ND9jVZPG75E#![/youtube]
-
[youtube]http://www.youtube.com/watch?v=_teWrMLL8S4&feature=player_embedded[/youtube]
-
http://cultso.com/artist-takes-every-drug-known-to-man-draws-self-portraits-after-each-use/
-
already seen it somewhere, it's pretty sick lol
-
(http://i.imgur.com/vPyfN.gif)
-
Lmao
(https://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-snc6/228836_354538614632944_146441520_n.jpg)
-
(http://www.chamsko.pl/demot/0_0_542237496_zlodziej_przez_dreutanaza_middle.jpg)
-
(http://www.chamsko.pl/demot/0_0_542237496_zlodziej_przez_dreutanaza_middle.jpg)
dafuq lol
-
lol
[youtube]http://www.youtube.com/watch?v=ZDnFNUqf3hg[/youtube]
-
(http://i45.tinypic.com/bja4c8.jpg)
-
:L
(http://i.imgur.com/V1M3q.jpg)
-
(http://git.pl/resource_image/git.pl-8103.gif)
new sig for cysio
-
słyszałem o tym wypadku w wiadomosciach chyba 2 dni temu :D
-
(http://git.pl/resource_image/git.pl-8103.gif)
new sig for cysio
lucky guy :L :L
-
mooman spotted in iraq
[youtube]http://www.youtube.com/watch?v=WbGNbd-GpOM[/youtube]
-
That's so not funny that it's actually funny.
-
i'm glad i made you smile :D
-
:)
-
mooman spotted in iraq
[youtube]http://www.youtube.com/watch?v=WbGNbd-GpOM[/youtube]
loool
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=PoI-fJJ4_Jo[/youtube]
:L
-
haha!
……………………………………..________
………………………………,.-‘”……………….“~.,
………………………..,.-”……………………………..“-.,
…………………….,/………………………………………..”:,
…………………,?………………………………………………\,
………………./…………………………………………………..,}
……………../………………………………………………,:`^`..}
……………/……………………………………………,:”………/
…………..?…..__…………………………………..:`………../
…………./__.(…..“~-,_…………………………,:`………./
………../(_….”~,_……..“~,_………………..,:`…….._/
……….{.._$;_……”=,_…….“-,_…….,.-~-,},.~”;/….}
………..((…..*~_…….”=-._……“;,,./`…./”…………../
…,,,___.\`~,……“~.,………………..`…..}…………../
…………(….`=-,,…….`……………………(……;_,,-”
…………/.`~,……`-………………………….\……/\
………….\`~.*-,……………………………….|,./…..\,__
,,_……….}.>-._\……………………………..|…………..`=~-,
…..`=~-,_\_……`\,……………………………\
……………….`=~-,,.\,………………………….\
…………………………..`:,,………………………`\…………..__
……………………………….`=-,……………….,%`>–==“
…………………………………._\……….._,-%…….`\
……………………………..,<`.._|_,-&“…………….`\
-
http://www.youtube.com/watch?v=Iiyj0Bh44iw
-
[youtube]http://www.youtube.com/watch?v=f6ZSZbNfSpk[/youtube]
LOL
-
lool
-
[youtube]http://www.youtube.com/watch?v=Gn-cYNVFRfs&feature=g-user-lik[/youtube]
-
use the id: Gn-cYNVFRfs , between watch?v= and &feature.
-
it is between :L
-
use http instead of https and it'll be fine
-
you're right, thanks :D
-
(http://i49.tinypic.com/2i12g6v.jpg)
(http://www.chamsko.pl/demot/0_0_460217316_podobne_jak_dwa_walki_tluszczu_przez_tatanka88_middle.jpg)
-
can be nsfw
http://i153.photobucket.com/albums/s223/Jbrizzel/Random%20Stuff/re6lol.jpg
-
lolete :L
[youtube]http://www.youtube.com/watch?v=snKbU5r0pBo&feature=player_embedded[/youtube]
(http://i.imgur.com/fj4eK.jpg)
[youtube]http://www.youtube.com/watch?v=GqJmP7PcaUw&feature=player_embedded[/youtube]
-
haha ;D
-
haha!
[youtube]http://www.youtube.com/watch?v=yoNmdAQkH8A[/youtube]
-
wtf :o
-
wtf :o
-
[youtube]http://www.youtube.com/watch?v=AWQyQ_A6JCM&feature=g-logo-rec[/youtube]
in Peru , i'll do something :o For FREE INTERNET :L
-
[youtube]http://www.youtube.com/watch?v=2zPiQgUQt3E&feature=player_embedded#![/youtube]
[youtube]http://www.youtube.com/watch?v=Nw6g8op_Dz8&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=ceVlltPBcHg&feature=player_embedded[/youtube]
-
[youtube]http://www.youtube.com/watch?v=sNOJ0R6C88Q[/youtube]
[youtube]http://www.youtube.com/watch?v=zjKJW7PxMJg[/youtube]
i love videos from him:
[youtube]http://www.youtube.com/watch?v=PiZgSXfN-BA&list=FLO_GNooxDNzt_FU0QCmrszw&index=3&feature=plpp_video[/youtube]
[youtube]http://www.youtube.com/watch?v=UAJN_8c_RKs&list=FLO_GNooxDNzt_FU0QCmrszw&index=4&feature=plpp_video[/youtube]
[youtube]http://www.youtube.com/watch?v=5F1o1BrXP1A&list=FLO_GNooxDNzt_FU0QCmrszw&index=1&feature=plpp_video[/youtube]
and as always have a nice day :D
-
[youtube]http://www.youtube.com/watch?v=F-CgeFsIdVE&feature=g-u-u[/youtube]
-
NO RAMMING ALLOWED
[youtube]http://www.youtube.com/watch?v=QdCDkfEKkUI&feature=related[/youtube]
-
lol, that track looks like made by msd or zole (1st turn!)
-
haha
-
lol, that track looks like made by msd or zole (1st turn!)
haha yeah wtf, who makes a turn like that :L
-
i bet the racer who started first won the whole race :L
-
yes the whole race, can you win half races phobos? :L
-
:blank:
-
Funny commercial here in NL
[youtube]http://www.youtube.com/watch?v=U_GKaaWBYGc[/youtube]
-
[youtube]http://www.youtube.com/watch?v=tZhh3SWPCjg&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=-R-ilep55V8[/youtube]
Haa!!! Got ya, you dirty minds!!!
-
(http://dl.dropbox.com/u/20689087/Photos/2012-10-11%2017.20.54.jpg)
-
haven't seen many Segal jokes yet:
(http://www.chamsko.pl/demot/0_0_199410619_ktora_godzina_przez_dexdexter_middle.jpg)
(http://www.chamsko.pl/demot/0_0_2146663641_Spray_na_suczki_przez_geraltsw_middle.jpg)
lol /b at 4chan always owns everyone.... (beware, i added as spoiler, you are looking at it on your own risk)
[spoiler](http://www.chamsko.pl/demot/0_0_1912904182_Deska_przez_tatanka88_middle.jpg)[/spoiler]
-
lol /b at 4chan always owns everyone.... (beware, i added as spoiler, you are looking at it on your own risk)
[spoiler](http://www.chamsko.pl/demot/0_0_1912904182_Deska_przez_tatanka88_middle.jpg)[/spoiler]
That's really a nasty NSFW. Still hilarious (Not for sensitive people!)
-
not funny but interesting
[youtube]http://www.youtube.com/watch?v=DF7WUe9nNdI&feature=player_embedded#![/youtube]
-
lol /b at 4chan always owns everyone.... (beware, i added as spoiler, you are looking at it on your own risk)
[spoiler](http://www.chamsko.pl/demot/0_0_1912904182_Deska_przez_tatanka88_middle.jpg)[/spoiler]
That's really a nasty NSFW. Still hilarious (Not for sensitive people!)
thats funny until you think how it actually happened
-
yeah lol, i wondered what could happen
-
(http://www.chamsko.pl/demot/0_0_1517282133_ZERO_CZARNYCH_KLAWISZY_przez_tatanka88_middle.jpg)
NSFW
[spoiler](http://www.chamsko.pl/demot/0_0_982307483_HALLOWEEN_przez_tatanka88_middle.jpg)[/spoiler]
top secret NASA found out how UFO is powered:
[youtube]http://www.youtube.com/watch?v=CuHin8bNDtc&feature=player_embedded[/youtube]
-
(http://i50.tinypic.com/21b57go.jpg)
(http://i46.tinypic.com/16716r4.jpg)
(http://i49.tinypic.com/21bkeqf.jpg)
-
(http://i49.tinypic.com/21bkeqf.jpg)
nick minaj would be better for this
-
next syg for cysio:
(http://www.chamsko.pl/demot/0_0_1650027362_Ja_nie_dam_rady_przez_geraltsw_middle.gif)
-
well that one is quite funny :L
-
next syg for cysio:
(http://www.chamsko.pl/demot/0_0_1650027362_Ja_nie_dam_rady_przez_geraltsw_middle.gif)
nice but not good for sign on this forum :(
it cutting down part and ruins everything
-
to someone who understand french, is this correct, warning may be NSFW
[spoiler](http://www.chamsko.pl/demot/0_0_1306720430_Slownik_francuskiego_przez_geraltsw_middle.jpg)[/spoiler]
-
lol
-
Funny thing would be if someone remind of my birthday in Oct 16 without reading this post
-
(http://www.embarrassingnightclubphotos.com/Photos/Thumb/1409121694757.jpg)
-
Funny thing would be if someone remind of my birthday in Oct 16 without reading this post
(https://i.chzbgr.com/completestore/12/7/30/JXAxRF8qxkylEYCQmQRktQ2.jpg)
-
[youtube]http://www.youtube.com/watch?v=jby0I-zLj9c[/youtube]
-
[youtube]http://www.youtube.com/watch?v=1gl7xr5rftc[/youtube]
-
lol
-
(http://www.chamsko.pl/demot/0_0_126332094_Spizgana_koza_przez_wieczar_middle.jpg)
-
LOL
-
can someone please explain
(NSFW)
http://www.youtube.com/watch?v=Sk5cdG5p-24
-
video deleted...
-
[youtube]http://www.youtube.com/watch?v=6FWUjJF1ai0[/youtube]
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
-
(https://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-ash3/550137_283809671736720_1668931536_n.jpg)
-
ye and this:
Keith Richards 1992
(http://www.top40db.net/img/artist/8638.jpg)
Keith Richards 2012
(http://3.bp.blogspot.com/-rJTiPc7O03c/T1ft_c0kDyI/AAAAAAAACpY/fFlj7GlaScI/s400/68cf104cbeab4101e28881ef8fa9796b.jpg)
-
can someone tell me the fun factor of the previous 2 posts :L
-
:L
-
can someone tell me the fun factor of the previous 2 posts :L
only fat Axl Rose lol
-
(http://www.chamsko.pl/demot/0_0_217644945_Walek_przez_xxxcyrulxxx_middle.gif)
NSFW?[spoiler](http://www.chamsko.pl/demot/0_0_1725271942_Niewidzialny_czlowiek_przez_geraltsw_middle.gif)[/spoiler]
-
LMAO!! :L :L
-
can someone tell me the fun factor of the previous 2 posts :L
If me and MadMax had put some Rap joke, Ush would understand... damn I miss you guys :(
-
:L :L
(http://i.imgur.com/1LlNY.gif)
-
LOOOOOOOL :L :L :L :L :L :L
-
Hahahah Genius :L :L
-
Haha, well edited. :L
-
Ha
-
(http://www.chamsko.pl/demot/0_0_1210363737_SOULS_przez_mamamniebije345_middle.jpg)
(http://www.chamsko.pl/demot/0_0_1934245164_Stop_rasizmowi_przez_geraltsw_middle.jpg)
-
[youtube]http://www.youtube.com/watch?v=osfEQTR-45M[/youtube]
-
[youtube]http://www.youtube.com/watch?v=RIuAZThCooU&list=FLO_GNooxDNzt_FU0QCmrszw&index=2&feature=plpp_video[/youtube]
[youtube]http://www.youtube.com/watch?v=cpyavVfcuzQ&list=FLO_GNooxDNzt_FU0QCmrszw&index=1&feature=plpp_video[/youtube]
-
Tesco video is best one I have seen in a while. :L
(http://images.4chan.org/b/src/1350981418343.gif)
-
Hahahha :L
-
I think this is SFW enough (it's on YT) so no spoiler (add if you think it should)
https://www.youtube.com/watch?v=KAQhG59zqZc
PS tried to embed but said wrong YT link
-
at 1:08, definitely gay :L
-
:L :L :L
[youtube]http://www.youtube.com/watch?v=uBPi2D0P_wU[/youtube]
-
hahaha
-
(https://fbcdn-sphotos-a-a.akamaihd.net/hphotos-ak-prn1/22584_10151308995918453_450867620_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=jipWoOXWIEU[/youtube]
lol
-
(https://fbcdn-sphotos-b-a.akamaihd.net/hphotos-ak-ash3/22786_434138366645882_2107180448_n.jpg)
(http://images.uncyc.org/pt/1/1e/Bin.gif)
(http://images.uncyc.org/pt/f/f1/Humor_photos12312341.jpg)
(http://images.uncyc.org/commons/b/b4/Not_Japanese.jpg)
Tommy Vercetti?
(http://images.uncyc.org/pt/thumb/c/cd/Tony_montana_coke.jpg/200px-Tony_montana_coke.jpg)
-
[youtube]http://www.youtube.com/watch?v=jipWoOXWIEU[/youtube]
lol
music
[youtube]http://www.youtube.com/watch?v=CMc4Y0yLa-k[/youtube]
:L
-
[youtube]http://www.youtube.com/watch?v=jipWoOXWIEU[/youtube]
lol
hahahahahhaha such a classic lol. still makes me laugh at how MikeGT thought I was from Argentina :L
-
look at her brother :L
[youtube]http://www.youtube.com/watch?v=9dHqy8mnDso&feature=plcp[/youtube]
-
hahaha
-
LOOL
-
oh 4chan
http://baldforbieber.com/ go photos page
-
oh 4chan
http://baldforbieber.com/ go photos page
wtf is that for real? :L
-
yeah
-
[youtube]L8m44UcO-RA[/youtube]
-
not sure if it's Poland, some people say it's Belgium (germany xD)
[youtube]http://www.youtube.com/watch?v=IhlKHgORrgM[/youtube]
[youtube]http://www.youtube.com/watch?v=TlhkOOr6u0k[/youtube]
-
:o
-
not sure if it's Poland, some people say it's Belgium (germany xD)
[youtube]http://www.youtube.com/watch?v=IhlKHgORrgM[/youtube]
lol you see everybody chewing (sign of ecstacy use), well it's not surprisingly that everyone is on x there, that is a fact at such parties (have been to such a party myself, one time)
-
An auction for a packet of Walker's Salt and Vinegar crisps has reached £4.70. :-\
Q: Hi mate, any chance I could come and view the item? I will pay cash (up to the value of the highest bid) if the packet is to my satisfaction?
A: I'm chocker mate, just shoot into tesco and have a look at a similar bag. They are the same except they have been volleyed round my bedroom
http://www.ebay.co.uk/itm/330819543400
4 days remaining. :o
-
eurozone situation - explanation
http://cha.lt/video/nevykeliai/236659-euro-zonos-krizes-paaiskinimas.html
also, this
http://www.youtube.com/watch?v=UCjkd7zDB28
-
dafuq is that movie :L
-
[youtube]http://www.youtube.com/watch?v=O2635quVnI8[/youtube]
[youtube]http://www.youtube.com/watch?v=ZpQBaj8m6pc[/youtube]
-
Snoopy look on page 477 ::)
-
An auction for a packet of Walker's Salt and Vinegar crisps has reached £4.70. :-\
Q: Hi mate, any chance I could come and view the item? I will pay cash (up to the value of the highest bid) if the packet is to my satisfaction?
A: I'm chocker mate, just shoot into tesco and have a look at a similar bag. They are the same except they have been volleyed round my bedroom
http://www.ebay.co.uk/itm/330819543400
4 days remaining. :o
even better, WHAT THE HELL!?!
http://www.ebay.co.uk/itm/Walkers-Tomato-Ketchup-Flavour-Potato-Crisps-32-5g-48-Bags-Full-Box-/180992183033?pt=UK_Home_Garden_Food_SM&hash=item2a23f98af9
-
lol wtf why would you buy crisps on ebay..
-
lilrunty that price is okay because you get 48 bags of a rare flavour.
-
BUT STILL, they're not that rare lol
http://groceries.asda.com/asda-estore/catalog/sectionpagecontainer.jsp?skuId=32560&departmentid=1214921923714&aisleid=1214921924266&startValue=&referrer=cookiesDetecting
-
I bought a 12 pack of Quavers from Ebay once because I couldn't be arsed to leave the house. Like 5 years ago
-
Snoopy look on page 477 ::)
I'm on page 716. I hope you are joking :L
-
haha
(http://i.imgur.com/NXBmH.jpg)
-
(http://i.imgur.com/NXBmH.jpg)
(http://www.newsbiscuit.com/wp-content/uploads/2011/03/362-man-on-phone3.jpg)
Hello? Is this the Krusty Krab?
-
don't know where to put this, what you're listening to now or here, I'll post here :L
[youtube]http://www.youtube.com/watch?v=5grN83P-jC4[/youtube]
-
http://www.tomshardware.com/news/Sony-France-PS-Vita-Ad-Boobs-Four-breasted-woman,18879.html#xtor=RSS-181
-
(http://i1175.photobucket.com/albums/r629/j4est/1246272566_50cent_slips_zpsb6e86e53.gif)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=6p_RrIA_Alc[/youtube]
-
Lmao creepy
-
(http://cdn3.whatculture.com/wp-content/uploads/2012/11/GTA-Meme-3-480x300.png)
-
More like AX logic lol
-
[youtube]http://www.youtube.com/watch?v=BnSKonxNx1c&feature=player_embedded#![/youtube]
-
^Good bit starts at 0:32 :L (for you lazy skippers like me)
-
We did that on school :L
haha fun times
-
http://www.youtube.com/watch?v=yTCRwi71_ns&feature=related
-
:L
-
(http://i.imgur.com/ENoB6.jpg)
-
[youtube]tpz14AyUV4M[/youtube]
-
(http://cdn.memegenerator.net/instances/400x/29642623.jpg)
-
(http://www.chamsko.pl/demot/0_0_1074750191_chicken_przez_Ketrel_middle.jpg)
-
[youtube]tpz14AyUV4M[/youtube]
how to hunt fox in russian style, you will need: Snickers = 1unit, Hunter = 1unit, Russia = 1unit
-
Probaly re-post
(https://fbcdn-sphotos-b-a.akamaihd.net/hphotos-ak-ash3/604019_543843708975001_947658077_n.jpg)
-
(http://i45.tinypic.com/f9fmkg.jpg)
-
[youtube]http://www.youtube.com/watch?v=WOlpdd7y8MI[/youtube]
-
epic
[youtube]http://www.youtube.com/watch?v=l2BE0ArUMOc[/youtube]
-
loooool :L
-
So cool. :L
-
epic
[youtube]http://www.youtube.com/watch?v=l2BE0ArUMOc[/youtube]
fake
[youtube]nzN2dxDOj-I[/youtube]
-
Never mind. :(
(http://24.media.tumblr.com/tumblr_lelllnhlhb1qej8gyo1_500.jpg)
(http://pics.blameitonthevoices.com/112011/small_jimmy%20wales%20on%204chan.jpg)
-
http://www.youtube.com/watch?feature=player_embedded&v=QdpGd74DrBM
-
Not saying it is fake, but that could be faked in like an hour. You don't even need a touchscreen. You could just make a slideshow of two images full screen on your laptop, and switch slides using the arrow key with your right hand every time you place your finger on the screen.
LOL at top comment:
Remember that time we tried to start controversy by posting a video about machines altering votes and Obama won?
-
(http://i.imgur.com/vU7fG.gif)
-
(http://i46.tinypic.com/szzi40.jpg)
-
:L
-
(http://i46.tinypic.com/szzi40.jpg)
pretty old but still funny :L :L :L :L
-
(https://fbcdn-sphotos-d-a.akamaihd.net/hphotos-ak-ash3/521640_441421792587057_1026673099_n.jpg)
-
:L
-
(http://i.imgur.com/vU7fG.gif)
WHAT THE HELL IS THAT?
-
A tarantula.
-
No, it isn't a tarantula, it is trap-door spider
(http://www.animalcorner.co.uk/venanimals/graphics/trapdoor.jpg)
-
Fucking hell lol!
-
OMFG, its legs and fucking huge!
-
needs strong legs, they usually dig a hole in ground,
normal spiders arent able to do that
dont forget that their lairs are usually very deep
(http://mw1.merriam-webster.com/art/dict/trapdoor.gif)(http://www.lloydlibrary.org/kids/Bass_trapdoor_spider.jpg)
and keep on mind it isn't a big spider afterall
(http://i165.photobucket.com/albums/u51/buzzmcmanus/Spiders/P1000143.jpg)
-
But where do they live max? (country)
-
can't tell, coz there are many diffrent species (around 130 or so) and diffrent ones in diffrent areas
from asia to australia, america to africa and even south europe
-
(http://uppix.net/1/0/a/c485bff053b7d04852bdc6ce4e2dbtt.jpg)
-
lmao
-
lol O___o
-
/me puts one under his laptop lid for extra protection
-
(http://www.czeta.it/wp-content/uploads/2012/11/5790841_700b_v1-490x2191.jpg)
-
:)
-
http://www.360cities.net/image/football-serbia-france-choreography#577.49,7.98,20.0
-
(http://i45.tinypic.com/30cq72c.jpg)
-
http://www.staggeringbeauty.com/
-
(http://i.imgur.com/oYrQO.jpg)
:L
-
http://www.staggeringbeauty.com/
dafuq!
-
[youtube]http://www.youtube.com/watch?v=KBARvn3eJuo&feature=g-logo-xit[/youtube]
-
(https://fbcdn-sphotos-a-a.akamaihd.net/hphotos-ak-ash4/306836_446380645424505_751873694_n.jpg)
-
(https://fbcdn-sphotos-b-a.akamaihd.net/hphotos-ak-snc7/579212_392634377435478_961474216_n.png)
-
^ rofl
-
^ :L
Transferring readme.txt (7kb)... Estimated time remaining 18 hours and 18 minutes...
-
https://www.youtube.com/watch?v=A-b2YNErwxw&feature=player_embedded
I panicked at 0:41 :O
-
[youtube]http://www.youtube.com/watch?v=AXz4P6EpX3s&feature=g-u-u[/youtube]
-
(https://fbcdn-sphotos-c-a.akamaihd.net/hphotos-ak-ash4/406400_325015677596209_66905893_n.jpg)
-
https://www.youtube.com/watch?v=A-b2YNErwxw&feature=player_embedded
I panicked at 0:41 :O
I lol'd. :L
Has subtitles for non-French people btw.
-
how about a magic trick?
(http://i1.kwejk.pl/site_media/obrazki/2012/11/5b0ece57a4bdd0fe0049d8b6a94cbb50_original.gif?1352496879)
may be nsfw (basterd killed a bird :-X)
[spoiler](http://i1.kwejk.pl/site_media/obrazki/2012/11/f04f51bca841460a2925713f93c89519_original.gif?1352462925)[/spoiler]
(http://i1.kwejk.pl/site_media/obrazki/2012/11/093b4ee180bef68e1f17f3a02719f17a_original.gif?1352460925)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/3de9b1a6e1935a1bfcc409f2ac034223_original.gif?1352567514)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/a7c5a68c9a13fcd3c97134fd9d1b66f5_original.jpg?1352729739)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/518d1f439692ba9bf6ec3a091f87ee0b_original.gif?1352729837)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/6f1cb5f5193836ad1c378561887ac1df_original.jpg?1352714968)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/edbba232bc2849c2c39f30360684ff24_original.jpg?1352648925)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/703ed3ccd96dcee81675d9550935ad20_original.jpeg?1352577911)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/f95dbf845e6da00a80b853a333299434_original.jpg?1352589499)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/6aca332e1b633f7738fe6fa9e714ec4a_original.jpg?1352551572)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/f6385f0816a4d93d784711451db26c4d_original.gif?1352523270)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/e595a82d0fee91d988fad1c7f3ef8970_original.png?1352497896)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/ea9a65d3195fbc9e61caa1fcc804cba9_original.jpg?1352457123)
-
nice :L
-
[youtube]http://www.youtube.com/watch?v=6R5QueuvKQ4[/youtube]
-
(http://i.minus.com/ibdyKDFqKDDqCV.gif)
-
lol
-
Haha, is that from a game?
-
(http://i.imgur.com/WRyLU.jpg)
i'm so famous :L
it's youtube bug, happens sometimes
-
Haha, is that from a game?
Yes its from Need For Speed Most Wanted
Btw you can test demo on PS3 http://www.needforspeed.com/demo?utm_source=www.youtube.com&utm_medium=marketing&utm_campaign=nfs_ytdescrip-demo-launch-trailer-demo-page&sourceid=nfs_ytdescrip-demo-launch-trailer-demo-page
-
(http://i.minus.com/ibdyKDFqKDDqCV.gif)
:L :L wtf is that a mod or the real game?
-
(http://i.minus.com/ibdyKDFqKDDqCV.gif)
:L :L wtf is that a mod or the real game?
the real game, but its just a cutscene
-
[youtube]H_a0TzFx5hE[/youtube]
-
haha, i guess steam download has its advantages :L
-
[youtube]http://www.youtube.com/watch?v=eVXKKaWJTls[/youtube]
-
(http://img.acianetmedia.com/i/Rjvqt.gif)
-
lmao already
-
1st, bit long, but funny gif
(http://i1.kwejk.pl/site_media/obrazki/2012/11/20677a01c2b04f2a73111798a1f5bef8_original.gif?1352892405)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/cfa286fb59f9cb9677c11316e5396ac2_original.gif?1352807067)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/ee1c5384c5779fb32c751c9d6987c4c0_original.jpg?1352818418)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/01dc91376619807af2a47c7b9a7eb17f_original.gif?1352922823)
(http://kwejk.pl/obrazek/1523967/icoffee.html)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/ed46bafef6c3f14b3905d5a6b989e404_original.jpg?1352875107)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/d8ce120ef7aa33bef96429cb2de01918_original.jpg?1352890185)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/83361c8d7d103c52aca1cdcf7d4b6f2e_original.jpeg?1352893106)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/524ce9dc57a2bea1e82756c44fdce922_original.gif?1352812813)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/11/cfa286fb59f9cb9677c11316e5396ac2_original.gif?1352807067)
[youtube]http://www.youtube.com/watch?v=pDTNC_tquvk[/youtube]
lol
-
i remember it! :L
-
(http://i1.kwejk.pl/site_media/obrazki/2012/11/cfa286fb59f9cb9677c11316e5396ac2_original.gif?1352807067)
[youtube]http://www.youtube.com/watch?v=pDTNC_tquvk[/youtube]
lol
LMAO!! :L :L
after such a long time it still made me laugh :L
-
Haha I remember telling someone doing a djharley the other day. If I ever say it, this is what I mean!
-
(http://i1.kwejk.pl/site_media/obrazki/2012/11/68d328f062bd1ac84d401ed489182d5b_original.jpg?1353000523)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/df6f944bb23fea63f4eaafea2ee41d67_original.gif?1352978597)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/7b6993d029f0b18926da693000adb8ba_original.gif?1352977036)
(http://www.chamsko.pl/demot/0_0_73418529_Kula_do_kregli_przez_Ruslan_middle.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/266f58dc52dcae8f7b4cd0a486d0ab9b_original.jpeg?1352896108)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/0267896328b88617929d181fa809ff80_original.jpg?1352938810)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/4da555759b20f8e0be312718fd07231a_original.jpg?1352938811)
-
AdrenalineX admin meeting lol
(http://i.imgur.com/XHayR.jpg)
-
Woo, estonian language
-
ha
-
how can gen understand this
-
如何理解的語言
-
[youtube]http://www.youtube.com/watch?v=sAuexTsAfaY&feature=player_embedded[/youtube]
[youtube]http://www.youtube.com/watch?v=fsmf8A2o06o&feature=player_embedded[/youtube]
-
lol
-
:L :L :L :L :L :L :L
(http://imagerz.com/QE9AWktvAwMABQ5KEgVT)
-
[youtube]http://www.youtube.com/watch?v=fsmf8A2o06o&feature=player_embedded[/youtube]
OMG lol'd hard.
@Sedici^: What is that from?
-
Jeremy strikes again
(http://i1.kwejk.pl/site_media/obrazki/2012/11/ed86479d6866a20d8675fcb0842c55f2_original.gif?1353055252)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/8b2c1acb9bd6f472a2f9d90727fe1bd8_original.jpg?1353057548)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/82cb13efa9ac3a7e45bd9195d10e7fdd_original.jpg?1353058346)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/07c19c7f1bb4de147260bce93a9b1459_original.jpg?1353063458)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/af393f3868371b890e5ddb37c33fec5d_original.jpg?1353064295)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/c37c8d0d8e9275fb21a1fe84342b7914_original.png?1353011464)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/ca0ba01f35d74d4244b9077ae3e557f0_original.gif?1353063151)
-
haha :L
-
(http://dl.dropbox.com/u/20689087/screens/ScreenCapture/SC20121012-202854.jpeg)
-
lmao
-
(http://3.bp.blogspot.com/-Y0mDzc3SEVo/UEdSNEt-JcI/AAAAAAAABe8/6T1sK2hGZ34/s1600/539184_333306380089886_1733293260_n.jpg)
(http://2.bp.blogspot.com/-8K_7LQ-UtWk/UEdQ9llMfCI/AAAAAAAABek/r48O5xEIdQ4/s1600/526632_329703003783557_813491586_n.jpg)
(http://1.bp.blogspot.com/-nfdc1rlYR50/UEdPph6wFAI/AAAAAAAABeM/PsYytWl_4JA/s1600/484132_322213161199208_1945120461_n.jpg)
(http://3.bp.blogspot.com/-X-gyKsgdzS8/UAzZTqd-p5I/AAAAAAAABZE/s9XkmXXV8P8/s1600/batman-small-car.jpg)
(http://2.bp.blogspot.com/-CxYUdrAqm48/T8sIicqXFJI/AAAAAAAAK0Y/pocBVO7u6Ug/s1600/take-breadth-in-and-let-it-out.jpg)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/11/5ed89895f6f62afea2670c6072d4b45c_original.jpg?1353160378)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/e0cb5ee5f8c03d667dc5825c86f8b9fb_original.jpg?1353160379)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/8bc58659fd1895d7b5c029a2aba2180a_original.jpeg?1353117540)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/f90a77b3502ab85aff2b08b32a294750_original.jpeg?1353068742)
-
thats a nasty joke!
(http://www.joemonster.org/i/e/trolling_01.jpg)
(http://www.joemonster.org/i/e/trolling_02.jpg)
(http://www.joemonster.org/i/e/trolling_03.jpg)
(http://www.joemonster.org/i/e/trolling_04.jpg)
(http://www.joemonster.org/i/e/trolling_05.jpg)
(http://www.joemonster.org/i/e/trolling_06.jpg)
(http://www.joemonster.org/i/e/trolling_07.jpg)
(http://www.joemonster.org/i/e/trolling_08.jpg)
(http://www.joemonster.org/i/e/trolling_09.jpg)
(http://www.joemonster.org/i/e/trolling_10.jpg)
(http://www.joemonster.org/i/e/trolling_11.jpg)
true badboy!
(http://www.chamsko.pl/demot/0_0_863460388_Wrocilem_suki_przez_xawery_middle.jpg)
-
hello dawg! :L
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=LXhnVuNHh9E[/youtube]
-
(https://fbcdn-sphotos-b-a.akamaihd.net/hphotos-ak-ash3/532282_438732009521910_2095523076_n.jpg)
-
true badboy!
(http://www.chamsko.pl/demot/0_0_863460388_Wrocilem_suki_przez_xawery_middle.jpg)
Here is reason why granpa wear that shirt
(http://i47.tinypic.com/2m2jhab.jpg)
-
(https://fbcdn-sphotos-b-a.akamaihd.net/hphotos-ak-ash3/561537_542794325749483_821224062_n.jpg)
-
(https://fbcdn-sphotos-b-a.akamaihd.net/hphotos-ak-ash3/12879_542385905790325_1579393836_n.jpg)
(https://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-ash4/483074_541593442536238_116002239_n.png)
(https://fbcdn-sphotos-b-a.akamaihd.net/hphotos-ak-prn1/63826_541089419253307_547168565_n.jpg)
(https://fbcdn-sphotos-a-a.akamaihd.net/hphotos-ak-prn1/67798_540737359288513_1522750713_n.jpg)
(https://fbcdn-sphotos-h-a.akamaihd.net/hphotos-ak-prn1/46229_538059596222956_708559563_n.jpg)
(https://fbcdn-sphotos-h-a.akamaihd.net/hphotos-ak-ash3/579191_537731969589052_691591985_n.png)
-
Lol good ones
-
sorry but this time small load
(http://www.chamsko.pl/demot/0_0_610526218_jak_go_nazwiemy__przez_dexdexter_middle.jpg)
(http://www.chamsko.pl/demot/0_0_701274064_Masz_ochote_na_jolka__przez_dexdexter_middle.jpg)
bless you!
(http://www.chamsko.pl/demot/0_0_837314674_Blogoslawienstwo_przez_xawery_middle.gif)
-
Wow Cthulu one is creepy lol.
-
same producer as the one in Friday, so shit :L
[youtube]ZSBq8geuJk0[/youtube]
-
(http://dl.dropbox.com/u/20689087/screens/ScreenCapture/SC20121012-202854.jpeg)
how do you make screenies with a smartphone? (I have the HTC One S, android jelly bean)
-
press and hold power and volume down buttons at same time, with good timing it snaps ss.
-
how do you make screenies with a smartphone? (I have the HTC One S, android jelly bean)
its different in each phone, on mine it was power + home buttons
-
Mine is swipe hand over screen
-
(http://img717.imageshack.us/img717/9845/53659230135981663026015.jpg) (http://imageshack.us/photo/my-images/717/53659230135981663026015.jpg/)
-
OH MY
-
The fun you can have with a couple of filters and a gullible redneck...
(http://i.imgur.com/rvQ7s.png)
-
[youtube]http://www.youtube.com/watch?v=9mHRwdN58qo&feature=share[/youtube]
-
(http://www.chamsko.pl/demot/0_0_581889752_I_kto_jest_mistrzem_przez_xawery_middle.gif)
(http://www.chamsko.pl/demot/0_0_968927583_Miales_sliczny_samochod_Miales_przez_xawery_middle.gif)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/7a483eefe12aa19bd4b6227a3d642a00_original.jpeg?1353599202)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/747aeb7a4115adf47fb2aa087453f8ae_original.jpeg?1353599322)
orgin of :3 face:
(http://i1.kwejk.pl/site_media/obrazki/2012/11/07b846f992ae7a343bfc3f612fd212ea_original.jpg?1353597607)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/d26fea1ceea407bf1d4485e3824478f1_original.jpg?1353585725)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/f0b4d3926c0b8e2984ff780e3aace0a3_original.jpg?1353578925)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/d9d84accca49a26a7c164a8daa94f5ef_original.gif?1353579340)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/7cba886daffc4ef7d9061b5654908488_original.jpeg?1353577472)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/5b81762fbbbd1e92a5976e0afff226f3_original.jpeg?1353523785)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/c27394927df90c803068e6f8ac0a4b8f_original.gif?1353523786)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/4529830adc03ad321bc7ec900eb01a1e_original.jpg?1353499452)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/3386d35bec4dc91d25cff50bc7300efc_original.png?1353491964)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/b7d1c9edcff7f09802f19987630c4382_original.jpeg?1353489362)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/5dd4154c270d2bb85c0d6267c40008e0_original.jpeg?1353504911)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/f583fb34f9093cc980c09d30ab69117a_original.jpg?1353492353)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/add362eb7338b24cb757978f1154553c_original.jpg?1353499254)
zajebisty pies
(http://i1.kwejk.pl/site_media/obrazki/2012/11/e240527794c4449b666a3c143dbdd661_original.gif?1353495785)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/40b9c307dd3afb6c37e35e4b126b3d6b_original.jpeg?1353440583)
-
(http://www.chamsko.pl/demot/0_0_581889752_I_kto_jest_mistrzem_przez_xawery_middle.gif)
dafuq :o
-
^I really hope that was staged lol.
-
Wait for it...
(http://i.imgur.com/sQFhM.gif)
-
(http://img513.imageshack.us/img513/3821/56164118876730124791581.jpg) (http://imageshack.us/photo/my-images/513/56164118876730124791581.jpg/)
-
(https://fbcdn-sphotos-e-a.akamaihd.net/hphotos-ak-ash3/522359_544567402238842_1070352144_n.png)
-
(http://i.imgur.com/g3y9F.jpg)
-
(http://img23.imageshack.us/img23/1233/profimontaz.jpg)
-
lmao
-
(https://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-ash3/179327_544647142230868_976370246_n.jpg)
(https://fbcdn-sphotos-c-a.akamaihd.net/hphotos-ak-ash3/68335_544287015600214_2082772909_n.jpg)
(https://fbcdn-sphotos-b-a.akamaihd.net/hphotos-ak-prn1/18302_543870698975179_1637548599_n.jpg)
A bit racist maybe
(https://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-ash3/532189_543864542309128_1006160077_n.png)
(https://fbcdn-sphotos-d-a.akamaihd.net/hphotos-ak-ash3/598510_543376465691269_658804151_n.jpg)
(https://fbcdn-sphotos-b-a.akamaihd.net/hphotos-ak-ash3/61187_543305382365044_564028305_n.jpg)
Chuck Norris' daughter
(https://fbcdn-sphotos-h-a.akamaihd.net/hphotos-ak-ash4/374416_543295599032689_407190350_n.jpg)
(https://fbcdn-sphotos-f-a.akamaihd.net/hphotos-ak-ash4/485028_542809662414616_825529384_n.jpg)
-
[youtube]gqZOqxk_xtI[/youtube]
-
^Actually lol'd
-
my new stats xD
(http://players.adrenalinex.co.uk/mmmpie.php?data=1337*1337*1337*1337*1337*1337*1337&label=Wins*Wins*Wins*Wins*Wins*Other*Finished)
-
(http://i.imgur.com/TbWQL.jpg)
-
my new stats xD
(http://players.adrenalinex.co.uk/mmmpie.php?data=1337*1337*1337*1337*1337*1337*1337&label=Wins*Wins*Wins*Wins*Wins*Other*Finished)
Yes, and this is mine :P
(http://players.adrenalinex.co.uk/mmmpie.php?data=1*2*3*4*5*6*7&label=You*Be*Lyin'*And*Cheatin'*Mo'*Fo')
-
the code has been cracked! :(
-
i beat dodger easily, thats a 200,000 win streak, beat it! :L
(http://players.adrenalinex.co.uk/mmmpie.php?data=200000*0*0*0*0*0*0*0*0*0&label=Wins*2nd*3rd*4th*5th*Other*Not_Finished)
-
(http://img19.imageshack.us/img19/2125/xcompsubsystemharddisk.jpg)
(http://i.imgur.com/pSs9n.gif)
-
Poor Ibra :L
(https://fbcdn-sphotos-a-a.akamaihd.net/hphotos-ak-prn1/73823_456676131034135_1437061187_n.jpg)
-
(http://sphotos-b.xx.fbcdn.net/hphotos-ash3/532159_374048069350301_1694433089_n.jpg)
-
1st a funny one, look carefully
(http://i1.kwejk.pl/site_media/obrazki/2012/11/0561b5ee45d2345d169850597df48c68_original.gif?1353707999)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/976c39f747b1d4365a1fed71c2fc11c1_original.jpeg?1353715031)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/de9a4cec70c86e4859c040165d902ba5_original.jpg?1353748579)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/745b6ebbc6bdb69af685f5f883888d65_original.jpg?1353750072)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/8db110aaa4ec80e0b0854c7ef69b6da3_original.gif?1353684786)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/3dc74d9ed39f2849f8238c7205126688_original.jpeg?1353697691)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/a565f23622dd84ffac80f28c8e0dc7f5_original.jpeg?1353746474)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/5324d8531e51ed4ec6f7496c65dba9d4_original.gif?1353747898)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/061e4f9bae1dce99782c5194532ef897_original.jpeg?1353754351)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/50dad7854b10a77b7ca1f271d23a3c80_original.jpeg?1353757487)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/53a2fb4e1aa585f30a1a28350fc4f1c2_original.gif?1353754599)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/9c68cbd15ef6b49d1f37413d83188ab9_original.gif?1353754602)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/6ed68d6c89740ecdfe865a96f62f35d2_original.jpg?1353698411)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/ebfa3976999297f043a8e7bfc69287fd_original.gif?1353754600)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/d2256cd900ec54032d5f3c0f2449a847_original.jpeg?1353751945)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/11/6ed68d6c89740ecdfe865a96f62f35d2_original.jpg?1353698411)
Haha nice.
-
(http://i1.kwejk.pl/site_media/obrazki/2012/11/ebfa3976999297f043a8e7bfc69287fd_original.gif?1353754600)
hah, Spaceballs ftw :D
-
[youtube]http://www.youtube.com/watch?v=UDUOgJL_B9A[/youtube]
[youtube]http://www.youtube.com/watch?v=h-oZTf04AhU[/youtube]
-
seems nsfw? but isn't, belive me, you dirty minded!
(http://i1.kwejk.pl/site_media/obrazki/2012/11/78e1a4c1b3eb52ad65326183215e3597_original.gif?1353879312)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/4c1109e4aed7cd16031db134045930d5_original.jpeg?1353796756)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/14bb6f134dc4392e540cb9f3c599eeca_original.gif?1353841594)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/1816996c3c92c58b84c9d6d20dbe3ac7_original.gif?1353841491)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/7acbca2e45b94f59a450deaf3def47aa_original.jpeg?1353838110)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/cee154e8a09d50f48ccdd130d58c3dab_original.jpg?1353884627)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/2da2e71cd9d44e2af0f0ddd32da517fb_original.gif?1353836579)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/05667d4e1f7ecd4790c270106c0139e5_original.png?1353891600)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/0ee4abbe43a5882d2daac706479d2f71_original.jpeg?1353840726)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/36b1546262b4c5c6c0c8104aec71fa6a_original.png?1353883220)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/0fedd9f507197b41a8ec234b4f75d300_original.jpeg?1353842740)
may be nsfw
[spoiler](http://i1.kwejk.pl/site_media/obrazki/2012/11/c0abebff50b2fb166d2df67c81015871_original.jpg?1353841460)[/spoiler]
-
owned, jesus :P
(http://i1.kwejk.pl/site_media/obrazki/2012/11/4c1109e4aed7cd16031db134045930d5_original.jpeg?1353796756)
-
(http://i.imgur.com/ZSG5P.gif)
(http://i.imgur.com/ynvQL.gif)
-
[youtube]http://www.youtube.com/watch?v=31D4MkCmHfs[/youtube]
LOL _:D
-
(http://i1.kwejk.pl/site_media/obrazki/2012/11/6d476f6321c73ca8bcbffbba557901f1_original.jpg?1354011380)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/22aa4d4284f44f5d05737a2e0cb2bca1_original.jpg?1353955848)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/f1d29dc7266b9ce71c86b7a085374253_original.jpeg?1353932888)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/68e6bce5a5c7bfbaf09b4d588b47c4a9_original.jpg?1353939772)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/2d0dc3bbc39065c90c2b92343ca46722_original.png?1353944991)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/968a85a4ee2a4960cf120869a01e8483_original.gif?1353932880)
sharktopus!
(http://i1.kwejk.pl/site_media/obrazki/2012/11/0191064850d8b21b8c5dca95bfd4aca0_original.gif?1353926130)
-
gifs don't work for me
-
hm have you tried upgrading to netscape navigator 2 or internet explorer 3?
-
didn't know where to post this so it will go here ;D
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=dOYg6yd1w-Q[/youtube]
-
I once convinced two ducks to come in the house by leaving a trail of breadcrumbs, but then I got worried they might poop on the floor so I made them go back out again.
-
I don't see why some people have a fear of them, I think they're lovely lol
-
LOLWUT I was trying to find this video I once saw of this guy who has ducks as pets, and I found this.
[youtube]Mkr81d13XLM[/youtube]
wtflol
Edit: Anyways, here's the video:
[youtube]FxZHAWfUfaQ[/youtube]
lol at 2:48
[youtube]xb57zcLuz9U[/youtube]
-
LMAO those are some huge ducks xD
EDIT: love to be able to do that, some chinese guy a few weeks ago killed a duck and took it home :(
-
http://www.nationalreview.com/corner/334155/kim-jong-un-sexiest-man-alive-katherine-connell
asslikcers, asslickers everywhere...
-
[youtube]http://www.youtube.com/watch?v=WAgt2vkRZWQ&feature=plcp[/youtube]
classic
-
be careful what you type!
(http://i1.kwejk.pl/site_media/obrazki/2012/11/95b2e80e4bb28ba60d44bf040602d375_original.jpg?1354097868)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/002cdaebca24dcc360cbee0eda81cd4e_original.jpeg?1354095684)
(http://i1.kwejk.pl/site_media/obrazki/2012/11/e2516fa806677fcda77e0771919dd008_original.jpeg?1354095135)
-
that was 15 dollars! :L
[youtube]http://www.youtube.com/watch?v=x4BHATYihT8[/youtube]
[youtube]http://www.youtube.com/watch?v=7Ij7l8vOaS8&feature=player_embedded#![/youtube]
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/5962977_700b.jpg)
-
(http://cs416328.userapi.com/v416328509/a6a/E6mINqWhKiU.jpg)
-
[youtube]http://www.youtube.com/watch?v=wSroTuycpFA[/youtube]
-
[youtube]P2Kn_y6X-iI[/youtube]
Wait for it :L
-
[spoiler=NSFW/NSFeyes](http://imagerz.com/QE9BXEtvAwMAA11KQwVR)[/spoiler]
-
oh god...
-
oh god...
-
[youtube]lg3aURzx6yA[/youtube]
-
(http://s3-ec.buzzfed.com/static/enhanced/webdr01/2012/11/15/11/enhanced-buzz-662-1352996126-5.jpg)
-
https://www.youtube.com/watch?feature=player_embedded&v=zcw0oRE_eo4#!
-
[youtube]http://www.youtube.com/watch?v=-YOlgTFhPkY[/youtube]
:L
-
^lol
(http://global3.memecdn.com/trevor_o_947422.jpg)
-
http://www.ajuaa.com/lookme/play.php?vid=7347
:P Fake or real?
-
(http://i1.kwejk.pl/site_media/obrazki/2012/12/d28bcf313a6371c2825eaa043d7e5588_original.jpeg?1354541715)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/b00609524569d10df2164b80f23448ae_original.jpg?1354701594)
[spoiler=NSFW](http://i1.kwejk.pl/site_media/obrazki/2012/12/3841507566d332d4852a187f62f7b9be_original.gif?1354788849)[/spoiler]
[spoiler=Sasha - 3some, can be NSFW lol](http://i1.kwejk.pl/site_media/obrazki/2012/12/3ec5d6f67194671f22577867be781b52_original.jpg?1354607271)[/spoiler]
[spoiler=remember this movie?](http://i1.kwejk.pl/site_media/obrazki/2012/12/4a46784ffb4469135ec908cb4b3321f4_original.gif?1354615280)[/spoiler]
[spoiler](http://i1.kwejk.pl/site_media/obrazki/2012/12/620c5dc1277354b891e272f5bac2cac1_original.jpg?1354378294)[/spoiler]
(http://i1.kwejk.pl/site_media/obrazki/2012/12/15a02cd1f8a6e42def05b99f4216ed2e_original.gif?1354546945)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/5510f4a77d35fe3fe114fe95dd200d84_original.jpg?1354538742)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/f430ba97b79aa798c671c65e867df26e_original.jpeg?1354358743)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/9051c824f330e71068e8067fa80c2714_original.jpg?1354533813)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/623285d2a28cf8ea7a787c2769f4b2b4_original.gif?1354445938)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/2872001361222a7c18762904d148d72b_original.jpg?1354508095)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/73f0e6d41a2903e42b9cd67d64a884ea_original.jpg?1354386437)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/674d3ec89081054ab1985131680f3792_original.jpeg?1354541897)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/21cfae62ef4ebdac8cbeb8a9634c46fe_original.gif?1354440206)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/fc2c116350bf7b46d213309532915832_original.jpg?1354547590)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/2cf785a64195e24edf9ecf8ede9ef382_original.png?1354466909)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/12687d4ac673af5c84327863ba670603_original.gif?1354613814)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/cf60b52313b67c3e8324935e23e786a8_original.jpg?1354487011)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/a71e6bca8b902a377a41a9b3f6811e31_original.jpg?1354531984)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/7b0f0b27a3ad0b6297303df8461e4238_original.jpeg?1354542953)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/fdc38de7ad6198f1716dc8717d854234_original.jpg?1354700451)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/7ce0adebc614acd48d7659e2db59997a_original.jpeg?1354671054)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/58115a302562dc6a37f8c4c020b02760_original.gif?1354671054)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/6c15e75ee2497a3266e1a7260beeda6a_original.gif?1354670086)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/b8937b511271d8893e44bde77e4d2386_original.jpg?1354654222)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/1aa347dcfdbf11744a7f5a4a46fdb143_original.jpeg?1354623454)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/f46196c3b852d52ce200d8044da1b7c2_original.png?1354615928)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/0ecfe67d5eae218c4d449eda8c86091d_original.jpg?1354632341)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/f7e082b29fb8dd64853684cb9bed60e6_original.jpeg?1354546943)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/49c3840346f7a7b93368c0a2591e556d_original.gif?1354547165)
-
[youtube]http://www.youtube.com/watch?v=LyieJp6EBMM[/youtube]
-
honey badger doesn't care. if it's hungry, it's hungry, runs backwards, honey badger don't care. it doesnt give a shit. it just takes what it wants
[youtube]http://www.youtube.com/watch?v=4r7wHMg5Yjg[/youtube]
-
[youtube]http://www.youtube.com/watch?v=LyieJp6EBMM[/youtube]
hahaha looool (it's dutch btw)
-
[youtube]http://www.youtube.com/watch?v=LyieJp6EBMM[/youtube]
hahaha looool (it's dutch btw)
yeah not everybody understands dutch, it's not funny at all if you can't understand...
-
(http://imagerz.com/QE9BUUtvAwMAAw9IFgVR)
-
(http://i1.kwejk.pl/site_media/obrazki/2012/12/c1a68c9124cd81b42319e9e422ea6048_original.jpg?1355135149)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/9653d5847b06b8e5e58fa26b327139e9_original.jpg?1355068005)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/68f2c54d26d795257d4d378d8551b74f_original.gif?1355064509)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/982e942f52d0fa22b4bc91d5bca814c7_original.jpg?1355067218)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/d37a4003115a5fc71c71a4c6e9ecbc36_original.gif?1355045699)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/4c9a20e7e2f0734538ee9d1c505c9879_original.gif?1355038480)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/b990aa5ce3d6f8f0cc8cf8eeb1dfab73_original.jpg?1355012293)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/18b85b05f8e65a51bff54555864547f2_original.jpg?1354975951)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/853b6909b91bba6ace2bbd09f0769afa_original.jpg?1354959212)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/d3e96c71eb4a54529ec1799356ea67cc_original.jpg?1354808609)
-
(http://img856.imageshack.us/img856/2275/72296502453909785354210.jpg) (http://imageshack.us/photo/my-images/856/72296502453909785354210.jpg/)
-
lol eatler
-
lool @ gotta catch 'em all :L
-
(http://i.imgur.com/6ECZE.jpg)
-
(http://i.imgur.com/PEVva.png)
-
bored there, all my entertiment is just surfing on the new, looking for funny images, so posting them, n-joy
(http://i1.kwejk.pl/site_media/obrazki/2012/12/342132aad013766a7b25a28d7b0a50ac_original.jpg?1355217059)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/f3d55bf3f5231761d62e44668ef623c0_original.jpg?1355219811)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/cf26555122d93bbd015eaecf4db32cbd_original.jpg?1355219307)
-
[youtube]http://www.youtube.com/watch?v=YInQ3-YsTro[/youtube]
[youtube]http://www.youtube.com/watch?v=1TmR8c3jMDc[/youtube]
[youtube]http://www.youtube.com/watch?v=58DmKw3nAaw[/youtube]
-
(https://i.chzbgr.com/maxW500/6823770880/h8386D67C/)
(https://i.chzbgr.com/maxW500/6807829504/h82B3277F/)
(https://i.chzbgr.com/completestore/12/11/30/DT004A5yzU2qf8FnagLb5w2.gif)
(https://i.chzbgr.com/completestore/12/11/21/u7WWY-hYuU-9G2bfwYe06Q2.gif)
(https://i.chzbgr.com/maxW500/6751904256/hC82FCF62/)
(https://i.chzbgr.com/maxW500/6837246976/h819F101B/)
(https://i.chzbgr.com/maxW500/6846848256/h5BE3E12B/)
-
haha :L
-
[youtube]http://www.youtube.com/watch?v=BW9B5ZuRdAw&list=UUOOQeCTjRQXvP-5s2U7v5Gg&index=6[/youtube]
-
[youtube]http://www.youtube.com/watch?v=BW9B5ZuRdAw&list=UUOOQeCTjRQXvP-5s2U7v5Gg&index=6[/youtube]
lool @ 3:25 :L
-
(http://i1.kwejk.pl/site_media/obrazki/2012/12/6eb2ba9a92f59adba850be5b216bf5cc_original.jpeg?1355393758)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/4629a5f7a5a644b74d1eda70edd82d86_original.jpg?1355392736)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/4aa3ed020d7c2d0b7c35e42246630600_original.jpg?1355392736)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/a8b34360521a8620181a29699e1eb5fd_original.jpg?1355392736)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/5bd242b1cdf8def5f1ff1fde6ddefb04_original.jpeg?1355358081)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/0025b6cf25d4a44ff2bf576ce4bcc5c8_original.jpeg?1355358106)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/80719361ad203e81d4a79843cd328a3c_original.gif?1355142725)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/de778404229ae105a89b073e7511777a_original.gif?1355320217)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/ae47e241028fbfe40d68f2f24931d2b1_original.png?1355327073)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/df3e797be1166fe26317938a0c031032_original.png?1355310962)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/5cc90ffd55161111dd7e36586c756372_original.gif?1355307935)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/06e9c273fa2c81b9f773e35264609676_original.jpg?1355315330)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/92ca35a14b970da2f89de79be92d6a8e_original.jpg?1355258082)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/b6283364c34b7c4b00e2b8b98af2e6a8_original.jpeg?1355307099)
(http://www.joemonster.org/i/e/what-simpstons-thaugt-us00.jpg)
(http://www.joemonster.org/i/e/what-simpstons-thaugt-us01.jpg)
(http://www.joemonster.org/i/e/what-simpstons-thaugt-us02.jpg)
(http://www.joemonster.org/i/e/what-simpstons-thaugt-us03.jpg)
(http://www.joemonster.org/i/e/what-simpstons-thaugt-us09.jpg)
(http://www.joemonster.org/i/e/what-simpstons-thaugt-us10.jpg)
(http://www.joemonster.org/i/e/what-simpstons-thaugt-us14.jpg)
(http://www.joemonster.org/i/e/what-simpstons-thaugt-us16.jpg)
(http://www.joemonster.org/i/e/what-simpstons-thaugt-us18.jpg)
(http://www.joemonster.org/i/e/what-simpstons-thaugt-us21.jpg)
(http://www.joemonster.org/i/e/what-simpstons-thaugt-us20.jpg)
(http://www.joemonster.org/i/e/what-simpstons-thaugt-us23.jpg)
(http://www.joemonster.org/i/e/what-simpstons-thaugt-us24.jpg)
-
the Simpsons ftw :L
-
(http://sphotos-f.ak.fbcdn.net/hphotos-ak-prn1/67862_312623118853724_161045824_n.png)
-
Ahahahaha. :L
-
(http://i.imgur.com/qN7ik.jpg)
-
if that is a brazilian house, I prefer it to other other one anyway lol
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=jjnrLt3VuSM[/youtube]
[youtube]http://www.youtube.com/watch?v=-K5mi4o1Z8g[/youtube]
-
(http://i.imgur.com/2lfCy.jpg)
-
:L
-
buahahaha
[youtube]http://www.youtube.com/watch?v=DBRcerTx134[/youtube]
-
hah :L
-
[youtube]http://www.youtube.com/watch?v=oqtaNPOitlw[/youtube]
-
(http://bwaff.com/wp-content/uploads/2012/12/exercising-baby-push-harder-fggot-theyre-going-to-wonder-if-you-even-lift.jpg)
-
classic :L
-
[youtube]http://www.youtube.com/watch?v=Dmf5V8_gsYQ&feature=[/youtube]
-
:L
-
[youtube]http://www.youtube.com/watch?v=U_9J2oJjjd4[/youtube]
-
OMG
[youtube]http://www.youtube.com/watch?v=3r5NzTnlwz4[/youtube]
-
what is that lol
-
Christmas Eve on the boardwalk in the polish city Radom. People take everything what they want :-\
-
my city ^^
-
(http://s11.postimage.org/jwb0ea0dv/vent.jpg)
-
hah
-
lol wtf
[youtube]http://www.youtube.com/watch?v=aS9VY2aJ1TQ&list=FLO_GNooxDNzt_FU0QCmrszw&index=1[/youtube]
-
(http://i.imgur.com/3Wbms.jpg)
(http://i.imgur.com/1NCGi.gif)
(http://i.imgur.com/S1Fam.gif)
-
(http://i577.photobucket.com/albums/ss212/dannyraddatz/548576_572305446132246_1927667434_n.jpg)
-
(https://fbcdn-sphotos-h-a.akamaihd.net/hphotos-ak-prn1/156106_392645137489229_494901429_n.jpg)
-
lmfao
-
(https://pbs.twimg.com/media/A-ovoD_CcAAJu_q.jpg)
-
looks fake
-
that looks photoshoped :-X
-
more like Paint'd :L
-
godzilla owns :L
-
so has the world ended for u guys yet? it ended for us a few hours ago.
-
[youtube]http://www.youtube.com/watch?v=DIjX8l4oe44[/youtube]
-
i know why we are still alive, just look:
(http://cdn.memegenerator.net/instances/400x/31460198.jpg)
-
(http://25.media.tumblr.com/48d19b9909f9f7ef9a3d1dc28f0fd384/tumblr_mfc1lwNaUX1qbyxr0o1_400.gif)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=7n2_WNJWCT8[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=7n2_WNJWCT8[/youtube]
Estonian National Cup ...: D. ... duel between Gen. Martin, Phil and Roaster: D
-
(http://4.bp.blogspot.com/-LG-5qJT-LjI/UNij4107R9I/AAAAAAAAQXs/URs6lrsKWWg/s1600/OJIw6%5B1%5D.png)
-
(http://i.imgur.com/FmlZ1.jpg)
-
[youtube]fBs1fb-n7HQ[/youtube]
-
(http://img90.imageshack.us/img90/5285/26900641248300880540579.jpg) (http://imageshack.us/photo/my-images/90/26900641248300880540579.jpg/)
-
:L
-
[youtube]http://www.youtube.com/watch?v=7HWmfPXFP6c[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=gXAWPlX_R68[/youtube]
-
[youtube]http://www.youtube.com/watch?v=SeUGn8jXG34[/youtube]
-
[youtube]http://www.youtube.com/watch?v=TCpOoAFfcEA[/youtube]
-
(http://i.imgur.com/UiyWZ.png?1)
:(
-
(http://i.imgur.com/UiyWZ.png?1)
:(
(http://i.imgur.com/1zRPD.jpg)
:'(
-
(http://img15.imageshack.us/img15/2475/6197937700b.jpg) (http://imageshack.us/photo/my-images/15/6197937700b.jpg/)
-
(http://4.bp.blogspot.com/-LG-5qJT-LjI/UNij4107R9I/AAAAAAAAQXs/URs6lrsKWWg/s1600/OJIw6%5B1%5D.png)
lol Tom
-
(http://i.imgur.com/vctTQ.jpg)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=xLYZwgdavuQ#![/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=xLYZwgdavuQ#![/youtube]
(http://i45.tinypic.com/6svuza.jpg)
-
lets start new year with some stuff
(http://i1.kwejk.pl/site_media/obrazki/2013/01/c30880a2ed9cda491c4f732c6fbd6ed0_original.jpg?1357040422)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/fa06256da99612fb50cdaa39d02e4e51_original.jpg?1357054331)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/6dde305a078087e5fc527b366c06be48_original.jpg?1356952818)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/4ec99b163ff8bb21f9ebb58aa21f895e_original.jpg?1356965661)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/078a7a13a4e074f61e1ed6af261f2595_original.jpg?1356965662)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/2e94f0f226eb45fd8ef157b0df8d18bd_original.jpg?1356948230)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/976bf655b0a01a34f6182c03c556ed13_original.jpg?1357054332)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/5d343546b50cc67a12e0dfe2d825cd00_original.jpg?1356901328)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/56ccbee92176d4e7c1c9986ddb33331b_original.jpg?1356965662)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/47ab4c231efa7da093599b814c609f7f_original.jpeg?1356946356)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/e4dd48517bb5fec0f5b7c2bfe0c50ff3_original.jpg?1357048207)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/f05daf84ec13d38ee9e2bfa1d1665791_original.jpg?1357040889)
(http://i1.kwejk.pl/site_media/obrazki/2012/12/40d806b38cb08e6d4be4235e554ec60a_original.jpeg?1356951339)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/b8cce2d20cae0b49a566aae46bc5b949_original.jpg?1357040888)
-
https://www.facebook.com/photo.php?fbid=510862962279478&set=a.496493167049791.116576.496078567091251&type=1&theater (https://www.facebook.com/photo.php?fbid=510862962279478&set=a.496493167049791.116576.496078567091251&type=1&theater)
Ouzo will love this one
-
a hue huehuehue :L
-
i want this!
[youtube]http://www.youtube.com/watch?v=ibEdgQJEdTA[/youtube]
-
2:17 disappointed me :(
-
(http://i1.kwejk.pl/site_media/obrazki/2013/01/4ab642f6d2c4702768b75df650e4e30b_original.jpg?1357119692)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/4c047c13f7f9a83b62d7c97644fe7af5_original.gif?1357078935)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/3fadbbd87b360027ada04639732c9d21_original.jpg?1357052727)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/6a1e43f9b6975575c5979e7bd93715d1_original.jpg?1357140522)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/518f51f3df461ab982be6d7e2339a742_original.jpg?1357126047)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/7f0497a685d77d846a5c2fc675266036_original.jpg?1357125956)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/0b4020aee560ba8e42339c1b87c4d92d_original.gif?1357123250)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/48c8fcb2efbf159a63c0cecc096d175e_original.jpg?1357125955)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/e2d4b2a7fc06c5c53584f584a82334db_original.jpg?1357123251)
-
(http://img266.imageshack.us/img266/5492/58262355738203359610678.jpg) (http://imageshack.us/photo/my-images/266/58262355738203359610678.jpg/)
-
lolll
(http://thechive.files.wordpress.com/2012/12/can-i-help-you-19.jpg)
(http://thechive.files.wordpress.com/2012/12/can-i-help-you-12.jpg)
(http://thechive.files.wordpress.com/2012/12/no-context-181.jpg)
(http://thechive.files.wordpress.com/2012/12/no-context-171.jpg)
(http://thechive.files.wordpress.com/2012/12/no-context-41.jpg)
(http://thechive.files.wordpress.com/2012/12/you-cant-explain-that-17.jpg)
(http://thechive.files.wordpress.com/2012/12/you-cant-explain-that-18.jpg)
(http://thechive.files.wordpress.com/2012/12/you-cant-explain-that-20.jpg)
(http://thechive.files.wordpress.com/2012/12/you-cant-explain-that-24.jpg)
(http://thechive.files.wordpress.com/2012/12/you-cant-explain-that-35.jpg)
-
[youtube]http://www.youtube.com/watch?v=Udk0_uJB4FA&feature=youtu.be[/youtube]
-
(http://i.imgur.com/CsD3x.png)
[spoiler=NSFW!](http://i.imgur.com/a87kp.gif)[/spoiler]
[youtube]http://www.youtube.com/watch?v=ZzUnrBpEmHU[/youtube]
(http://i.imgur.com/gJcEr.png)
(http://i.imgur.com/bvuGc.gif)
(http://i.imgur.com/pja4O.jpg)
and two that are huge so i'll just link them..
http://i.imgur.com/zn69n.jpg
http://i.imgur.com/qhZRm.jpg
-
xDDDD pictures
-
(https://fbcdn-sphotos-a-a.akamaihd.net/hphotos-ak-prn1/33880_374143819348860_1525288821_n.png)
(http://i.imgur.com/N5v2W.jpg)
(http://i.imgur.com/PRpQR.jpg)
(http://i.imgur.com/IuT5z.jpg)
[youtube]9ThKGj5CoRk[/youtube]
"I'd rather drive thru than drive by." :L
-
lol this almost killed me when i saw it
(http://i.imgur.com/T8512.jpg)
-
this one killed me too
it is bit old, so probably a repost, but worth positing, even again
(http://static.fjcdn.com/pictures/Madonna_a079d5_127460.jpg)
-
UHEUEHUEHEUHEUEHEUHEUEHUEHEUHEUEHEUHEUEHEUHEU :L :L :L :L :L :L :L :L :L :L
(https://fbcdn-sphotos-c-a.akamaihd.net/hphotos-ak-snc7/431301_459156610807486_1099416225_n.jpg)
-
(http://img99.imageshack.us/img99/7344/54503346899616980216620.jpg) (http://imageshack.us/photo/my-images/99/54503346899616980216620.jpg/)
-
:L :L
(http://i.imgur.com/Q0wZ3.jpg)
-
:L
-
Sabre Convertible / Sabre Cabrio ;)
(http://static0.carsablanca.de/files/medias/filename/Oldsmobile_Cutlass_Supreme_350cui_V8_Rocket_Cabriolet_5265_big.jpg)
-
[youtube]http://www.youtube.com/watch?v=0_TYeD0Mucw&feature=player_embedded[/youtube]
-
Now I know who to have on my team if I'm going to do a ram-raid. :L
-
Sabre Convertible / Sabre Cabrio ;)
(http://static0.carsablanca.de/files/medias/filename/Oldsmobile_Cutlass_Supreme_350cui_V8_Rocket_Cabriolet_5265_big.jpg)
i got model of it on my shelf
car is called oldsmobile cutlass, from 1970 year (only 1970, not 68, not 71 too)
-
[youtube]http://www.youtube.com/watch?v=0_TYeD0Mucw&feature=player_embedded[/youtube]
lol he should've only carried apple stuff and resold it later
-
I assume there must have been a limit to the number of a particular item you could take to keep the game interesting.
Also, was he awarded the items or their cash value?
-
(http://3.bp.blogspot.com/-_FJUH3I-pBU/UOygnmKcVwI/AAAAAAAAU6E/z96NviBotRU/s1600/553259_422838354456413_715370382_n%5B1%5D.jpg)
-
(http://i.imgur.com/ZWsrs.jpg)
(http://i.imgur.com/24pWw.jpg)
-
similar:
(http://i.imgur.com/bSGJy.jpg)
[spoiler=NSFW?](http://i.imgur.com/TjIwW.jpg)
(http://i.imgur.com/RVhCk.jpg)
(http://i.imgur.com/QN28N.jpg)
[/spoiler]
-
:L
-
lol these pictures are great :L
-
(http://i1.kwejk.pl/site_media/obrazki/2013/01/f091fa5949e31586b9f33b30c1e0fb2b_original.jpeg?1357763600)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/7e7faed9f5c655e3cbd019ec3d5ddac6_original.jpg?1357675154)
-
[youtube]https://www.youtube.com/watch?feature=player_embedded&v=_0tPYlsKOdE[/youtube]
-
[youtube]_0tPYlsKOdE[/youtube]
Fixed.
-
[spoiler](http://i46.tinypic.com/27wvdpu.jpg)[/spoiler]
-
dafuq have i just seen lol
-
;D lol
-
[spoiler](http://i46.tinypic.com/27wvdpu.jpg)[/spoiler]
Is that you on the bike? Or the one on his knees???
-
he's the dog in the middle
-
[youtube]http://www.youtube.com/watch?v=t0ZBrmkJ_-s[/youtube]
-
[spoiler](http://i46.tinypic.com/27wvdpu.jpg)[/spoiler]
AHAHAHHAHAHAAHAAL LOOOOOL. :L :L :L :L
-
he's the dog in the middle
oh yeAH HAHAHA
-
WTF is going on there lol :L
Where is that?
What an indifference :L
-
(https://fbcdn-sphotos-e-a.akamaihd.net/hphotos-ak-snc6/185708_517156071638688_1037867558_n.jpg)
-
(http://s10.directupload.net/images/user/100511/z8czlebx.gif)
-
[youtube]http://www.youtube.com/watch?v=9oC5gcAk1XY[/youtube]
-
:L :L
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=ueNgswQ5rek[/youtube]
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=YVHna0c2v44[/youtube]
-
ban apetit:
[youtube]http://www.youtube.com/watch?v=K-CZtYUeCE0&feature=player_embedded[/youtube]
(http://i1.kwejk.pl/site_media/obrazki/2013/01/881333af712ed0e6134d3b077ccea9b2_original.jpeg?1357905589)
-
[youtube]http://www.youtube.com/watch?v=tUl0zzH68WA[/youtube]
-
[youtube]http://www.youtube.com/watch?v=b1kIiraXXfg[/youtube]
i laughed hard!
-
(http://i1.kwejk.pl/site_media/obrazki/2013/01/3f47db16b4b12a82e1a892c96206801f_original.jpg?1358155535)
http://42.pl/bunny/
-
lol those bunny suicides are just epic
-
(https://fbcdn-sphotos-b-a.akamaihd.net/hphotos-ak-ash4/398127_319697378131690_887032845_n.jpg)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=ilP_sSzBo3M[/youtube]
-
UHEUEHUEHEUHEUEHEUHEUEHUEHEUHEUEHEUHEUEHEUHEU :L :L :L :L :L :L :L :L :L :L
(https://fbcdn-sphotos-c-a.akamaihd.net/hphotos-ak-snc7/431301_459156610807486_1099416225_n.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/d25bb2f8b06da226e9a9b86f9f4206ad_original.jpg?1358246394)
-
Wait for it...
[youtube]kSN7OZjt1MU[/youtube]
-
Hah!
-
[youtube]XeaCEYW7TRk[/youtube]
on 13:02 you can even see him (or at least his feet :L )
-
lol really, if you look closely :D quite cool :L
-
(http://i1.kwejk.pl/site_media/obrazki/2013/01/8004155a3fb1ce8cc30e7c8ffe466f34_original.jpg?1358249835)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/17f9265ba59039238d14c5f69d8d8eb1_original.jpg?1358257323)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/bcc6c7d1af2298343d21dba8f0ad4fcd_original.jpeg?1358247392)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/dccfa222ba97579b563c0b790b559c5f_original.jpeg?1358247097)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/3335dd3e21c385fad3b457d9d12c80ef_original.jpeg?1358246154)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/2e0d37bfda244428939f94f041c4beb3_original.jpg?1358296881)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/600c71b10c15ea7627ac69138b910ead_original.jpg?1358294096)
-
(http://i.imgur.com/lTxG7.jpg)
-
hahaha
-
hahahaa
-
lmao
-
pff tards everywhere
-
http://globoesporte.globo.com/platb/files/89/2013/01/ibra.gif (http://globoesporte.globo.com/platb/files/89/2013/01/ibra.gif)
-
(http://cdn.memegenerator.net/instances/400x/33491207.jpg)
-
(http://img845.imageshack.us/img845/1074/dodgy.png)
-
[youtube]Y5XM6r7GiUI[/youtube]
^ /spec 12
-
LOOOOOOOOOOOOOOL
-
http://nooooooooooooooo.com/ old but still
-
ye i remember even made topic to this
back to topic:
(http://i1.kwejk.pl/site_media/obrazki/2013/01/4f772c2eb0e2ad970f8334a529054f9e_original.jpg?1358423741)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/47f567905210342303b38ed642840152_original.jpg?1358464319)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/1818f8e1f92e0c55b6fbb2eb1d4187b3_original.png?1358368102)
-
(http://i.imgur.com/RTKC9.jpg)
(http://i.imgur.com/nGIzQ.jpg)
(http://i.imgur.com/jKhN3.jpg)
-
can't quite make out the letters on that last picture, epoxi. could you maybe post a better quality version?
-
[youtube]gzWVto7R9FA[/youtube]
[youtube]8_FRxF7Fg7s[/youtube]
-
(http://i.imgur.com/nGIzQ.jpg)
"feeling like i just got given a blowjob by a tube of Colgate" :L :L
epic email lol
-
haha cool, robots which are playing Motorhead :D
[youtube]http://www.youtube.com/watch?v=3RBSkq-_St8[/youtube]
-
Wow, a robot that can play guitar. That must be insanely complicated.
-
(http://i.imgur.com/nGIzQ.jpg)
"feeling like i just got given a blowjob by a tube of Colgate" :L :L
epic email lol
lol i have same gel.
Was using it about 30 mins ago (on my balls too but not too much LOL) Very cold haha
1st time i used a lot and it was pritty fucking freezing lmao
-
(http://i.imgur.com/TRxPh.jpg)
-
(https://fbcdn-sphotos-c-a.akamaihd.net/hphotos-ak-prn1/582405_575068909188691_599484591_n.jpg)
-
(http://poorlydrawnlines.com/wp-content/uploads/2012/02/Tiny-Hippo1.jpg)
-
https://www.facebook.com/photo.php?v=111991245643982&set=vb.436374073083095&type=2&theater
-
1st, Lemmy kills the system!
(http://i1.kwejk.pl/site_media/obrazki/2013/01/0a6ea4265e0255290fdfd774e4d99f0c_original.jpeg?1358672716)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/5a41bc7b5ab8bd7cad3c4bda3b15d9b1_original.jpeg?1358673182)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/74b0fd61b95dc43f8968ae67ac60bc7f_original.jpg?1358703079)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/a7bb7585950892f021b2f34480f6e066_original.png?1358693269)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/28f223a700d8e6478f5c84da91f5fbcf_original.jpg?1358687606)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/83e5252d40095b2ff5f6c6392763907e_original.jpg?1358674561)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/7399ddc70c445967cd36fc270b8b2668_original.jpg?1358678477)
(http://i1.kwejk.pl/site_media/obrazki/2013/01/590c7acda154f9df9348a07c28caed31_original.jpeg?1358685794)
[spoiler=only these who watch Walking Dead will understand](http://i1.kwejk.pl/site_media/obrazki/2013/01/b51ffe0f4e26057a79cea89a960955af_original.jpeg?1358688869)[/spoiler]
-
(http://img12.imageshack.us/img12/4356/37936841645233509224211.jpg) (http://imageshack.us/photo/my-images/12/37936841645233509224211.jpg/)
-
like :L
-
like :L
-
[youtube]http://www.youtube.com/watch?v=RnAMDg7IVWs&feature=youtu.be[/youtube]
-
[youtube]http://www.youtube.com/watch?v=HHa9rjQUDq4&feature=player_embedded[/youtube]
-
[youtube]http://www.youtube.com/watch?v=RnAMDg7IVWs&feature=youtu.be[/youtube]
i don't know why but i love videos like this :L
[youtube]http://www.youtube.com/watch?v=r2wyWPBRfxY[/youtube]
[youtube]http://www.youtube.com/watch?v=jsH9u7rghAk[/youtube]
-
[youtube]http://www.youtube.com/watch?v=xOwz5c6GKL8[/youtube]
-
[youtube]http://www.youtube.com/watch?v=QPd7kAy15kw[/youtube]
-
lagged real vehicle!
http://youtu.be/AXz4P6EpX3s?t=12m35s
or
12:35 in this:
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=AXz4P6EpX3s#![/youtube]
-
(http://global3.memecdn.com/Epic-Christiano-Ronaldo-Gif_o_111311.gif)
I like CR7 but this is good...:D
-
[youtube]http://www.youtube.com/watch?v=HHa9rjQUDq4&feature=player_embedded[/youtube]
HAHAHAHAHAHAHAH XD
[youtube]https://www.youtube.com/watch?v=B-TF0xRMczY[/youtube]
-
This video is for those , who understand russian quite well .
https://www.youtube.com/watch?feature=player_embedded&v=uV59R6Vf72c#!
-
I can't stop laughing from this one :L
[youtube]http://www.youtube.com/watch?v=UdJ6pnPW2b4[/youtube]
-
Some dude who is holding a conference is being interrupted by the phone call of one of the journalist's phone, which the original owner was using as a voice recorder for the interview.
[youtube]RjYQqmXZ4IA[/youtube]
Transcript (boldly copied from YT comments):
[spoiler]
"Probably at home. Yeah.. so.. em... it's always good you know. I asked them to eh.. I challenged them today. They did everything we asked the... hold on a sec"
*answers phone
"Hello? Hello? Yeah, I can hear you who's that?" *she hangs up
"Ohh she's not happy. Who's SW?"
"You in trouble again aye?"
"what's her name Michael?"
"Sharon.. Sharon? You gotta stop interrupting my press conference please? This is Neil Lennon here okay" *hangs up
For everyone who can't understand err.... English[/spoiler]
-
PINO! :L
[spoiler](http://d24w6bsrhbeh9d.cloudfront.net/photo/6402865_700b.jpg)[/spoiler]
-
loooooooooooool
-
this is this restaurant in paris montparnasse
(http://www.pizzapino.fr/RSC/img/nos-restaurants/2009_11_detail_montparnasse1.jpg)
(http://monblog.gl2i.com/data/images/pizza_pino.jpg)
-
the image i posted is taken in paris, yes. PINO mathches with that object on your second pic
-
(http://www.chamsko.pl/demot/0_0_250790218_Bambo_przez_dexdexter_middle.jpg)
(http://www.chamsko.pl/demot/0_0_958710071_Popieprzona_animacja_przez_alfred77_middle.gif)
[youtube]http://www.youtube.com/watch?v=bQmpCFt0YEA&feature=player_embedded[/youtube]
-
can be NSFW!
[spoiler]
(http://i.wp.pl/a/f/gif/30561/gifs_of_gorgeous_italian_tv_hosts_12.gif)
(http://i.wp.pl/a/f/gif/30560/gifs_of_gorgeous_italian_tv_hosts_10.gif)
(http://i.wp.pl/a/f/gif/30561/gifs_of_gorgeous_italian_tv_hosts_18.gif) [/spoiler]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=AAhnebLDsIY#![/youtube]
-
ahh that pression in this video!
suggest watching with good audio, coz soundtrack is what makes it
[youtube]http://www.youtube.com/watch?v=E3tQLgRobLI&feature=player_embedded[/youtube]
-
[youtube]https://www.youtube.com/watch?v=Gyf1kjaUZCo[/youtube]
hahahah :D
-
(http://i.imgur.com/mDIgklO.jpg)
-
[youtube]http://www.youtube.com/watch?v=f0tA42km_1Q[/youtube]
-
(http://static.fjcdn.com/gifs/Bollywood_4a7b20_734207.gif)
-
[youtube]http://www.youtube.com/watch?v=6utE5APd4wA[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=UpfxY_KIXu4#![/youtube]
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=6JnwzLJ2yGM[/youtube]
-
(sorry Tom) WARNING NSFW
lol xD http://efukt.com/21020_Painfully_Awkward_Moments_in_Porn_.html
haha this is much better http://efukt.com/20947_Not_Even_A_Minute_Man.html
and this one is the best http://efukt.com/21002_The_Trolling_Of_Wannabe_Pornstars_3.html
-
should have warned people of the NSFW
-
posting as spoiler coz come may be NSFW or just offensive
[spoiler](http://www.chamsko.pl/demot/0_0_814431977_Rysowanie_kota_przez_alfred77_middle.jpg)
(http://www.chamsko.pl/demot/0_0_126891898_Szybkie_mycie_przez_alfred77_middle.gif)
(http://www.chamsko.pl/demot/0_0_601522056_DownGuard_przez_addemczuk_middle.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2013/02/963ec4bbca71aa753c2f3f3ddab949b3_original.png?1360062650)
(http://i1.kwejk.pl/site_media/obrazki/2013/02/afe7d6907198d320ed0483802ed69323_original.jpg?1360057628)
(http://i1.kwejk.pl/site_media/obrazki/2013/02/721374ebdf9dbff633574efccd2adb1b_original.gif?1360058927)
(http://i1.kwejk.pl/site_media/obrazki/2013/02/94964787542c55eee54b6105e1ba7b90_original.jpeg?1359984527)[/spoiler]
-
(sorry Tom) WARNING NSFW
lol xD http://efukt.com/21020_Painfully_Awkward_Moments_in_Porn_.html
haha this is much better http://efukt.com/20947_Not_Even_A_Minute_Man.html
and this one is the best http://efukt.com/21002_The_Trolling_Of_Wannabe_Pornstars_3.html
lol @ the last one, what an ownage
-
[youtube]0nNbkPEr0io[/youtube]
[youtube]exZ_GLDBtKg[/youtube]
[youtube]EHLcbQtmJNk[/youtube]
[youtube]2lHrKeMV69Q[/youtube]
-
(sorry Tom) WARNING NSFW
lol xD http://efukt.com/21020_Painfully_Awkward_Moments_in_Porn_.html
haha this is much better http://efukt.com/20947_Not_Even_A_Minute_Man.html
and this one is the best http://efukt.com/21002_The_Trolling_Of_Wannabe_Pornstars_3.html
lol @ the last one, what an ownage
:L :L :L "What kind of guys do you like? Blind?" or "What do you mean with a challenge? - I mean you're an idiot"
(In case people don't read the quote- NSFW links!)
This is much better: http://efukt.com/21052_Russian_porn_is_hilariously_horrible.html
http://efukt.com/21051_The_Camwhore_Awards.html
http://efukt.com/21040_Porn_Scenes_Worthy_of_an_Oscar_.html
-
lol at not even a minute man
-
not funny but epic
[youtube]http://www.youtube.com/watch?v=45YyPTgCtJs[/youtube]
-
Brazilian nightclub fire :(
(http://i.imgur.com/AuU1Dpo.jpg)
(http://i.imgur.com/RYYk8iw.jpg)
-
not funny
-
(https://www.ptsdforum.org/c/attachments/dark1-jpg.27534/)
-
:L
-
(http://i.imgur.com/Svpwu0W.jpg)
Cracks me up lol!!
-
not funny
+100
-
Tom would be saying different if it wasn't for Gabbie.
-
no, put yourself in their position, have respect for the people who had no idea that a great night was going to turn out so badly.
-
I would put myself in their position but I don't go to nightclubs.
-
it was something like 230 dead bodies
-
200 to be exact
-
not funny
-
not funny
-
(http://www.abload.de/img/5847_450617438343041_sdjxe.png) (http://www.abload.de/image.php?img=5847_450617438343041_sdjxe.png)
-
:L
-
[youtube]http://www.youtube.com/watch?v=hGgr8ZbeNgQ[/youtube]
-
New asdf movie 6:
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=hrzIykdka4s[/youtube]
-
[youtube]http://www.youtube.com/watch?v=hHkKJfcBXcw[/youtube]
[youtube]http://www.youtube.com/watch?v=DI5_sQ8O-7Y[/youtube]
Catchy songs
-
Creative :L
-
[youtube]http://www.youtube.com/watch?v=hknVoAoyy-k[/youtube] epic
-
[youtube]http://www.youtube.com/watch?v=QXwfACVi0k0[/youtube]
:L
watch other his videos ;D
-
Lolete St Valentine's Day
(http://d.wpimg.pl/4623165-1562145230/walentynki-romantyczne.jpg)
(http://d.wpimg.pl/1633366402-1118243734/walentynki-romantyczne.jpg)
(http://d.wpimg.pl/1136665136-1385005359/walentynki-romantyczne.jpg)
(http://d.wpimg.pl/1646418400-366628390/walentynki-romantyczne.jpg)
(http://d.wpimg.pl/1150081365-1331883414/walentynki-romantyczne.jpg)
-
[youtube]http://www.youtube.com/watch?v=gmlR5eG9zP4[/youtube]
-
(http://i.imgur.com/Hq5KRIo.jpg)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=eB31O7g57PY[/youtube]
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=3fuijhUn0pk[/youtube]
-
(http://img51.imageshack.us/img51/6114/45544580767968604299559.jpg) (http://imageshack.us/photo/my-images/51/45544580767968604299559.jpg/)
-
[youtube]http://www.youtube.com/watch?v=rgg1WUJhUc4[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=tvejp8v8qbU[/youtube
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=PHSJCMkUa9Y[/youtube]
-
[youtube]http://www.youtube.com/watch?v=p-ZuRopR1Ek[/youtube]
-
:L
-
(http://img577.imageshack.us/img577/4118/73498046617533345489115.jpg) (http://imageshack.us/photo/my-images/577/73498046617533345489115.jpg/)
-
:L
[youtube]http://www.youtube.com/watch?v=qRWuxWLQOqY[/youtube]
-
Is he gay? I might suck. Passed with mooman so one chocolate man is not a big problem. :L
-
:L
[youtube]http://www.youtube.com/watch?v=qRWuxWLQOqY[/youtube]
[youtube]http://www.youtube.com/watch?v=9f8oyer8VoY[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=eyCl_iJOpI8[/youtube]
-
normally you would think this should be labeled NSFW, but in fact it isn't NSFW so leaving it like that...
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=MYusslcnc1g[/youtube]
-
lol
-
(http://img812.imageshack.us/img812/4710/47991346920349646543362.jpg) (http://imageshack.us/photo/my-images/812/47991346920349646543362.jpg/)
-
hahah
-
(http://a1302.hizliresim.com/16/r/kdlf1.jpg)
(http://global3.memecdn.com/bad-luck-brian_o_489818.jpg)
-
This is so true lol: http://www.funnyordie.com/videos/5ab6547a16/the-girlfriend
AND:
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=cpfQSqfpuac[/youtube]
Polish Harlem Shake "Forever Alone"
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=ONcMMbaLwEM[/youtube]
-
[youtube]http://www.youtube.com/watch?v=eG-6HaAF6Cs[/youtube]
-
[youtube]http://www.youtube.com/watch?v=A54SfVFTNlg[/youtube]
-
^Fakefakefakefakefake. Fake. :L
-
[youtube]http://www.youtube.com/watch?v=T76DHvxqsYU&feature=youtu.be[/youtube]
-
[youtube]http://www.youtube.com/watch?v=c8LBb_JlTUQ[/youtube]
-
NOT FUNNY BUT NFSMW
http://images.4channel.org/f/src/cherry-pie.swf
WOMAN EATS OWN BODY PARTS OMGWTFLOLZORPANTS :/
-
Omg what did I just see? :o
-
what the fuck :o
...asians lol ::)
MadMax is probably enjoying it :L
MadMax 18:17:28 Viewing the topic Funny Videos/Pictures.
-
just went throu forums checking whats new, Japans are fucked up, but still not as classic as 1 man and 1 jar :L
-
but still not as classic as 1 man and 1 jar :L
BUTT it was funny
-
i remember you send me link to it 1st lol
the same with merry holidays and other shits...
-
i stopped after she wiped her fork on her breast, what does she do next?
-
cut off, eat, eye, eat. basically
-
Looks too fake with that eye lol. It seems to be a penis instead.
-
if anyone wants to watch the movie it's from:
http://www.imdb.com/title/tt0217679/
-
oh well... what a surprise you know this movie :L
-
heh, thats what i expected, these crappy and creepy japanese productions from early/mid 90s
-
NOT FUNNY BUT NFSMW
http://images.4channel.org/f/src/cherry-pie.swf
WOMAN EATS OWN BODY PARTS OMGWTFLOLZORPANTS :/
from suicide forums to 4chan huh
-
Well, she enjoyed it i think ;D
-
[youtube]http://www.youtube.com/watch?v=BLT0sudAGtU[/youtube]
-
^
Dodger is so pro even IRL
[youtube]BG569wZI1Z4[/youtube]
-
[youtube]http://www.youtube.com/watch?v=w0CdXaOS5_o[/youtube]
best :D
-
[youtube]http://www.youtube.com/watch?v=Dwimc4cvUmQ[/youtube]
-
[spoiler](https://fbcdn-sphotos-f-a.akamaihd.net/hphotos-ak-prn1/417738_542588539108442_245513521_n.jpg)[/spoiler]
-
Well, this is not funny, I put it for all to see
[youtube]http://www.youtube.com/watch?v=et7qnM62tXg[/youtube]
-
(http://i.imgur.com/huZFvJ7.jpg)
(http://i.imgur.com/ZQMx8EP.png)
-
(http://img541.imageshack.us/img541/4307/42106730503413287793320.jpg) (http://imageshack.us/photo/my-images/541/42106730503413287793320.jpg/)
(http://img708.imageshack.us/img708/9993/53549747570454249670221.jpg) (http://imageshack.us/photo/my-images/708/53549747570454249670221.jpg/)
-
Czech tram driven by Phobos (starts at 0:45):
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=s-Cl4Y4fOlg[/youtube]
-
URL=http://imageshack.us/photo/my-images/708/53549747570454249670221.jpg/](http://img708.imageshack.us/img708/9993/53549747570454249670221.jpg)[/URL]
hahaha :L
-
[youtube]http://www.youtube.com/watch?v=9AJfQgI2WHU[/youtube]
-
Czech tram driven by Phobos (starts at 0:45):
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=s-Cl4Y4fOlg[/youtube]
haha lol
and this is how i roll in Brno <_>
[youtube]http://www.youtube.com/watch?v=DbGFiuXvpS0[/youtube]
-
[youtube]dTquipQmhnI[/youtube]
-
(http://i.imgur.com/LcDBwzy.jpg)
-
lol wot
-
used to see many cars like this one in my town, never saw them fly though! :L
(https://fbcdn-sphotos-b-a.akamaihd.net/hphotos-ak-ash4/314404_159097984249327_1128782923_n.jpg)
-
(http://i1.kwejk.pl/site_media/obrazki/2013/03/61abd27f605ca8dbb790adf3453e8dcf_original.png?1362685685)
(http://i1.kwejk.pl/site_media/obrazki/2013/03/d6c50886589b7a18757bf700b99fb526_original.jpg?1362584023)
(http://i1.kwejk.pl/site_media/obrazki/2013/03/984f0ffaad9c1049bf2945f7bdb97a95_original.jpg?1362661187)
(http://i1.kwejk.pl/site_media/obrazki/2013/03/2282862e05a3af44a0db7cfb46e48108_original.jpg?1362736283)
(http://i1.kwejk.pl/site_media/obrazki/2013/03/ec470cea9a341da7b48687d8016d2363_original.jpg?1362673495)
-
(http://i.wp.pl/a/f/jpeg/30786/przegladarka-paski-660x494.jpeg)
-
(http://i.wp.pl/a/f/jpeg/30786/przegladarka-paski-660x494.jpeg)
This reminds my friends PC :L
-
lmfao
-
That's what I was talking about Ush: :L
(http://mistrzowie.org//uimages/services/mistrzowie/i18n/pl_PL//201206/1339070586_by_sillu_org.jpg)
-
:L
-
[youtube]GnZvOUvxRws[/youtube]
-
[youtube]http://www.youtube.com/watch?v=j2ghVpNCVe4[/youtube]
:L
[youtube]http://www.youtube.com/watch?v=8UjcqCx1Bvg&feature=player_embedded[/youtube]
-
i lol'd hard! xD (https://fbcdn-sphotos-f-a.akamaihd.net/hphotos-ak-prn1/33982_546767628677173_2143047942_n.png)
-
(http://sphotos-b.ak.fbcdn.net/hphotos-ak-ash4/482821_474990505906707_377038042_n.jpg)
-
(http://www.abload.de/img/551466_56939401310081xhk1q.png) (http://www.abload.de/image.php?img=551466_56939401310081xhk1q.png)
best! :)
-
At first I was like "How is this funny, it is so inappropriate."
Then I was like "OOOOOOOOOOOOOOOOHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH SNAP!"
-
U KNOW WHAT I MEAN :ddd
-
^ :L
(http://i.imgur.com/vN2fbjm.gif)
-
Haha, that driver must have been like, WTF IS COMING AT ME THIS TIME?
-
xDDDD
//Edit: watch this
(https://fbcdn-sphotos-c-a.akamaihd.net/hphotos-ak-ash3/549310_580884598618427_631713048_n.jpg)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=WuaQ7Z0mH2g[/youtube]
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=RRDSj62tlvQ[/youtube]
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=fiV_jpW9DlY#![/youtube]
-
After the 4:0 for Barca
(http://sphotos-a.ak.fbcdn.net/hphotos-ak-snc7/301669_562738250426876_1691817074_n.jpg)
Fuck, I must laugh so hard XD
-
[youtube]jDfD5u3vIRU[/youtube]
-
Don't worry, this is faked (very well).
[youtube]SBpdZcAOy6M[/youtube]
-
well, with some more training he could be a fine wrestler
-
you mean actor
-
yeah, well, its the same thing actually
-
well, with some more training he could be a fine wrestler
you mean actor
yeah, well, its the same thing actually
OH SNAP!
-
(http://i.wp.pl/a/f/jpeg/30840/nie_seksowne_99.jpeg)
(http://i.wp.pl/a/f/jpeg/30838/nie_seksowne_11.jpeg)
(http://i.wp.pl/a/f/jpeg/30838/nie_seksowne_7.jpeg)
(http://i.wp.pl/a/f/jpeg/30838/nie_seksowne_3.jpeg)
(http://i.wp.pl/a/f/jpeg/29889/nie_seksi_5.jpeg)
(http://i.wp.pl/a/f/jpeg/29889/nie_seksi_30.jpeg)
-
i do not understand 'FAIL' in 2nd picture.. well she isn't pretty, but why 'FAIL'?
-
i do not understand 'FAIL' in 2nd picture.. well she isn't pretty, but why 'FAIL'?
her right hand behind the body looks like a dick :L
and LOL @ the woman with the cat haha
-
https://www.facebook.com/photo.php?v=498327410231994&set=vb.170051619726243&type=2&theater
listen this lol
-
fucking outstanding
-
Ahahaha. :L
-
:L
-
[youtube]v0cOIBu-vqo[/youtube]
-
LOOOOOOOOOOL
-
(http://24.media.tumblr.com/b83c25c3c22a2e42e3e3e7f463e62a1f/tumblr_mjun6dIgCc1rdeo1uo1_500.jpg)
(http://mistrzowie.org/uimages/services/mistrzowie/i18n/pl_PL//201303/1362871294_by_osatorun.jpg?1362991625)
-
(http://3.bp.blogspot.com/-4lbTMQR5JFA/UUnZXbN-uAI/AAAAAAAAZM0/5oWy5VWq8FY/s1600/say+that+five+times+fast_d0124b_4491390.png)
-
(http://img.myepicwall.com/i/2013/03/1ed34f44ae35ec66a6355a3c033bff5a.jpg?1363799011)
-
(http://i1.kwejk.pl/site_media/obrazki/2013/03/42bef1e8e09b6c9cef5f1c97c0c5b209_original.jpg?1363774581)
-
(http://img.myepicwall.com/i/2013/03/1ed34f44ae35ec66a6355a3c033bff5a.jpg?1363799011)
hahaha that guy is awesome
-
his works are intresting
some are brainfuck, and some may be nsfw, so in spoiler
[spoiler]
(http://1.bp.blogspot.com/-zjtvS3PQLEI/UOQVmm2rf1I/AAAAAAAAAts/J9pntc-CzbE/s1600/fitness.jpg)
(http://4.bp.blogspot.com/-99fl1nBtO28/UL8qKCd08nI/AAAAAAAAAqk/EwuK80dYxl0/s1600/mr.rainbow.jpg)
(http://3.bp.blogspot.com/-oWZS1BUMKZo/UPZ9tLdB8vI/AAAAAAAAAuk/8mgyJAHSOnE/s1600/cap.jpg)
(http://24.media.tumblr.com/a67fb0d8d38b4297088216d80054ffae/tumblr_mhb7tclE0r1s3m39bo1_500.jpg)
(http://www.papaissue.com/wp-content/uploads/2013/01/3xpyJoanCornella_950-e1359042293274.jpeg)
(http://4.bp.blogspot.com/-lZHtyHt6tK0/UMhc1J0eOMI/AAAAAAAAArg/VtNBMoxvxJM/s1600/L.jpg)
(http://2.bp.blogspot.com/-9706EA2LWr0/UJwQy-kEV5I/AAAAAAAAAoA/7QwtKQ0iWd8/s1600/disco.jpg)
(http://25.media.tumblr.com/b53f9fef2a4dc34244f88687d7840c10/tumblr_mgmo3rzrOd1qzt0oyo1_500.jpg)
(http://24.media.tumblr.com/2ce32bd7638097fe45afa3e7177e038d/tumblr_mgcralGcsx1qdgzyfo1_500.jpg)
(http://25.media.tumblr.com/49803fa53105a6634ad8f31455b4e601/tumblr_mh2w2tfxBV1qkyh45o1_1280.jpg)
(http://3.bp.blogspot.com/-llrrbJym8fY/UPNFvKxkw2I/AAAAAAAAAKY/pNonZkCijRY/s1600/coso2.jpeg)
(http://2.bp.blogspot.com/-FOchHcNPOik/UHXLrG1JXvI/AAAAAAAAAfk/HIAKSdnUgU0/s1600/mut.jpg)
(http://1.bp.blogspot.com/-Ss4EUHHCKMA/URoFiNhhk8I/AAAAAAAAAzY/jVuDCxXgcKg/s1600/U%CC%88bermensch.jpg)
(http://i.imgur.com/ufz4sXl.jpg)[/spoiler]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=kueH45LKvkQ[/youtube]
-
(http://i1.kwejk.pl/site_media/obrazki/2013/03/42bef1e8e09b6c9cef5f1c97c0c5b209_original.jpg?1363774581)
haha
-
Haha, Max those photos are so wtf I found myself laughing in confusion. :L
-
[youtube]vR3QgfiqTP8[/youtube]
:L :L :L
-
:L
-
part 1
[youtube]http://www.youtube.com/watch?v=QYm-dT24iRY[/youtube]
part 2
[youtube]Rgox84KE7iY[/youtube]
[youtube]http://www.youtube.com/watch?v=YdQnuqFlD7U[/youtube]
-
-
-
[youtube]http://www.youtube.com/watch?v=9GdhevIpKaI[/youtube]
-
:L
-
Haha this gave me a good laugh :L
-
[youtube]52_fFlf4PBg[/youtube]
-
(http://i.imgur.com/13j5Jkz.png)
-
WARNING:BLACK HUMOR
:L
[youtube]http://www.youtube.com/watch?v=z4-wsErhEtQ[/youtube]
[youtube]http://www.youtube.com/watch?v=xAru_LPduZQ[/youtube]
-
This is quite epic...
Such a dump ass drivers over there..
In russia everyone just drives trough crashed lol..
Some funny ones there too.. Like the one with the Horse or the truck wheel. The car going down hill in the snow or the road workers that rollin down :L
[youtube]http://www.youtube.com/watch?v=6ekeKTCJliA[/youtube]
-
ebanij v rot :L
-
eh... classic!
[spoiler]
[youtube]http://www.youtube.com/watch?v=EMIKNCiGu-8[/youtube][/spoiler]
-
(http://i1.kwejk.pl/site_media/obrazki/2013/04/de7feeb5a0da660b35df46c94a0ebc98_original.jpg?1364810102)
(http://i1.kwejk.pl/site_media/obrazki/2013/04/203a7ba5b13509c84979bb174d084be3_original.gif?1364809984)
(http://i1.kwejk.pl/site_media/obrazki/2013/04/3d7bb0b5bffe156938bf521487d1ad1e_original.jpg?1364805082)
-
(http://i.imgur.com/QU7naRD.jpg)
(http://24.media.tumblr.com/aae07a5aab8c464393159300bf4d240f/tumblr_mij8qqjZ9V1qewacoo1_r2_500.jpg)
-
Hi all!)
[youtube]http://www.youtube.com/watch?feature=player_detailpage&v=WbcihIRpQoY[/youtube]
-
nice
-
THE BEST HARLEM SHAKE !! :L
[youtube]http://www.youtube.com/watch?v=2WOrjQbudP4[/youtube]
-
THE BEST HARLEM SHAKE !! :L
[youtube]http://www.youtube.com/watch?v=2WOrjQbudP4[/youtube]
LOLOL Yeaaaaaah in yo face!!
-
hahahahahahahahahahaha
-
definitely the best harlem shake ;_;
-
looool :L
-
Got this today from my operator
(http://i46.tinypic.com/34e3iur.jpg)
-
[youtube]http://www.youtube.com/watch?v=wSMKfzIGzmo[/youtube]
-
(http://i.imgur.com/x9t8HIP.png)
-
Got this today from my operator
(http://i46.tinypic.com/34e3iur.jpg)
:L
-
Everything in this picture is Snoop Dogg:
(http://i.imgur.com/uZbp211.png)
-
this is how ush got introduced to weed!
[youtube]
http://www.youtube.com/watch?v=Kl_k0zysgg0[/youtube]
-
That's how you get high with style!
[youtube]http://www.youtube.com/watch?v=O6nLdpW5pZk[/youtube]
-
[youtube]ck_gGJ1z1-E[/youtube]
-
playing with oscilloscope valued in 6k €
(http://photoload.ru/data/4c/d3/87/4cd3877576e2662100ed54aa6d20c75a.jpg)
-
:L Nice. Does it run Windows XP?
-
dat epoxi
-
http://www.youtube.com/watch?v=XHEFbX81XWQ
a Dutch (gifted) singer
-
:L Nice. Does it run Windows XP?
yeah it does xD
-
Everything in this picture is Snoop Dogg:
(http://i.imgur.com/uZbp211.png)
(https://fbcdn-sphotos-e-a.akamaihd.net/hphotos-ak-frc3/485393_548993775123065_1771870495_n.jpg)
-
http://www.youtube.com/watch?v=XHEFbX81XWQ
a Dutch (gifted) singer
:blank:
-
(http://img850.imageshack.us/img850/1582/12513525723667470278648.jpg) (http://imageshack.us/photo/my-images/850/12513525723667470278648.jpg/)
LOL ^
-
fb
-
fb
suicideforums
-
fb
suicideforums
:L :L
-
lmao
-
HHAhahaahahahahaahheahjja
[youtube]http://www.youtube.com/watch?v=j6NjSGn3fj0&list=HL1365349642[/youtube]
-
[youtube]http://www.youtube.com/watch?v=jvijM4Vr7oA[/youtube]
-
haha :L
-
[youtube]http://www.youtube.com/watch?v=1b7DKQx5SCw[/youtube]
-
Putin's visit to Merkel in Hanover (Germany)...
(http://www.courrierinternational.com/files/imagecache/article/illustrations/article/2013/04/0804_BRV_POUTINE.jpg)
Vlady' apparently declared later: "I appreciated a lot. I couldn't really hear what they were shouting because of the security service that acts with a lot of brutality. It (the security service) could be more delicate. I couldn't even see if they were blondes, brown-haired or brunettes."
The femen woman had shouted "fuck you Putin!" (not sure if it's the exact words, I translated it from an already-translated version).
-
Yes. The words on her back say "Idi nahuj Putin" = "Fuck you Putin"/
-
i wish more women hated me that much :L
-
[youtube]http://www.youtube.com/watch?v=1b7DKQx5SCw[/youtube]
classic :L
-
(http://i.imgur.com/g4uf1sm.gif)
-
(http://www.abload.de/img/560006_30139892332613d9bin.jpg) (http://www.abload.de/image.php?img=560006_30139892332613d9bin.jpg)
-
[youtube]YQY8j5LLuEo[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=qnydFmqHuVo#![/youtube]
[youtube]http://www.youtube.com/watch?v=7RCX6tEba1Q[/youtube]
[youtube]http://www.youtube.com/watch?v=38KIVxQ29nc[/youtube]
-
got only 1 but amout of 'WTF???' is just amazing
(http://i1.kwejk.pl/site_media/obrazki/2013/04/69f1cb8420a5de18d53026cbdd0ab96e_original.gif?1365603393)
-
(http://24.media.tumblr.com/dacbee36eb1a6df221f3f4cafebaee33/tumblr_mk9a0jFT3w1qlfymuo1_400.gif)
-
[youtube]http://www.youtube.com/watch?v=jjnrLt3VuSM[/youtube]
[youtube]http://www.youtube.com/watch?v=kZUPCB9533Y[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=qnydFmqHuVo#![/youtube]
[youtube]http://www.youtube.com/watch?v=7RCX6tEba1Q[/youtube]
[youtube]http://www.youtube.com/watch?v=38KIVxQ29nc[/youtube]
this guy is awesomeeeee
-
(http://i.imgur.com/B42yEiC.jpg)
-
(https://fbcdn-sphotos-a-a.akamaihd.net/hphotos-ak-ash3/547415_10151392480812965_736736476_n.jpg)
-
(http://i.imgur.com/2ILy0.jpg)
(http://cdn2.planetminecraft.com/files/resource_media/screenshot/1248/strand_4256809.jpg)
(http://i.imgur.com/g1PY6.jpg)
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=e3HSagbrDOY[/youtube]
-
lol
-
lol the 2d-squarish trees give away that its auto-generated :( (not that i wish anyone to make it by hand)
-
lol the 2d-squarish trees give away that its auto-generated :( (not that i wish anyone to make it by hand)
Yeah, I thought the same. I'm still impressed. :L
-
Only pros will feel related to this!
(https://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-prn1/539612_498433870205736_206351468_n.jpg)
-
Only pros will feel related to this!
(https://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-prn1/539612_498433870205736_206351468_n.jpg)
That's funny but I actually cut any corner I can on the sidewalks, even it's like 1 meter less route since I've started playing racing games. :L
-
Cutting corners is awesome. If you commuted through there every day, then you would save 5 minutes in a year.
(http://i.imgur.com/8GeNi9w.jpg)
-
:L
-
(http://img.myepicwall.com/i/2013/04/5f1bbe9110726c26abd0c0a52334dd9c.gif)
-
I first brought you this:
Oswestry Sleep Walker (https://www.youtube.com/watch?v=cxsjDOSgWdA)
Now, my friend mentioned he placed a video on YouTube, so I thought I'd share it with you. (If just about fits this thread :L)
[youtube]http://www.youtube.com/watch?v=Go7qTeWEKkQ[/youtube]
-
Some awesome DVDs there. Best era ever
-
Rick: Ordered some views for him :L
And on topic. Best phone config ever. Fuck iPhone:
(http://1.bp.blogspot.com/_xsEQqY9te_Q/TR48rq_02eI/AAAAAAAAAK8/wmEGHUr-Nps/s1600/nokia-3310.jpg)
-
(http://img.myepicwall.com/i/2013/04/5f1bbe9110726c26abd0c0a52334dd9c.gif)
(http://i.imgur.com/PPZK0rb.gif)
-
(http://img.myepicwall.com/i/2013/04/5f1bbe9110726c26abd0c0a52334dd9c.gif)
(http://i.imgur.com/PPZK0rb.gif)
That's really frustrating.
-
Madmax's cat:
(http://i.imgur.com/ASYQ4Mv.gif)
-
LOL more like vert's one
notice this car is turning wrong direction
-
fixed
(http://i.imgur.com/5nwCoKF.gif)
-
looooooool
-
hahahahahah mooma n
-
(http://i.wp.pl/a/f/jpeg/30992/zamiana__twarzy_32.jpeg)
(http://i.wp.pl/a/f/jpeg/30991/zamiana__twarzy_20.jpeg)
(http://i.wp.pl/a/f/jpeg/30992/zamiana__twarzy_34.jpeg)
(http://i.wp.pl/a/f/jpeg/30991/zamiana__twarzy_24.jpeg)
(http://i.wp.pl/a/f/jpeg/30992/zamiana__twarzy_39.jpeg)
(http://i.wp.pl/a/f/jpeg/30991/zamiana__twarzy_17.jpeg)
(http://i.wp.pl/a/f/jpeg/30992/zamiana__twarzy_31.jpeg)
(http://i.wp.pl/a/f/jpeg/30992/zamiana__twarzy_44.jpeg)
(http://i.wp.pl/a/f/jpeg/30906/bez_zebow_4.jpeg)
(http://i.wp.pl/a/f/jpeg/30906/bez_zebow_3.jpeg)
(http://i.wp.pl/a/f/jpeg/30906/bez_zebow_1.jpeg)
-
^ Lol men are ugly, I don't know why girls like us. :L
-
[youtube]I03UmJbK0lA[/youtube]
-
[youtube]2h1Ox5vEW0Q[/youtube]
[youtube]SlBnJiTj1G4[/youtube]
-
(https://fbcdn-sphotos-f-a.akamaihd.net/hphotos-ak-ash4/483222_183749691750317_1698135748_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=4aObNcADs2c[/youtube]
-
(https://fbcdn-sphotos-f-a.akamaihd.net/hphotos-ak-ash4/483222_183749691750317_1698135748_n.jpg)
:L
Probably 3 new characters will pass it
-
[youtube]http://www.youtube.com/watch?v=IeVMKC4EXnQ[/youtube]
-
(http://i.imgur.com/bmPwZF5.jpg)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=Z0DO0XyS8Ko#![/youtube]
-
[youtube]HtxhEmShETA[/youtube]
-
i'm just watching the game and look what i suddenly see
[MA]Fagus :L
(http://i.imgur.com/ocGb8jT.png)
-
: (((((
(https://fbcdn-sphotos-b-a.akamaihd.net/hphotos-ak-prn1/65606_550983064951958_460034356_n.jpg)
(https://fbcdn-sphotos-c-a.akamaihd.net/hphotos-ak-ash3/10101_160247120809108_1408149257_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=_MjxF04WlQQ[/youtube]
-
party rock xDD
-
[youtube]http://www.youtube.com/watch?v=_MjxF04WlQQ[/youtube]
[youtube]http://www.youtube.com/watch?v=IhlKHgORrgM[/youtube]
-
(http://sphotos-b.ak.fbcdn.net/hphotos-ak-ash3/644631_613729445333942_1052300395_n.jpg)
-
(http://i.imgur.com/yHS7QK5.jpg)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=Z0DO0XyS8Ko#![/youtube]
What does this mean? So bad and catchy at the same time.
-
(http://2.bp.blogspot.com/-MvSE3-FxMZ8/UXrQD6vpiYI/AAAAAAAAB0Q/q-FGGkU96NY/s1600/34.png)
-
(https://fbcdn-sphotos-h-a.akamaihd.net/hphotos-ak-frc1/v/375036_601879319825254_343430416_n.jpg?oh=217a86c81ca19d2ab61bfb7bfa0afacc&oe=517E76A2&__gda__=1367326458_4dbc2a9d5a4432b47e10f42665c19fed)
Normal day in facebook for me
-
He might have feelings, you know :(
-
[youtube]http://www.youtube.com/watch?v=1rveFObzeX8[/youtube]
[youtube]reIbQLWmLOU[/youtube]
-
:L
-
(http://vpx.pl/i/2013/04/28/32.jpg)
-
[youtube]http://www.youtube.com/watch?v=1rveFObzeX8[/youtube]
[youtube]reIbQLWmLOU[/youtube]
amazing :L
-
[youtube]PP7pH4pqC5A[/youtube]
-
[spoiler=kind of nsfw!](http://s.pikabu.ru/post_img/2013/04/29/6/1367223587_358314676.gif)
(http://s.pikabu.ru/images/big_size_comm/2013-04_6/1367232682699.gif)[/spoiler]
-
(http://img7.joyreactor.cc/pics/post/%D0%B3%D0%B8%D1%84%D0%BA%D0%B8-%D0%B3%D0%B0%D1%88%D0%B8%D1%88-%D1%87%D1%82%D0%BE-%D0%B7%D0%B0-%D1%85%D1%83%D0%B9%D0%BD%D1%8F-%D0%BF%D0%B5%D1%81%D0%BE%D1%87%D0%BD%D0%B8%D1%86%D0%B0-670527.gif)
-
[youtube]http://www.youtube.com/watch?v=1rveFObzeX8[/youtube]
hahahahaha this
-
[youtube]PP7pH4pqC5A[/youtube]
(http://i.imgur.com/bhBcnOl.jpg)
-
Sloths FTW
-
Black Jarno
(http://i.imgur.com/fD5o4M8.jpg)
-
(http://i1.kwejk.pl/site_media/obrazki/2013/04/6001f696b30c6bd131d5dfb5ba540075_original.jpg?1367333973)
-
(http://25.media.tumblr.com/tumblr_ma6savgpha1rngpbho1_500.jpg)
(https://fbcdn-sphotos-c-a.akamaihd.net/hphotos-ak-frc1/321370_140165912835431_1193923984_n.jpg)
-
(http://i.imgur.com/D7zsuJK.gif)
-
lmao
-
Haha, cool.
-
[youtube]http://www.youtube.com/watch?feature=youtube_gdata_player&v=rnFYPQXfjgg[/youtube]
-
(http://25.media.tumblr.com/77b179575bbffd00bf403b99ac20debb/tumblr_mm4xvk7otG1qlxohso1_500.jpg)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=u_jRgv-UqBU#![/youtube]
-
(http://i.imgur.com/Qu04Gvp.gif)
-
(http://i1.kwejk.pl/site_media/obrazki/2013/05/6264b86db2fd4542e637bc65bf293497_original.jpg?1367932156)
-
[youtube]http://www.youtube.com/watch?v=TQIwEZlOzp4&feature=share[/youtube]
-
this should be in the top1 of funniest videos ever
[youtube]http://www.youtube.com/watch?v=bSTXm49hidI[/youtube]
realife spongebob xD
-
(http://i1.kwejk.pl/site_media/obrazki/2013/05/6264b86db2fd4542e637bc65bf293497_original.jpg?1367932156)
more of these please :L
-
I remember when Snoopy sent me this some time ago :L
[youtube]http://www.youtube.com/watch?v=nzVlmgCpGbs[/youtube]
-
The face at the end..
[youtube]https://www.youtube.com/watch?v=5ZRwol_qFW4[/youtube]
-
The face at the end..
[youtube]http://www.youtube.com/watch?v=5ZRwol_qFW4[/youtube]
-
(http://i1.kwejk.pl/site_media/obrazki/2013/05/2e99f69c6a191573115bc22384de94d5_original.gif?1368022682)
(http://i1.kwejk.pl/site_media/obrazki/2013/05/bfb70157daf45e9d3e24aa8a0c0c71a1_original.gif?1368023368)
(http://i1.kwejk.pl/site_media/obrazki/2013/05/974cc60955309343e179ae47c4b521e9_original.jpg?1368006320)
(http://i1.kwejk.pl/site_media/obrazki/2013/05/5e13b37e72b565c6ca83c8b46db172ed_original.jpg?1368001445)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=eUkX75IEkHE[/youtube]
-
(http://24.media.tumblr.com/tumblr_lw9q0dhwNS1qlxohso1_400.gif)
-
(http://img835.imageshack.us/img835/5850/75902925.jpg)
-
(http://forgifs.com/gallery/d/208898-1/90-year-old-double-backflip.gif)
(http://forgifs.com/gallery/d/208871-1/Camo-face-paint-awkward-moment.gif)
(http://forgifs.com/gallery/d/208866-1/Video-game-spank-trap.gif)
(http://forgifs.com/gallery/d/208848-1/Vigilante-robbery-shotgun.gif)
(http://forgifs.com/gallery/d/208782-1/Disappearing-head-illusion.gif)
(http://forgifs.com/gallery/d/155821-5/Kung-fu-bear.gif)
This bear have more talent than me
(http://forgifs.com/gallery/d/208501-1/Reporter-slaps-videobombing-child.gif)
-
(http://i.imgur.com/LGMg1su.jpg)
(http://i.imgur.com/5uBYCVD.gif)
[spoiler](http://i.imgur.com/t01908V.gif)[/spoiler]
-
(http://i.imgur.com/LGMg1su.jpg)
(http://i.imgur.com/5uBYCVD.gif)
[spoiler](http://i.imgur.com/t01908V.gif)[/spoiler]
(http://t0.gstatic.com/images?q=tbn:ANd9GcSTy3I3UlMgd4tMUojrtjq9RzXnMcS6IXF3Nmb35vVEDUW_1w2Xug)
-
lold
-
My old computer has a motherboard of merk SNSV.
I opened the phone fight GIF in Imageready and this is one of the frames. :L
(http://i.imgur.com/C8PlanN.jpg)
-
My old computer has a motherboard of merk SNSV.
I opened the phone fight GIF in Imageready and this is one of the frames. :L
(http://i.imgur.com/C8PlanN.jpg)
lmao
-
(http://i1.kwejk.pl/site_media/obrazki/2013/05/b28b344cd0318270480528e6572fd76a_original.png?1368388112)
-
That's awesome:
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=ZNM0ENUCO5I[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=QwKaObpmTbQ[/youtube]
-
(http://cdn.ebaumsworld.com/mediaFiles/picture/218923/83290999.gif)
-
(http://cdn.ebaumsworld.com/mediaFiles/picture/218923/83290999.gif)
lol
-
[youtube]http://www.youtube.com/watch?v=7rxqz-_feBQ[/youtube]
-
On this page, the EU unveils its secret plans. Now you know why I fled. (first one to guess what I'm talking about gets a cookie)
http://www.robert-schuman.eu/doc/oee/oee-834-en.pdf
-
cba lol
-
You actually don't even have to read anything to find out :blank: (I thought it would be found out by the first on to click the link lol)
-
haha. a perfect europe :L
-
for ush :L
[youtube]http://www.youtube.com/watch?v=sZqS6M1COXQ[/youtube]
-
(http://i.imgur.com/BIsVTq3.jpg)
-
(http://i.imgur.com/b6qG0Nw.png)
-
[youtube]http://www.youtube.com/watch?v=neOTV3wZsSc[/youtube]
-
(http://25.media.tumblr.com/a5b68ef986557a7f3337c16ff9e8e333/tumblr_mmx67wxoWr1qlxohso1_500.jpg)
-
[youtube]KA2Jyp6icg8[/youtube]
-
Busted :L
-
[youtube]tr3ftsCVXhc[/youtube]
Beat juggling and scratching
-
^Excellent.
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=u86bGzYb2Oc[/youtube]
-
[youtube]http://www.youtube.com/watch?v=8wjPZ4ICRz4[/youtube]
-
[youtube]http://www.youtube.com/watch?v=ruqy1kW3apY[/youtube]
-
(http://i.imgur.com/ElE7zZS.jpg)
-
Took him a while to deliver eh
-
(http://i.imgur.com/ElE7zZS.jpg)
(http://images.4chan.org/v/src/1369164531287.jpg)
-
I certainly hope PS wins this time around. If the new XBOX is online-only, Microsoft will have finally pushed their consumers too far.
-
PS won before too lol
i had x360 and sold it and bought ps3 and it's much better
-
[youtube]http://www.youtube.com/watch?v=8wjPZ4ICRz4[/youtube]
Funny trolls by Silvio Santos
(http://3.bp.blogspot.com/_z0Pm9SSLB60/SXEo4Jq_5TI/AAAAAAAAAIQ/dqw7UgU4-J0/s400/silvio%2520santos%25202.jpg)
other by he:
[youtube]http://www.youtube.com/watch?v=QZh3IFp_dTo[/youtube]
~~~~
THE DANCING DEAD
[youtube]http://www.youtube.com/watch?v=xX9gue9vY8U[/youtube]
-
[youtube]http://www.youtube.com/watch?v=KbWgUO-Rqcw[/youtube]
:L
-
"XBOX, GO HOME" :L
-
drunk and awful, can it get worse? yeah, you could be unlucky enough to get one with COD
-
:L LMAO!
Thats what i was complaining about.
This is a fucking gaming console i want to talk about games and hardware not a fucking TV
-
(http://img.myepicwall.com/i/2013/05/4bed7b1ec34db6ce4098a711dcc827a8.jpg?1369473772)
(http://img.myepicwall.com/i/2013/05/eae38a6e9e2d2efc8d3d75a00352bf56.jpg?1369321450)
(http://img.myepicwall.com/i/2013/05/258a6676678ecb6e471b8f1020ee7aab.gif?1369386995)
(http://img.myepicwall.com/i/2013/05/c0ab11670ce55f900231e6425dea8cf6.gif?1369389248)
(http://img.myepicwall.com/i/2013/05/85bddef7f731ebd90d007936cfc21081.jpg?1369389196)
(http://img.myepicwall.com/i/2013/05/0705651e1641c64c29741b33ba527728.jpg?1369143011)
Something for Ush's best song evaaaaaa:
(http://img.myepicwall.com/i/2013/05/e2c372e250983a9122197465302dbb73.jpg?1369210239)
-
(http://img.myepicwall.com/i/2013/05/85bddef7f731ebd90d007936cfc21081.jpg?1369389196)
thom yorke ftw
-
(http://i1.kwejk.pl/site_media/obrazki/2013/05/324c7eb44bee40eadab5cbaa0c55e858_original.jpg?1369490692)
(http://i1.kwejk.pl/site_media/obrazki/2013/05/fea7ee85b90dda667f402e8a759922e7_original.jpg?1369466523)
(http://i1.kwejk.pl/site_media/obrazki/2013/05/46673bc723c6a7cec43a7800368313f1_original.jpg?1369468992)
(http://i1.kwejk.pl/site_media/obrazki/2013/05/519d873cdd938e31185987c7d52dcdef_original.jpg?1369424446)
(http://i1.kwejk.pl/site_media/obrazki/2013/05/4d8bbfed24cefc3f76ce2e1e5c591f23_original.jpg?1369456756)
(http://i1.kwejk.pl/site_media/obrazki/2013/05/ca0f8626e19f1a09c9b0d7a69de966e6_original.jpg?1369402577)
(http://i1.kwejk.pl/site_media/obrazki/2013/05/29f534aaef41e7808aaf57d373e25f58_original.jpg?1369318519)
(http://i1.kwejk.pl/site_media/obrazki/2013/05/7c101a3ea72418977f769bdcc8d040b6_original.jpg?1369387489)
nasty, NSFW cake:
[spoiler]http://i1.kwejk.pl/site_media/obrazki/2013/05/d0de3d129ac23e89e5815aea1f8ce286_original.jpg?1369418418[/spoiler]
-
how to make a giant kinder surprise!
http://imgur.com/a/jPZbQ
-
LMAO
-
[youtube]3LXSajHOx0w[/youtube]
-
fake
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=SAjpecR0j_I#![/youtube]
-
[youtube]http://www.youtube.com/watch?v=c64h4iB645o[/youtube]
Haha yesterday on mumble :D
-
WEeeeeeeeee willl weeeeeeeeeeeee will ROCK YOUUUUUUUUUUUUU
(http://i1.kwejk.pl/site_media/obrazki/2013/06/cba7b996933cdae984d1581a21ea6986_original.jpg?1370164763)
-
LOL :L
-
[youtube]http://www.youtube.com/watch?v=biQh1Q5a7Nk[/youtube]
-
nice Martin
-
(http://i.imgur.com/3eadVOT.jpg)
-
[youtube]http://www.youtube.com/watch?v=DNipTRi7t2o[/youtube]
-
(http://i.imgur.com/d4Izuqt.jpg)
-
http://eater.com/archives/2013/06/03/taco-bell-employee-puts-his-spit-on-a-huge-stack-of-tacos.php
-
not funny but interesting and good made :)
Animated history of Poland
[youtube]http://www.youtube.com/watch?v=2DrXgj1NwN8[/youtube]
-
(http://listelist.com/wp-content/uploads/2013/06/970833_523898447675302_857773071_n-600x421.jpg)
It says "You pick on the generation that beat the police in GTA" from Turkey protests :D
-
http://estonianmoments.tumblr.com/post/48342100913/moment-you-first-time-hear-12-months-in-estonian
-
LoL
;D
-
(https://fbcdn-sphotos-h-a.akamaihd.net/hphotos-ak-prn2/7175_651633968183983_1375705181_n.jpg)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=NmCdZ2LgxRM[/youtube]
-
Haha. 4:30 was very wtf indeed.
-
this was best for me :L
[youtube]http://www.youtube.com/watch?v=FGXDKrUoVrw[/youtube]
-
(http://i.imgur.com/VAMvWsO.png)
-
(http://24.media.tumblr.com/97d5a92d6fdcdf236272bb808e97282f/tumblr_mnybou6V721qlxohso1_500.jpg)
-
lol, the one who did picture , will watch dogs , not the kid :L
-
this was best for me :L
[youtube]http://www.youtube.com/watch?v=FGXDKrUoVrw[/youtube]
Original short movie with this amazing FX ^^ (jan kounen 1990)
[youtube]http://www.youtube.com/watch?v=jwMHD4mteMs[/youtube]
same author : VIbroboy
birth of a superhero ;)
14min 45 ^^
[youtube]http://www.youtube.com/watch?v=9NwEUQGCA40[/youtube]
-
[youtube]http://www.youtube.com/watch?v=Iiyj0Bh44iw[/youtube]
-
I´m stuck in tree :L
(http://www.upload.ee/image/3366945/sa-mp-101.png)
-
lol!
(http://zaujimavosti.info/wp-content/uploads/2013/06/tumblr_mnvv6mmwpV1qz4cuyo1_1280.jpg)
(http://zaujimavosti.info/wp-content/uploads/2013/06/2174235377_9841695580_z.jpg)
(http://zaujimavosti.info/wp-content/uploads/2013/06/440250.jpg)
-
what the fuck
-
vertigo is finally caught..
[youtube]IwYt0Y2A4uM[/youtube]
-
somehow i thought they would use the ceiling or something :L
-
I'm not scum :(
-
>:(
-
(https://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-prn2/8712_504275296311410_875760999_n.jpg)
-
I don't know Portuguese, but for some reason I know exactly what that bird is saying. :L
-
- Take me outta of here you son of a bitch!
- Your mother is a slut !
- Fucking Faggot!
- Go take in your asshole!
-
[youtube]http://www.youtube.com/watch?v=ORUDTs2wMyg[/youtube]
-
:L lol wtf for real:
[spoiler](http://i.imgur.com/RJUFYpv.jpg)[/spoiler]
(Kinda NSFW)
-
wtfffffffffffff .o
(https://fbcdn-sphotos-h-a.akamaihd.net/hphotos-ak-prn2/5909_491222104280659_826697393_n.jpg)
-
:L
[youtube]http://www.youtube.com/watch?v=kWSIFh8ICaA[/youtube]
-
wtfffffffffffff .o
(https://fbcdn-sphotos-h-a.akamaihd.net/hphotos-ak-prn2/5909_491222104280659_826697393_n.jpg)
haha tom almost lost his virginity there
-
:L
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/a3YP2n5_700ba.gif)
Let the hate begin.
-
(http://gamecola.net/wp-content/uploads/2013/03/pc-vs-console.jpg)
-
(http://i.imgur.com/QijIeDN.gif)
(https://fbcdn-sphotos-f-a.akamaihd.net/hphotos-ak-ash3/10543_671461182879693_1849645117_n.jpg)
-
if a brick stops working it can't be used as a brick..
-
if a brick stops working it can't be used as a brick..
(http://i.imgur.com/jLczOeY.jpg)
(http://www.metal-archives.com/images/2/7/1/271_logo.gif)
-
http://www.dumpert.nl/mediabase/6548068/7a82fc4f/index.html#176120381
-
(https://i.chzbgr.com/maxW500/7566062080/h691004C5/)
-
^ lol so true, as it has always been
-
(http://24.media.tumblr.com/568ac3c24af58b5d18debf0d065351f7/tumblr_moamxdGEOr1qlxohso1_500.jpg)
-
Well, watch his Videos. These are fu**ing awesome. But these are the funniest :P
[youtube]http://www.youtube.com/watch?v=YTKXGzKaB5w[/youtube]
[youtube]http://www.youtube.com/watch?v=yO8MdjqhFbQ[/youtube]
And this guy should get a Formula 1 Moderator tbh, his voice and sense of humor. Its really awesome ^^
-
I watch these guys all the time...
[youtube]AYjCXjIeNJk[/youtube]
[youtube]18YLzyK-Kbs[/youtube]
-
birgirpall is icelandic! :D
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/aYbN6zw_460sa.gif)
-
[youtube]http://www.youtube.com/watch?v=89OduOlMc0M[/youtube]
-
Dr. Pepper , the shittiest thing i ever drunk :blank:
-
Dr. Pepper , the shittiest thing i ever drunk :blank:
nooo, dr pepper is nice!
-
Dr. Pepper , the shittiest thing i ever drunk :blank:
nooo, dr pepper is nice!
well , i drunk it for the first time when i was in Ireland , i thought there was nothing worst than the Cherry Cola . i was completely wrong.
-
lol cherry cola ftw
-
first time i drunk CC i had to eat a entire bag of chips to balnce the tastes in my mouth :L
-
(http://i1.kwejk.pl/site_media/obrazki/2013/06/02b4060710d002b36b2ba127297ce558_original.jpg?1371475808)
(http://i1.kwejk.pl/site_media/obrazki/2013/06/16158a61a9d187ad6d2e24663bca646f_original.gif?1371499818)
-
wb max :L
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/anYqABq_460sa.gif)
-
Bollywood ftw :L
-
yea, Bollywood action movies ftw :L
-
(https://fbcdn-sphotos-a-a.akamaihd.net/hphotos-ak-ash3/10590_156773767841312_1263660287_n.png)
Ouzo is about to be caught
-
lmao
-
DO IT
http://img.pr0gramm.com/2013/06/mratngt.gif
-
[youtube]http://www.youtube.com/watch?v=bKgf5PaBzyg[/youtube]
:L
-
[youtube]https://www.youtube.com/watch?v=bKgf5PaBzyg[/youtube]
:L
:L :L :L
-
forgot about deleting s from https, now its fixed
-
LOOOOOOOL :L :L :L :L :L
-
(http://i.wp.pl/a/f/jpeg/31494/pierwsza_komunia_2.jpeg.jpeg)
-
dafuq ^ lol
-
:L
-
[youtube]http://www.youtube.com/watch?v=a2jngmAM17U&feature=youtu.be[/youtube]
Ali always trying to be a real gangsta haha
-
rofl
[youtube]http://www.youtube.com/watch?v=D5tvJWM2qx4[/youtube]
-
How is that even possible?!
-
it's called cz/sk's got talent, he shouldn't even be allowed on it :L
-
[youtube]http://www.youtube.com/watch?v=a2jngmAM17U&feature=youtu.be[/youtube]
Ali always trying to be a real gangsta haha
grove street land lol
-
http://www.joemonster.org/filmy/53569/Romantyk_XXI_wieku
-
http://www.joemonster.org/filmy/53569/Romantyk_XXI_wieku
dafuq
-
[youtube]http://www.youtube.com/watch?v=a2jngmAM17U&feature=youtu.be[/youtube]
Ali always trying to be a real gangsta haha
grove street land lol
Grow Stree Layndz***
-
(http://i.wp.pl/a/f/jpeg/31500/dziwne_slubne_zdjecia_18.jpeg)
-
President of Belarus
(http://s.pikabu.ru/post_img/2013/06/21/12/1371841352_1095533847.jpg)
-
(http://i.imgur.com/jmMR0jV.png)
-
haha, old one
-
(http://rest.api.gface.com/gface-rest/media/stream/get?mediaid=5075217&token=f055954c-1597-4d50-bffa-7f7cf71f92ef)
-
haha i wonder if that's real or fake
guys in microsoft know they had to do this or they wouldn't sell shit :L
-
Cromiell before joining server and bannig people :L
[youtube]http://www.youtube.com/watch?v=vnIux9FM9QE[/youtube]
-
(http://i1.kwejk.pl/site_media/obrazki/2013/06/3f1f627bf4234f7462c5755fc19e8929.gif)
(http://i1.kwejk.pl/site_media/obrazki/2013/06/0fafe1db4b3892c065d583c030c9fb5e.gif)
(http://i1.kwejk.pl/site_media/obrazki/2013/06/a662b5809f67a992558d588238b38097.gif)
(http://i1.kwejk.pl/site_media/obrazki/2013/06/3e94f60a54082a026e0a645bd0b98d95.gif)
(http://i1.kwejk.pl/site_media/obrazki/2013/06/c298f5496ac4413b45b7f486f6678904.gif)
(http://i1.kwejk.pl/site_media/obrazki/2013/06/cba0c14982a06528478b063138f35376.gif)
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=i8Aq4x6K6-8[/youtube]
-
(http://i.imgur.com/uKdtXul.jpg)
-
(http://forums.petrisimolin.com/media/23001/WoW2ForumDead.png)
-
[youtube]http://www.youtube.com/watch?v=Biwk5x5Bkn0[/youtube]
-
(http://img.myepicwall.com/i/2013/06/f37cd0b247088567d2bec41f09d21db0.gif?1372083624)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=0ea_xZpgYXg[/youtube]
Dodger got caught ..
-
Did the bicycle accuse him of raping?
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=rcMe9htQpsg[/youtube]
:L
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=ZoENoMhMjqQ[/youtube]
-
(http://i.imgur.com/NBrRYub.gif)
-
(http://25.media.tumblr.com/7b1a6c4ea97b9c5acf73440b2b235918/tumblr_mp1qo39Li71qlxohso1_500.jpg)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=CyAvJthL-jk#at=232[/youtube]
-
(http://i.imgur.com/EonMkdz.jpg?1)
[youtube]dCEWgk43Pew[/youtube]
-
[youtube]http://www.youtube.com/watch?v=DpDUem6ho2M[/youtube]
-
[youtube]http://www.youtube.com/watch?v=8DexJS9XxCk[/youtube]
:L Strange russian army :D
-
[youtube]http://www.youtube.com/watch?v=PsO8IMrZk18[/youtube]
-
what a stupid trailer
[youtube]http://www.youtube.com/watch?v=S4PPDNL3RGw[/youtube]
-
lol
(http://i1.kwejk.pl/site_media/obrazki/2013/06/acf88855c5c4c736da7d89696dcd8dcb_original.gif?1372462173)
(http://i1.kwejk.pl/site_media/obrazki/2013/06/4b7d4081b6080c45d8d509c55696a0e4_original.jpg?1372350204)
(http://i1.kwejk.pl/site_media/obrazki/2013/06/fbdb5a206444c6d28e7affabbced4109_original.gif?1372422738)
(http://i1.kwejk.pl/site_media/obrazki/2013/06/90ec592d8cfe4d630ffd361183c54290_original.jpg?1372411173)
(http://i1.kwejk.pl/site_media/obrazki/2013/06/c32b2238589fe4dd7143260b94de66d4_original.jpg?1372345681)
(http://img.myepicwall.com/i/2013/06/2d5fb871f36af9903e19ca9cebce0abd.jpg?1372492453)
(http://img.myepicwall.com/i/2013/06/b13933c64ef3ee6cbec112cf8988c6cd.png?1372493430)
(http://img.myepicwall.com/i/2013/06/63e6456d64ddd5fe754a84c89c992350.jpg?1372499688)
(http://img.myepicwall.com/i/2013/06/3d6ae0fa0822d8fc1a3ca25ca1d091be.gif?1372501796)
(http://img.myepicwall.com/i/2013/06/c4ac3f49a47b2ed4148c09faae6f87b1.png?1372500902)
(http://img.myepicwall.com/i/2013/06/772cae899e6320d4a85c1072383f4eb0.jpg?1372431060)
(http://img.myepicwall.com/i/2013/06/26ddcd2747833852e223c2a3beb78587.png?1372422547)
(http://img.myepicwall.com/i/2013/06/90b25b5851e2e61d0245d80f6e4ad965.jpg?1372418992)
(http://img.myepicwall.com/i/2013/06/29490cc136ef4a4e24d1861b9d518769.jpg?1372418992)
(http://img.myepicwall.com/i/2013/06/4f048543013014a733ae824f16b6f06f.gif?1372418492)
(http://img.myepicwall.com/i/2013/06/a884048184b7bf1cc6c8cdabaac39907.jpg?1372323255)
-
lol
[youtube]http://www.youtube.com/watch?v=iXp2ruZoxK8[/youtube]
-
[youtube]VtCtlpWwwt8[/youtube]
Spoooooooky...
-
(https://fbcdn-sphotos-d-a.akamaihd.net/hphotos-ak-prn1/q71/1011163_160106434174712_1527913618_n.jpg)
-
Cheers cokedre ;)
(http://i.imgur.com/Bi4MT1P.jpg)
-
(http://lista10.org/wp-content/uploads/2013/06/fotos-legais-54.jpg)
[youtube]http://www.youtube.com/watch?v=-pwDoXkN2uo[/youtube]
-
(http://s43.radikal.ru/i099/1307/13/649021ddf214.jpg)
-
Cheers cokedre ;)
(http://i.imgur.com/Bi4MT1P.jpg)
(http://i.imgur.com/pVUf8js.png)*
-
Oh crumbs. I even had to create a fake fb profile to use the fb coke app :/ fb automatically capitalizes names :(
http://www.facebook.com/profile.php?id=100006246432925&fref=ts
-
haha
-
(http://i.imgur.com/QuWlyWg.jpg)[spoiler=probably nsfw lol]
(http://f.asset.soup.io/asset/4474/6639_a753.gif)
[/spoiler]
-
lmfao June
-
nice troll :L
-
[spoiler=probably nsfw lol]
(http://f.asset.soup.io/asset/4474/6639_a753.gif)
[/spoiler]
hahahahahahahahahahaha
-
damn so genius! :o
[youtube]http://www.youtube.com/watch?v=VMUtNu-0PRE[/youtube]
-
[youtube]http://www.youtube.com/watch?v=NGwwJEE7k48[/youtube]
:'(
-
damn so genius! :o
[youtube]http://www.youtube.com/watch?v=VMUtNu-0PRE[/youtube]
Serbs style ;)
-
(http://i.wp.pl/a/f/jpeg/31567/goetze_bayern_prezentacja_650.jpeg)
:L
If you dont notice anything:
[spoiler] check logo on each of shirt :P [/spoiler]
-
SO FUNNY h3h3h3h3h3h3hh33h3h3h3hh :-[
-
adidas is bayern sponsor with 9% and that guy wearing nike t-shirt, as bayern fan you should know that
its like drinking pepsi in coca-cola office
-
NSFW
[spoiler][youtube]http://www.youtube.com/watch?v=gYXnngJyzXk[/youtube][/spoiler]
-
NSFW
[spoiler][youtube]http://www.youtube.com/watch?v=gYXnngJyzXk[/youtube][/spoiler]
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
-
wtf xD
-
what the hell..... lol
-
why would you need to dub that? :L
-
so fucking wierd xD porn everywhere....
-
no comments
[youtube]http://www.youtube.com/watch?v=r6VCnYkNYLo[/youtube]
-
[youtube]http://www.youtube.com/watch?v=Eqoq2kBT5Co[/youtube]
-
[youtube]http://www.youtube.com/watch?v=Eqoq2kBT5Co[/youtube]
nice to meet ya Adam :D
-
(http://wac.450f.edgecastcdn.net/80450F/929jackfm.com/files/2013/01/hollywood.jpg)
-
omg when did that happen
-
Fake, but it happened on 14th March 2011 http://www.thepoke.co.uk/2011/03/14/hollywood-sign-hit-by-pranksters/
-
He was being funny haha
-
[youtube]http://www.youtube.com/watch?v=OENj7Z-afhY[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=5EzaZOFTcFQ[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=5EzaZOFTcFQ[/youtube]
(http://dattatecblog.com/wp-content/uploads/2012/01/fuck_yea.jpg)
-
(https://fbcdn-sphotos-a-a.akamaihd.net/hphotos-ak-ash3/10590_156773767841312_1263660287_n.png)
Ouzo is about to be caught
:L :L :L :L :L :L :L :L
-
[youtube]http://www.youtube.com/watch?v=I2kv4Xrtsyc[/youtube]
-
[youtube]http://www.youtube.com/watch?v=I2kv4Xrtsyc[/youtube]
JESUS CHRIST ._. what the hell...
-
do not wonder, just switch off
-
(http://i.wp.pl/a/f/jpeg/31567/goetze_bayern_prezentacja_650.jpeg)
:L
If you dont notice anything:
[spoiler] check logo on each of shirt :P [/spoiler]
another one :D :L
(http://i1316.photobucket.com/albums/t605/zurriequnited/goetze_zps159e6eae.jpg)
-
Götze looks so young :L As well as that guy right on the picture
-
(http://i1316.photobucket.com/albums/t605/zurriequnited/goetze_zps159e6eae.jpg)
(https://encrypted-tbn3.gstatic.com/images?q=tbn:ANd9GcS-4l9vR4NuqZ0cQKXkWpJa0mQMXSKp1mqwUkdBprOqHVF4eZ6y)
-
[youtube]http://www.youtube.com/watch?v=0CsrbzpXTm0[/youtube]
[youtube]http://www.youtube.com/watch?v=kD-f84vgYxM[/youtube]
[youtube]http://www.youtube.com/watch?v=7ffmPu95yAE[/youtube]
-
nigga detected D: <3
-
[youtube]http://www.youtube.com/watch?v=fOLPYG4w7Nc[/youtube]
-
those niggas are fucking crazyy :L :L :L :L
-
[youtube]http://www.youtube.com/watch?v=HLI-3eNj-Pk[/youtube]
-
lol this is iconic
[youtube]http://www.youtube.com/watch?v=rpu47GEzXwo[/youtube]
-
[youtube]http://www.youtube.com/watch?v=fOLPYG4w7Nc[/youtube]
wtf?! :laugh:
-
[youtube]http://www.youtube.com/watch?v=IDDcY4ZFtA4[/youtube]
-
[youtube]http://www.youtube.com/watch?v=fOLPYG4w7Nc[/youtube]
wtf?! :laugh:
those tities bouncing as he dances
(http://24.media.tumblr.com/tumblr_m3qi05XNdY1ruoy68o1_500.gif)
-
[youtube]http://www.youtube.com/watch?v=fOLPYG4w7Nc[/youtube]
wtf?! :laugh:
those tities bouncing as he dances
(http://24.media.tumblr.com/tumblr_m3qi05XNdY1ruoy68o1_500.gif)
fuck i laughed so hard at this.. xDDD
-
[youtube]http://www.youtube.com/watch?v=XvkC4t2d9Ok[/youtube]
Someone translate , what she's saying
-
LMAO dafuq did I just hear XD
-
[youtube]http://www.youtube.com/watch?v=QXPAZJvbH1s[/youtube]
-
[youtube]http://www.youtube.com/watch?v=W_KL1mSq1qQ&feature=player_embedded#at=16[/youtube]
:D
-
lolll
-
Headache cure from now on :laugh: 1:35 LOOOLLLL :L
[youtube]http://www.youtube.com/watch?v=3IB9MNfAz0Y[/youtube]
-
(http://i.minus.com/ivMuEJOYK9wN1.gif)
-
:L
-
[youtube]http://www.youtube.com/watch?v=Oe2NgaoDnBU[/youtube]
CANT STOP LAUGHING ! :D
-
wtf music is real?
-
ah, an old friend and former samp player made a way better song (remember slash_butcher?)
[youtube]http://www.youtube.com/watch?v=-uHl7vMAbA8[/youtube]
-
(http://i.imgur.com/WgyJKEE.jpga)
-
(http://i.imgur.com/WgyJKEE.jpga)
u_u xD
-
(http://i.imgur.com/WgyJKEE.jpga)
true story(http://i.imgur.com/4aNOu.gif)
-
(http://s16.radikal.ru/i190/1307/f9/8a849b88fee2.jpg)
:L
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=GuOm74zSIck[/youtube]
-
so this actually aired on tv...
[youtube]L1JYHNX8pdo[/youtube]
http://tv.msnbc.com/2013/07/12/ktvu-reports-fake-racist-names-of-asiana-airlines-214-pilots/
-
:L :L :L :L :L :L :L :L
-
(http://s018.radikal.ru/i509/1307/f1/a97158cfa65a.jpg)
-
Video made by me in my town :D Name: woman with a mop
here is a photo:
http://s020.radikal.ru/i701/1307/59/598f2ebc11b7.jpg
And here is the video! Watch as 480 :)
In the video, my friend laughs :L
[youtube]http://www.youtube.com/watch?v=JchLWh50jsM[/youtube]
-
(http://s018.radikal.ru/i509/1307/f1/a97158cfa65a.jpg)
what the fuck
-
^ makes no sense lol
-
when you turn out the lights death starts chasing you, so you have to be quick and go to the safety of the bed.
if you reach bed, death is mad and worthless, obviously.
and the hand under the bed... just for the lolz, i assume.
-
(http://cs537308.vk.me/u98835002/doc/73ca5674a8f2/file394.gif)
(http://cs6051.vk.me/v6051365/5637/kaf0eRwgHqQ.jpg)
(http://cs537106.vk.me/u98835002/doc/85433a0ce1af/file397.gif)
(http://cs14115.vk.me/c540107/v540107002/71b1/x5AY3dFbfCQ.jpg)
-
[youtube]http://www.youtube.com/watch?v=oK_asiXX3mM&feature=youtu.be[/youtube]
-
Here's an Italian restaurant I came across while I was away...
(http://i.imgur.com/JoWHJFg.jpg)
-
http://fc08.deviantart.net/fs70/f/2012/097/3/a/bounce_up_and_down_anim_by_griffsnuff-d4vclcg.swf
Annoying stuff! :D
-
The real SEXBOX360....
NSFW http://newsfilter.org/165224
-
mooman on the wrong side of the internet again :L
-
[youtube]http://www.youtube.com/watch?v=lqWhvM8k1Tc[/youtube]
woowww :o
-
(http://i.imgur.com/SzchObZ.jpg)
(http://i.imgur.com/Kw7fr6Z.jpg)
(http://i.imgur.com/ekTBy29.jpg)
(http://i.imgur.com/O553mTa.jpg)
-
http://www.cringechannel.com/2013/07/01/video-extreme-fighting/
-
The real SEXBOX360....
NSFW http://newsfilter.org/165224
http://www.cringechannel.com/2013/07/01/video-extreme-fighting/
what the fuck lol
-
(https://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-ash3/69013_631325173545101_1348384708_n.jpg)
-
MTA vs SAMP :D
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=2e6r-lnlaaQ[/youtube]
-
Lol you are SA-MP then
-
The real SEXBOX360....
NSFW http://newsfilter.org/165224
http://www.cringechannel.com/2013/07/01/video-extreme-fighting/
what the fuck lol
Gotta love a fight that turns into gay sex.
-
The real SEXBOX360....
NSFW http://newsfilter.org/165224
+1 lol
http://www.cringechannel.com/2013/07/01/video-extreme-fighting/
what the fuck lol
Gotta love a fight that turns into gay sex.
-
[youtube]http://www.youtube.com/watch?v=M6HUrko7_qY[/youtube]
-
[youtube]http://www.youtube.com/watch?v=pIJrwP3WavM[/youtube]
-
[youtube]http://www.youtube.com/watch?v=M6HUrko7_qY[/youtube]
This actually looks like a lot of fun...
-
Kitty_[GT] and _[H[N]L]_Kitty.. (http://i.imgur.com/0kFkw7J.jpg) :L
-
(https://encrypted-tbn1.gstatic.com/images?q=tbn:ANd9GcRPtXggZUi-7Mvb-ldKttlg_Rj9eRaQI0VOV7V7qv7N6hwGqsjK)
-
https://www.facebook.com/photo.php?v=1386110384942564
(for facebook user)
-
:L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA :L HAHA
-
In soviet Russia, the Bass drops you! Hah
-
this guy thought he broke his nose, :L was even checking hes teetch :L then he was stuck somewhere between the door and the couch :L :L :L :L :L :L :L :L :L :L :L
-
this guy thought he broke his nose, :L was even checking hes teetch :L then he was stuck somewhere between the door and the couch :L :L :L :L :L :L :L :L :L :L :L
Ye :L :L :L :L But he was sleeping :DDD The bass woke him up >:D
-
[youtube]http://www.youtube.com/watch?v=onZczlPRZNc[/youtube]
-
LOOOLL u.u xDDD :L
-
Haha, where will you be when diarrhea attacks? :L
-
lol @ the video comments, too: "How the hell did i end up here"
yeah martin, what were you doing :L
-
GTA V Gameplay Trailer - Niko's Dramatic Reaction :)
[youtube]http://www.youtube.com/watch?v=1gyS0hQMLPs&feature=youtu.be&t=3m40s[/youtube]
-
[youtube]http://www.youtube.com/watch?v=7EM9DtVQQpg[/youtube]
omg i cant stop laughing :L :L :laugh:
-
wtf
-
lmao :D :L
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/aoz0vLn_700b.jpg)
-
Answer at my video :D
-
(http://i.imgur.com/AWHLRF5.gif)
-
(https://fbcdn-sphotos-e-a.akamaihd.net/hphotos-ak-ash3/556972_517328684989034_1533395121_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=gbaUFY9j1qg[/youtube]
-
(https://fbcdn-sphotos-e-a.akamaihd.net/hphotos-ak-ash3/556972_517328684989034_1533395121_n.jpg)
hmmm?? :o xD
-
(https://fbcdn-sphotos-e-a.akamaihd.net/hphotos-ak-prn1/1013606_518103848244851_153868195_n.jpg)
-
(http://i1.kwejk.pl/site_media/obrazki/2013/07/b4a40ee1dc6b32efbd9a54653b99e39b_original.png?1374233623)
(http://i1.kwejk.pl/site_media/obrazki/2013/07/592b0bfd66cd0f698d4fd89e9e5bc475_original.jpg?1374225855)
(http://i1.kwejk.pl/site_media/obrazki/2013/07/e25fb7f4e3ff671b1394c599994e2a2c_original.jpg?1374223314)
(http://i1.kwejk.pl/site_media/obrazki/2013/07/f9b8fe6ae6179d978c465f3578bd98cb_original.gif?1374183211)
(http://i1.kwejk.pl/site_media/obrazki/2013/07/174212c79690ab26c8a09a619585d477_original.jpg?1374082200)
-
(http://i1.kwejk.pl/site_media/obrazki/2013/07/b4a40ee1dc6b32efbd9a54653b99e39b_original.png?1374233623)
(http://i1.kwejk.pl/site_media/obrazki/2013/07/592b0bfd66cd0f698d4fd89e9e5bc475_original.jpg?1374225855)
(http://i1.kwejk.pl/site_media/obrazki/2013/07/e25fb7f4e3ff671b1394c599994e2a2c_original.jpg?1374223314)
(http://i1.kwejk.pl/site_media/obrazki/2013/07/f9b8fe6ae6179d978c465f3578bd98cb_original.gif?1374183211)
(http://i1.kwejk.pl/site_media/obrazki/2013/07/174212c79690ab26c8a09a619585d477_original.jpg?1374082200)
DAMN IT!! that gif killed me :L :L :L :L :L XDDDDDDDDD
-
no no no no no no no no no you don't need to quote 5 pictures. quote 1 of them or none at all! :(
-
last picture is best :D
-
(http://i1.kwejk.pl/site_media/obrazki/2013/07/f9b8fe6ae6179d978c465f3578bd98cb_original.gif?1374183211)
LIKE THIS? :3 ::)
-
(http://i1.kwejk.pl/site_media/obrazki/2013/07/f9b8fe6ae6179d978c465f3578bd98cb_original.gif?1374183211)
LIKE THIS? :3 ::)
hehehe :D
[youtube]http://www.youtube.com/watch?v=MU1gHX7sG0I[/youtube]
-
(http://cdn.meme.li/instances/300x300/39944305.jpg)
-
(http://i1.kwejk.pl/site_media/obrazki/2013/07/f9b8fe6ae6179d978c465f3578bd98cb_original.gif?1374183211)
LIKE THIS? :3 ::)
hehehe :D
[youtube]http://www.youtube.com/watch?v=MU1gHX7sG0I[/youtube]
poor girl u.u okno .. its funny :L :L :L :L (u.u damn.. im starting to get evil)
-
[youtube]http://www.youtube.com/watch?v=-_xUIDRxdmc[/youtube]
[youtube]http://www.youtube.com/watch?v=1YQAYEmwBvs[/youtube]
-
hahahaha :L :L :L
-
[youtube]http://www.youtube.com/watch?v=mLwrO7blvQo&hd=1[/youtube]
[youtube]http://www.youtube.com/watch?v=C058wv48oms&hd=1[/youtube]
-
[youtube]http://www.youtube.com/watch?v=-_xUIDRxdmc[/youtube]
[youtube]http://www.youtube.com/watch?v=1YQAYEmwBvs[/youtube]
hehe nice videos :L
-
so they built a new tent hall at work but for some reason they forgot about emregency exits and this is how they solved their little problem - they've just added lines and a knife to help you cut a way through :L
(http://s22.postimg.org/u8jallca9/DSC01160.jpg)
(http://s22.postimg.org/8jkehqa29/DSC01159.jpg)
(http://s22.postimg.org/63il3vrzl/DSC01158.jpg)
-
Only in Russia xD
[youtube]http://www.youtube.com/watch?v=IVfI3WdF8vA[/youtube]
-
[youtube]http://www.youtube.com/watch?v=iqjAa4bMP2s[/youtube]
:L :L
-
(http://cs538314.vk.me/u98835002/doc/b924efeaa8f7/file415.gif) :L
-
:L
-
:L
-
Snoopy nice avatar :L
-
[youtube]http://www.youtube.com/watch?v=Z_VkeKXZdKw[/youtube]
-
(http://s4.uploads.ru/8OrQP.gif)
-
The Picture shows how much hours you need to work to buy game in some countries...
(http://get-2.wpapi.wp.pl/a,61764431,f,upload/80/36/fc/51ee3cfd4b9d8_cena_z_zarobkami.jpg)
from top to down:
Poland
Spain
Germany
Finland
United Kingdom
Canada
USA
Norway
Australia
Denmark
-
Only in Russia xD
[youtube]http://www.youtube.com/watch?v=IVfI3WdF8vA[/youtube]
FUCKYEAH xD
-
[youtube]http://www.youtube.com/watch?v=_UfwDEbKfNY&feature=youtu.be[/youtube]
-
[youtube]http://www.youtube.com/watch?v=k-Mr7tycjmo&feature=share[/youtube]
Here at our local rally , some guy got hit in the balls with a rock :L
-
awwwwwwwww
-
This is why men enioy staying single...
[youtube]popi3-_RBPI[/youtube]
-
nsfw
[spoiler](http://lolhehehe.com/wp-content/uploads/2012/12/ImK59.gif)[/spoiler]
-
[youtube]http://www.youtube.com/watch?v=7LP0qzP--3A&feature=youtu.be[/youtube]
-
http://imgur.com/a/Ddy2I
some are NSFW
-
lol this collection is better i think
http://imgur.com/a/tFQdo
also nsfw/racist etc
-
saw this one too, but it had so much of the first one that i decided to not post it.
the link i posted has the best stuff in mid-end.
-
Haha, both of them are great.
Random racism seems kinda unnecessary though lol. Never mind, it's /b/ :L
-
the dart vader's one is bit wtf
do you spell it "X-wing fighter Delicious"?
-
In Captcha it gives you one word you have to get correct, and the other word is for helping scanning in books (where the text-recognition software is struggling). In some cases it's really obvious which word is which (hence one will look like nonsense).
My friend answers the test word correctly and the book word as a rude word, so tomorrow someone will be reading an e-book and it will say something like "He abruptly placed the penismobile on the counter." :L
-
lol this collection is better i think
http://imgur.com/a/tFQdo
also nsfw/racist etc
lol brilliant!
-
In Captcha it gives you one word you have to get correct, and the other word is for helping scanning in books (where the text-recognition software is struggling). In some cases it's really obvious which word is which (hence one will look like nonsense).
My friend answers the test word correctly and the book word as a rude word, so tomorrow someone will be reading an e-book and it will say something like "He abruptly placed the penismobile on the counter." :L
A good plan in theory but I read that they don't rely on just one person's answer which makes sense when you think about it. You can still take advantage of it by only putting in the more legible word though, as it will just assume the other word was too distorted to read.
-
[youtube]http://www.youtube.com/watch?v=HqYAyBNk16A[/youtube]
:L
-
[youtube]http://www.youtube.com/watch?v=dLnRnNg1yVw[/youtube]
-
[youtube]http://www.youtube.com/watch?v=HqYAyBNk16A[/youtube]
:L
LMAO :L
-
[youtube]http://www.youtube.com/watch?v=dLnRnNg1yVw[/youtube]
what the f.... :L
-
The actor was making the slow motion effect :L :L :L :L :L
-
First things I have noticed:
1. Guy attacks first with knife, then pulls gun out of nowhere ("Y U BRING KNIFE TO GUN FIGHT")
2. Woman first attacks with kung-fu, then pulls gun ("oh right, this is serious, better pull my gun now")
3. Woman closes eyes before aiming and shooting
4. He seems to have caught the first bullet with his bare hands, because this is where the blood comes from.
5. Second and third bullet just disappear, although he screams like a little girl
6. Forth bullet is fired, suddenly bullet holes from bullet 2 and 3 appear, but bullet 4 disappears again.
7. Bullet 5 disappears too.
8. After being hit around 2-5 times (can't tell actually) he finally can look at his enemy, but doesn't shoot.
-
Was gonna post it in picture form, but it's funnier as a URL.
AdrenalineX gansta slang version. (http://www.gizoogle.net/xfer.php?link=http://adrenalinex.co.uk/&sa=U&ei=xfn2Uc6sLtS6hAegg4CQDg&ved=0CBkQFjAA&usg=AFQjCNHqOjeEqrN_O6eu4zClUtU0pIW_fw)
-
LMAO brilliant
-
Haha, I'm really impressed at how it makes so much sense.
-
lol
"Da server has been updated ta tha sickest fuckin version of SA-MP, 0.3x"
&
"New joint launched"
Made my day, and it's just 10am
-
where the world goes...
http://store.steampowered.com/app/207090/?l=english
-
it's because i love the WWE but missed attitude era
[youtube]http://www.youtube.com/watch?v=83w0GNJ8sOs[/youtube]
[youtube]http://www.youtube.com/watch?v=rmyxPwczyaI[/youtube]
[youtube]http://www.youtube.com/watch?v=-BUjjoopmZA[/youtube]
[youtube]http://www.youtube.com/watch?feature=player_detailpage&v=Nb-xX498dVQ[/youtube]
-
the dart vader's one is bit wtf
do you spell it "X-wing fighter Delicious"?
that symbol reminds one type of TIE Fighter the Empire was using, specially in frontal view
(http://windblacksky.altervista.org/schede_tecniche/747_TIE_advanced.jpg)
-
(http://i.imgur.com/kL0AUhE.png)
-
[youtube]http://www.youtube.com/watch?v=QF52FW0GyJU[/youtube]
-
[youtube]http://www.youtube.com/watch?v=hmGCwkYsEsc[/youtube]
+ Sup4Real bonus
[youtube]http://www.youtube.com/watch?v=lBGxivEYOaA[/youtube]
[youtube]http://www.youtube.com/watch?v=mHOWs5ISuD8[/youtube]
-
https://www.facebook.com/photo.php?v=558757350855579&set=vb.232014336863217&type=2&theater
how to install GTA V (facebook users only)
-
version non-fb required
[youtube]http://www.youtube.com/watch?v=jS3ZxOtTD5A[/youtube]
-
it's funny for you? ???
-
yes it is. didn't expect that paper and pressing arrows followed by OK gesture
-
RIP laptop :blank:
-
RIP laptop :blank:
and for me the laptop looks like new :-X
-
what a waste of everything, I can't definitively see no fun in that
-
[youtube]http://www.youtube.com/watch?v=3CMQsFwJrPA[/youtube]
-
[youtube]http://www.youtube.com/watch?v=bYP4wKD-6J8[/youtube]
-
kids on AX
(https://fbcdn-sphotos-c-a.akamaihd.net/hphotos-ak-ash4/998734_654280067916889_889071315_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=3CMQsFwJrPA[/youtube]
DAT preview pic!
I need a name. Now.
-
[img]http://24.media.tumblr.com/33f0e508fe93cd859d2065917044319c/tumblr_mqov2qvyNO1qlxohso1_500.jpg[img]
-
Welcome to Brickleberry:
[youtube]http://www.youtube.com/watch?v=9zpWXinvQ-I[/youtube]
-
(http://24.media.tumblr.com/33f0e508fe93cd859d2065917044319c/tumblr_mqov2qvyNO1qlxohso1_500.jpg[img]
[/quote]
[img]http://24.media.tumblr.com/33f0e508fe93cd859d2065917044319c/tumblr_mqov2qvyNO1qlxohso1_500.jpg)
-
Welcome to Brickleberry:
[youtube]http://www.youtube.com/watch?v=9zpWXinvQ-I[/youtube]
(https://encrypted-tbn0.gstatic.com/images?q=tbn:ANd9GcRCP6DK3fAzNrEgTU1xQiSXR69fIiOgdPmhfBWKFpahO-AYe5hE)
-
[youtube]http://www.youtube.com/watch?v=3CMQsFwJrPA[/youtube]
funny pic :D
-
(http://s17.postimg.org/t6mmgutrj/image.jpg) (http://s11.postimg.org/p3pj6utk3/image.jpg) (http://s24.postimg.org/ych1mr0c5/image.jpg) (http://s21.postimg.org/5z3mwsp5z/image.jpg) (http://s15.postimg.org/oz546g5m3/image.png)
-
(http://s11.postimg.org/p3pj6utk3/image.jpg)
(https://encrypted-tbn3.gstatic.com/images?q=tbn:ANd9GcS-4l9vR4NuqZ0cQKXkWpJa0mQMXSKp1mqwUkdBprOqHVF4eZ6y)
-
(http://31.media.tumblr.com/f0e73f910a2f27f3f29a4b764b698917/tumblr_mr2m9oaLbu1qlxohso1_500.jpg)
the devil
-
(http://s11.postimg.org/p3pj6utk3/image.jpg)
(https://encrypted-tbn3.gstatic.com/images?q=tbn:ANd9GcS-4l9vR4NuqZ0cQKXkWpJa0mQMXSKp1mqwUkdBprOqHVF4eZ6y)
lol , best idea ever :o
-
(http://s11.postimg.org/p3pj6utk3/image.jpg)
(https://encrypted-tbn3.gstatic.com/images?q=tbn:ANd9GcS-4l9vR4NuqZ0cQKXkWpJa0mQMXSKp1mqwUkdBprOqHVF4eZ6y)
lol , best idea ever :o
XD INDEED
-
(http://s11.postimg.org/p3pj6utk3/image.jpg)
(https://encrypted-tbn3.gstatic.com/images?q=tbn:ANd9GcS-4l9vR4NuqZ0cQKXkWpJa0mQMXSKp1mqwUkdBprOqHVF4eZ6y)
lol , best idea ever :o
XD INDEED
let's just quote the shit out of the previous post
-
(http://www.abload.de/img/s6o1tmbkk0.gif)
-
I don't understand a shit of it , but so funny to hear them
[youtube]http://www.youtube.com/watch?v=K-Q2kskHBtg[/youtube]
-
(http://s11.postimg.org/p3pj6utk3/image.jpg)
(https://encrypted-tbn3.gstatic.com/images?q=tbn:ANd9GcS-4l9vR4NuqZ0cQKXkWpJa0mQMXSKp1mqwUkdBprOqHVF4eZ6y)
lol , best idea ever :o
XD INDEED
let's just quote the shit out of the previous post
DONE
(http://24.media.tumblr.com/tumblr_m20d2zpUH11qlf5h2o1_500.gif)
-
(http://i.imgur.com/2vZ6Fnt.jpg)
-
fixed the picture for you :P
and lol, i'm gonna preorder that :L
-
first i bought this grid 2 collector edition:
A copy of GRID 2 for PlayStation 3 including bespoke artwork
An actual 170 mph BAC Mono supercar in exclusive GRID 2 livery
A day at the BAC factory, including a factory tour and time spent with technicians to customise the BAC Mono for size and specifications
A GRID 2: Mono Edition-branded Bell Racing helmet
Race suit, boots and gloves, all made to measure in BAC Mono and GRID 2 branding
A PlayStation 3
Did we say AN ACTUAL BAC Mono supercar? Yeah, one of them.
(http://farm3.staticflickr.com/2820/8792592537_d9b8289b85.jpg)
so now it's time for Saints Row IV!
-
fixed the picture for you :P
and lol, i'm gonna preorder that :L
thanks! now i feel like a complete noob, i thought my internet just is too bad to load the image :-[
anyway, someone calculated the costs of that bundle is actually 650-750K, but i guess the arab that's going to buy it won't really care.
-
(https://fbcdn-sphotos-e-a.akamaihd.net/hphotos-ak-ash3/552594_486461131437171_940212925_n.png)
-
[youtube]http://www.youtube.com/watch?v=eo2K6-v0dlc[/youtube]
-
someone will be angry against me :L
[youtube]http://www.youtube.com/watch?v=oqxkxeGF6Mc[/youtube]
[youtube]http://www.youtube.com/watch?v=yhLUFV3pW48[/youtube]
-
:L
(http://cl.jroo.me/z3/7/P/H/d/a.aaa-hear-me-now.jpg) :L
-
[youtube]http://www.youtube.com/watch?v=LpGMmZsqFCA[/youtube]
-
Gonna do it next time the police chases me
(http://24.media.tumblr.com/tumblr_m9epg0zOEj1qdlh1io1_500.gif)
(http://techvela.com/wp-content/uploads/2013/02/tumblr_lmdxc2zSQJ1qbn4k4.jpg)
-
[youtube]http://www.youtube.com/watch?v=xrrpMaN1Bx0[/youtube]
hahahah :L
-
[youtube]http://www.youtube.com/watch?v=xrrpMaN1Bx0[/youtube]
hahahah :L
Lmao :L
-
(https://i.chzbgr.com/maxW500/7732814592/h462DE080/)
-
(http://i.imgur.com/WEC5k0p.jpg)
"all about kurva" lol
-
Payday 2?
-
(http://i.imgur.com/2yJlWHO.jpg)
-
You stole the techniques from Poland.
-
You stole it from us :(
-
Payday 2?
yes
-
bitch please
(http://www.nacion.com/ocio/revista-dominical/HUECO-ABRIO-GENERAL-PARALIZO-TENORIO_LNCIMA20121216_0204_1.jpg)
-
BITCH PLEASE
(http://4.bp.blogspot.com/_29_shKT4Elw/TAipY-NyyGI/AAAAAAAAKSk/x8W_IiN0qXo/s1600/giant-sinkhole-guatemala-city-why_21263_600x450.jpg)
-
thought it's fake at first...
http://www.aolnews.com/2010/06/01/storm-opens-massive-sinkhole-in-guatemala-city/
-
Oh wow yeah, I thought it was fake too. Still hard to believe. :o
-
lol guys watch this lol and in specialy the 12* song queen - we are the champion :L
[youtube]http://www.youtube.com/watch?v=DLkE7Mr7__I[/youtube]
-
[youtube]http://www.youtube.com/watch?v=rkcJtE5prMw[/youtube]
-
(http://i.imgur.com/8wpLt1x.png)
Oh no devil, pls no!
(for retards that dont undertand, look to wins, 4th and other positions =X)
-
[youtube]http://www.youtube.com/watch?v=J7LusWFZK9U[/youtube]
DANGER DANGER!
-
[youtube]http://www.youtube.com/watch?v=egcXvqiho4w[/youtube]
-
[youtube]http://www.youtube.com/watch?v=G2t31AKP3rs[/youtube]
-
[youtube]http://www.youtube.com/watch?v=G2t31AKP3rs[/youtube]
(https://encrypted-tbn1.gstatic.com/images?q=tbn:ANd9GcTIsztuw3NzfYOAA_5uAnivSyyuV9N_RZPH7TT7NcLqcGk7jOz3IQ)
-
ROFL.. DAT ASS!! xDDDDD :L :L :L :L :L :L
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=j_KJuDUqD0w#t=150[/youtube]
-
^ lol that guy lisp so much
ontopic:
(http://i.wp.pl/a/f/jpeg/31827/japonia_upal_afp_600.jpeg)
-
(http://mistrzowie.org/uimages/services/mistrzowie/i18n/pl_PL/201308/1376754318_by_kako.jpg?1376754318)
-
^ lol that guy lisp so much
ontopic:
(http://i.wp.pl/a/f/jpeg/31827/japonia_upal_afp_600.jpeg)
all made in china ffs :L
-
[youtube]http://www.youtube.com/watch?v=Y8QCwIuUzjA&feature=share[/youtube]
Watch this video , i couldn't stop laughing
-
loooooooool
-
I bet he think's that he is in stuntmode and can use speedboost... :L
(http://files1.isnichwahr.com/_nhlfu0823/img/fitted_live/9183505321.jpg)
-
(http://i1316.photobucket.com/albums/t605/zurriequnited/onlymalta_zps5b48d369.jpg)
:D
-
lol.. can't be so worse as in Belgium :L
-
lol.. can't be so worse as in Belgium :L
Galicia (SPAIN)
(http://i.qkme.me/353ljn.jpg)
-
[youtube]http://www.youtube.com/watch?v=qZ9DThV6dnc&hd=1[/youtube]
LMAO
-
(http://i1316.photobucket.com/albums/t605/zurriequnited/onlymalta_zps5b48d369.jpg)
:D
9 days earlier lol
(http://i.imgur.com/2yJlWHO.jpg)
anyway back to topic
(http://i.imgur.com/dabhHa3.jpg)
-
[youtube]http://www.youtube.com/watch?v=qZ9DThV6dnc&hd=1[/youtube]
LMAO
dodga & killer dis is real swag $$
-
young mulla baby
-
tounchi
-
(http://i.imgur.com/nbip9.gif)
-
:L
-
(http://i.imgur.com/TRp21Gi.jpg)
:L
-
lol
-
(http://osvigaristas.s3.amazonaws.com/imagens/miniaturas/largura_780,qualidade_85,limite/6167.jpg)
-
This video will make you hurt while watching:
[youtube]http://www.youtube.com/watch?v=HwtY5g547Ik[/youtube]
-
(http://osvigaristas.s3.amazonaws.com/imagens/miniaturas/largura_780,qualidade_85,limite/6167.jpg)
still better than Ironman - version from 1978 Avengers movie
(http://www.jorymon.com/images/2012/april/the-avengers-78-movie-trailer.jpg)
(http://static1.fjcdn.com/comments/The+1978+Ironman+_0de0cf3f172c5141ef2aaac084ac1e10.jpg)
-
[youtube]http://www.youtube.com/watch?v=3CPh69nKgS0[/youtube]
Watch this lol
-
(https://fbcdn-sphotos-e-a.akamaihd.net/hphotos-ak-ash4/999774_519457964801522_940351333_n.jpg)
:L :L :L
-
(http://i1316.photobucket.com/albums/t605/zurriequnited/nailit_zps6084540e.jpg)
Nailed it haha :L :L :L
tbh, the right one is much more prettier :L
-
[youtube]http://www.youtube.com/watch?v=zEYCPc9P-Q0[/youtube]
-
[youtube]http://www.youtube.com/watch?v=zEYCPc9P-Q0[/youtube]
^ and that, ladies and gentlemen, is how men shave themselves :L
-
(http://31.media.tumblr.com/b276a3cfad27772bb6b8a30d2c908d82/tumblr_mrjmdtgpiv1qdlh1io1_400.gif)
-
LMAO
-
(http://31.media.tumblr.com/b276a3cfad27772bb6b8a30d2c908d82/tumblr_mrjmdtgpiv1qdlh1io1_400.gif)
ROFL :L
-
lóóóóól
-
Fucking bump >:D
https://www.youtube.com/watch?v=zDdIT5czr8Q
-
Fucking bump >:D
https://www.youtube.com/watch?v=zDdIT5czr8Q
awesome stunt.... xD :L
-
Just another day of me, racing on AdrenalineX...
-
Just another day of me, racing on AdrenalineX...
^
(https://fbcdn-sphotos-a-a.akamaihd.net/hphotos-ak-ash3/1240101_436790563097784_1949085317_n.png)
-
[youtube]http://www.youtube.com/watch?v=MW_Hc2AcwBs#t=40[/youtube]
-
(https://dl.dropboxusercontent.com/u/20689087/screens/Desktop/66%2C6.png)
-
You got satan installed on Disk F.
-
Nerd Vandalism
(http://www.naosalvo.com.br/wp-content/uploads/2013/08/nerdvandalismo.gif)
-
In Soviet Russia, the audience knocks you!
[youtube]http://www.youtube.com/watch?v=ZBZH0cyUcgw#t=220[/youtube]
-
(http://img713.imageshack.us/img713/9117/xxj5.jpg) (http://imageshack.us/photo/my-images/713/xxj5.jpg/)
lol
-
Not really funny but quite nice to watch :)
[youtube]http://www.youtube.com/watch?v=ZQv6bPHwRP4[/youtube]
-
Cool video. :D
I am scared to drive the Nurburgring in video games, never mind in real life. :L
-
https://www.facebook.com/photo.php?v=10151678496643876&set=vb.170901143077174&type=2&theater
Hahaha :L
-
(http://s16.postimg.org/ajccx5bld/michael_jackson_mugshot_C_pia.jpg)
-
https://www.facebook.com/photo.php?v=10151678496643876&set=vb.170901143077174&type=2&theater
Hahaha :L
nice hahaha
-
(http://u.mundomemes.com.br/2013/08/201308231pn.gif)
(http://forgifs.com/gallery/d/190175-3/Cocaine-fail.gif)
(http://www.naomesmo.com/wp-content/uploads/2013/08/nao-se-preocupe-ele-nao-vai-morder.gif)
(http://1.bp.blogspot.com/-sUZK9o2hA6Y/UhLX5L9oT2I/AAAAAAAANAs/1uhZMn0EKdk/s1600/2.jpg)
[youtube]http://www.youtube.com/watch?v=wd6QO8JpsCs#t=56[/youtube]
[youtube]http://www.youtube.com/watch?v=CQ4reuo4H8I#t=54[/youtube]
(http://www.largadisso.com/wp-content/uploads/2013/06/fila.gif)
Asians:
[youtube]http://www.youtube.com/watch?v=8RDf1hX7McQ[/youtube]
-
dodger playing adrenalinex
(http://img.pandawhale.com/post-23469-Icy-Rally-Car-Driving-gif-Imgu-dvuX.gif)
-
[youtube]http://www.youtube.com/watch?v=g6R82ZQZQF4[/youtube]
-
(http://img29.imageshack.us/img29/165/n85g.jpg) (http://imageshack.us/photo/my-images/29/n85g.jpg/)
-
lmao @ the black putin :L :L
-
looks like an indian
-
[youtube]http://www.youtube.com/watch?v=aquqJABJWzw[/youtube]
-
Everybody of us needs this. And then we'll do a LAN Party.
(http://d24w6bsrhbeh9d.cloudfront.net/photo/ajrXWP8_460sa.gif)
-
(https://fbcdn-sphotos-h-a.akamaihd.net/hphotos-ak-ash4/p480x480/1233530_663859663627219_64709936_n.jpg)
I wasnt laughing at all that moment lol
-
(http://25.media.tumblr.com/fdb0c3b674c3a5d15c4d7a3e8420a6cf/tumblr_mskrwbOAhm1qdlh1io1_250.gif)
(http://25.media.tumblr.com/2235aaf6a1d8ba1257aa814df77caa30/tumblr_msfggtvynv1qdlh1io1_400.gif)
(http://24.media.tumblr.com/8fef203dd0773416b34afcdd00f8cc8e/tumblr_ms8ac5dOJA1qdlh1io1_r1_400.gif)
(http://31.media.tumblr.com/fb0002809479d8c647e220760f237ac6/tumblr_mrxba6sRlr1qdlh1io1_400.gif)
(http://31.media.tumblr.com/72c82adc7b089067a497fa83fd8c94a2/tumblr_mr8hgmPVko1qdlh1io1_r1_400.gif)
-
(http://24.media.tumblr.com/b07e987f7412c53cfb5758773147e2b0/tumblr_msyk4vNpiU1r3gb3zo1_400.gif)
-
[youtube]http://www.youtube.com/watch?v=iOBSeo1lJEk[/youtube]
-
[youtube]http://www.youtube.com/watch?v=iOBSeo1lJEk[/youtube]
People since you've seen the new video of Miley Cyrus and do not want to use a hammer...
(http://img839.imageshack.us/img839/7254/yjws.jpg)
-
(http://i.imgur.com/D8WfAVf.png)
-
(http://i.imgur.com/0pDri6F.jpg)
-
haha
(http://i.imgur.com/0pDri6F.jpg)
lol
-
omggggggg
[youtube]http://www.youtube.com/watch?v=e6-HYjz2bAw[/youtube]
-
(http://i.minus.com/ibszKGBHCuWybN.gif)
-
omggggggg
[youtube]http://www.youtube.com/watch?v=e6-HYjz2bAw[/youtube]
POOR CHICKEN! ???
(http://www.cuantocabron.com/images/templates/raisins1-template.jpg)
-
(https://dl.dropboxusercontent.com/u/17228246/091213t.gif)
(http://i.imgur.com/Ks1aP91.gif)
-
WTF!!!!!!!???????
(http://1.fwcdn.pl/an/867323/54467.6.jpg)
-
old, but still good. :L
[youtube]http://www.youtube.com/watch?v=i4BYMvVvMg0[/youtube]
-
shit still gets to me
[youtube]http://www.youtube.com/watch?v=29SuuEKztPc[/youtube]
-
(http://i.imgur.com/nQ0pZHV.gif)
-
The most ridiculous GTA Moments hahaha lol :L
http://www.dorkly.com/article/53925/ridiculous-gta-gifs
-
[youtube]http://www.youtube.com/watch?v=VmrlLBbVKcI[/youtube]
LOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOL
-
(http://i.imgur.com/2SLLDPn.jpg)
-
:L
and on x360 you have to pay for playing multiplayer :L :L :L
-
(https://fbcdn-sphotos-c-a.akamaihd.net/hphotos-ak-ash4/1006365_10151869254977604_1616325882_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=z_SQO3vv3p8[/youtube]
-
lol
[youtube]http://www.youtube.com/watch?v=PH1Wd0dXh8Q[/youtube]
-
lol wtf, and just proceed match like nothing happend :L
-
(http://www.rottenecards.com/ecards/Rottenecards_581005_ctz92xxrbx.png)
-
(https://i.chzbgr.com/maxW500/7776399616/h3755C3D9/)
-
[youtube]http://www.youtube.com/watch?v=DL1ASq34jKw#t=73[/youtube]
-
(https://i.chzbgr.com/maxW500/7776399616/h3755C3D9/)
HAH! :L
-
(https://scontent-b-mad.xx.fbcdn.net/hphotos-ash3/q71/994605_151119315098862_1207381729_n.jpg)
-
(http://d3fsqtc6sy2z27.cloudfront.net/uploads/d49b06b2b1d379082294520ba213336f_large)
that ref ran so fast :L
-
(http://i.imgur.com/siOeFFK.png?1)
(http://i.imgur.com/tldGGALh.png?1)
-
(http://ibxk.com.br/2013/9/materias/96882577513163416.jpg)
-
(http://i.imgur.com/siOeFFK.png?1)
(http://i.imgur.com/tldGGALh.png?1)
hahahahaha idiots :L :L :L
-
In biology we call this "natural selection". Too bad this stuff doesn't work anymore today...
-
In biology we call this "natural selection". Too bad this stuff doesn't work anymore today...
survival of the fittest - darwin
-
HUE HUE
Herbert Spencer first used the phrase – after reading Charles Darwin's On the Origin of Species – in his Principles of Biology (1864), in which he drew parallels between his own economic theories and Darwin's biological ones, writing, "This survival of the fittest, which I have here sought to express in mechanical terms, is that which Mr. Darwin has called 'natural selection', or the preservation of favoured races in the struggle for life."[1]
-
:L
-
(https://www.grower.ch/forum/images/smilies/tongue03.gif)
-
anyone gonna buy all DLCs for this game on steam? they are quite cheap :L
(http://i.imgur.com/g0hye7G.png)
-
anyone gonna buy all DLCs for this game on steam? they are quite cheap :L
(http://i.imgur.com/g0hye7G.png)
:blank:
-
thanks miko, i always wanted arthritis in my middle finger!
-
thanks miko, i always wanted arthritis in my middle finger!
lol I scroll with my index finger
-
pointless game
-
thanks miko, i always wanted arthritis in my middle finger!
-
thanks miko, i always wanted arthritis in my middle finger!
lol I scroll with my index finger
same. or sometimes my thumb
-
[youtube]http://www.youtube.com/watch?v=RnAMDg7IVWs[/youtube]
-
thanks miko, i always wanted arthritis in my middle finger!
lol I scroll with my index finger
same. or sometimes my thumb
I have a magic mouse at work. So, theoretically, I could scroll with my dick. I win.
-
have fun http://the100meterscroll.com/
-
Samuel ftw lol
[youtube]http://www.youtube.com/watch?v=uMl9oYSVGlo[/youtube]
-
(http://i.minus.com/iIlPPe6mKbDDX.gif)
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=o_NsSXV5AGY[/youtube]
:O
-
Found this real life racing server...
"Shit race, delete it and block the license" hahah
Just watch the first 30 seconds
[youtube]http://www.youtube.com/watch?v=O46HJbbIWlA#t=30[/youtube]
-
not really a pic/vid, but lol http://answers.yahoo.com/question/index?qid=20080105080551AA5d5Lg
-
[youtube]http://www.youtube.com/watch?v=2sU1TXlxM0A[/youtube]
:L :L :L :L :L :L :L :L :L
-
[youtube]http://www.youtube.com/watch?v=nLwML2PagbY#t=20[/youtube]
-
[spoiler](http://www.chamsko.pl/demot/0_0_36975439_The_goatfucker_przez_napohybel77_middle.jpg)
(http://www.chamsko.pl/demot/0_0_1114589789_Jedziesz_kurwo_przez_Devil666_middle.gif)
(http://www.chamsko.pl/demot/0_0_2024007778_Lezec_suko_przez_xawery_middle.gif)
[/spoiler]
EDIT:
(http://vader.joemonster.org/upload/qgb/11038250d863d6705.jpg)
(http://vader.joemonster.org/upload/qgb/11038374139bde316.jpg)
-
(http://vader.joemonster.org/upload/qgb/11038374139bde316.jpg)
so true
-
[youtube]http://www.youtube.com/watch?v=rB5mQLP3av8[/youtube]
-
[youtube]http://www.youtube.com/watch?v=_8UsxfrKCi8[/youtube]
-
[youtube]http://www.youtube.com/watch?v=tibpUpXsK04[/youtube]
https://www.facebook.com/photo.php?v=204084463107771&set=vb.477237972361719&type=2&theater
:L :L :L :L :L :L :L :L :L :L :L :L :L :L
-
[youtube]http://www.youtube.com/watch?v=X0XRzZOSZMA[/youtube]
-
(http://vader.joemonster.org/upload/qgb/11038374139bde316.jpg)
so true
indeed :L
-
[youtube]http://www.youtube.com/watch?v=iat0ntfPL5s[/youtube]
-
(https://scontent-b-mad.xx.fbcdn.net/hphotos-prn2/1377186_450475195064908_1084565592_n.jpg)
-
(https://fbcdn-sphotos-e-a.akamaihd.net/hphotos-ak-prn2/1393768_535781069835878_1584468512_n.jpg)
:P
-
(https://scontent-b-mad.xx.fbcdn.net/hphotos-prn2/1377186_450475195064908_1084565592_n.jpg)
lol
this is awesome :L
[youtube]http://www.youtube.com/watch?v=0ybX0nqJACc[/youtube]
-
[youtube]http://www.youtube.com/watch?v=VlOxlSOr3_M[/youtube]
-
hah thanks for re-posting :D
-
(http://i.imgur.com/cTgY37a.jpg)
-
( ͡° ͜ʖ ͡°)
-
( ͡° ͜ʖ ͡°)
[youtube]http://www.youtube.com/watch?v=wGlBwW7f5HA[/youtube]
-
(http://i.imgur.com/qrBU29l.png)
-
[youtube]http://www.youtube.com/watch?v=g14FwqxPPpc[/youtube]
-
(http://imag.sector.sk/files/users/disk/177873/3845237/177873-12278-5979.jpg)
-
rofl
-
SA being forgotten a bit, but it's funny
Zombie-plane
[youtube]http://www.youtube.com/watch?v=BPFsHf1MSYw[/youtube]
go to this area, at certain time, use blown vehicles cheat and look how blown up at-400 still struggle to fly
-
In the disney movie Arielle the mermaid are in the opening scene Goofy and Donald! :L :L
But how do they breathe under water?? :L
(http://i.imagebanana.com/img/gmwlczur/donald_and_Goofy_edit.jpg)
also as moving pics
(http://s14.directupload.net/images/131013/832rpa3l.gif)
-
(http://www.baconwrappedmedia.com/wp-content/uploads/2013/01/funny-kids-bacon-wrapped-media-21.jpg)
(http://xaxor.com/wp-content/uploads/2012/10/Funny-Pics-03.10.2012-17.jpg)
(http://www.hdwallpapersinn.com/wp-content/uploads/2013/03/eiffel-tower-funny-girl.jpg)
(http://cl.jroo.me/z3/A/p/B/e/a.baa-Funny-cat-tail.jpg)
-
lesson learned for that kid :L
[youtube]http://www.youtube.com/watch?v=ms3tqDjeENg[/youtube]
-
(http://zaslike.com/files/8df6qqh2t3ht2s2xy9ty.gif)
-
why do you have a picture of my country's prime minister with a mohawk haircut as your signature
-
(http://zaslike.com/files/8df6qqh2t3ht2s2xy9ty.gif)
(http://i.imagebanana.com/img/57io0075/S7zCeIe.gif)
:L :L :L :L :L :L :L :L :L
-
(http://img.myepicwall.com/i/2013/10/fa88036c2d8236c0ac6538a2dae911be.jpg?1381571185)
(http://img.myepicwall.com/i/2013/10/0fd9da47a9c7a353fd407c9e569052eb.gif?1381259587)
-
(http://img.myepicwall.com/i/2013/10/0fd9da47a9c7a353fd407c9e569052eb.gif?1381259587)
(http://i1316.photobucket.com/albums/t605/zurriequnited/lol_zps314cb234.png) (http://s1316.photobucket.com/user/zurriequnited/media/lol_zps314cb234.png.html)
-
why do you have a picture of my country's prime minister with a mohawk haircut as your signature
He is my idol :L
-
why do you have a picture of my country's prime minister with a mohawk haircut as your signature
He is my idol :L
lol wut
-
why do you have a picture of my country's prime minister with a mohawk haircut as your signature
He is my idol :L
lol wut
strange avatar, strange personal text below it and strange signature lol
hmm..
-
yeah ultimate wtf moment
-
why do you have a picture of my country's prime minister with a mohawk haircut as your signature
i hope you are trolling... too obv. it's Travis Brickle (Robert DeNiro) from 'Taxidriver' movie
-
(http://turkeymacedonia.files.wordpress.com/2010/06/nikola-gruevski.jpg)
https://www.google.com/search?q=nikola+gruevski&safe=off&rlz=1C1CHKZ_enMK495MK495&espv=210&es_sm=93&source=lnms&tbm=isch&sa=X&ei=OXZdUpjmGNDasgbb04HgCA&ved=0CAkQ_AUoAQ&biw=1920&bih=979&dpr=1#es_sm=93&espv=210&q=nikola+gruevski&safe=off&tbm=isch&imgdii=_
-
https://www.google.com/search?q=nikola+gruevski&safe=off&rlz=1C1CHKZ_enMK495MK495&espv=210&es_sm=93&source=lnms&tbm=isch&sa=X&ei=OXZdUpjmGNDasgbb04HgCA&ved=0CAkQ_AUoAQ&biw=1920&bih=979&dpr=1#es_sm=93&espv=210&q=nikola+gruevski&safe=off&tbm=isch&imgdii=_
lol @ this
(http://farm3.static.flickr.com/2318/3584290541_ab67e8c966.jpg)
-
[youtube]http://www.youtube.com/watch?v=0iyeUcFKRv4[/youtube]
-
[youtube]http://www.youtube.com/watch?v=vevOWUe_x7Y[/youtube]
-
I'm in love
-
This seems appropriate.
[youtube]http://www.youtube.com/watch?v=HZaAFbT0b5Y[/youtube]
Watch the full movie, it's pretty good lol.
-
[youtube]http://www.youtube.com/watch?v=0iyeUcFKRv4[/youtube]
ha!
-
This seems appropriate.
[youtube]http://www.youtube.com/watch?v=HZaAFbT0b5Y[/youtube]
Watch the full movie, it's pretty good lol.
Is that you , Vertigo ?
-
[youtube]http://www.youtube.com/watch?v=dQLsyYfO5ig[/youtube]
-
This seems appropriate.
[youtube]http://www.youtube.com/watch?v=HZaAFbT0b5Y[/youtube]
Watch the full movie, it's pretty good lol.
Is that you , Vertigo ?
No...;_;
-
[youtube]http://www.youtube.com/watch?v=oYzQu9FG0Ks[/youtube]
-
https://www.google.com/search?q=nikola+gruevski&safe=off&rlz=1C1CHKZ_enMK495MK495&espv=210&es_sm=93&source=lnms&tbm=isch&sa=X&ei=OXZdUpjmGNDasgbb04HgCA&ved=0CAkQ_AUoAQ&biw=1920&bih=979&dpr=1#es_sm=93&espv=210&q=nikola+gruevski&safe=off&tbm=isch&imgdii=_
lol @ this
(http://farm3.static.flickr.com/2318/3584290541_ab67e8c966.jpg)
:L
(http://oi46.tinypic.com/2n85w0w.jpg) When he was young :police:
-
(http://25.media.tumblr.com/tumblr_m52mu7Xeb21r9sda1o1_1280.jpg)
-
[youtube]http://www.youtube.com/watch?v=kMEsBEBypRE[/youtube]
-
Craaaaaig Daaaaavid
-
Craaaaaig Daaaaavid
seven daaaaaaays check it oooooout
-
(http://img689.imageshack.us/img689/7672/lztx.jpg) (http://imageshack.us/photo/my-images/689/lztx.jpg/)
-
( ͡° ͜ʖ ͡°)
[youtube]http://www.youtube.com/watch?v=wGlBwW7f5HA[/youtube]
-
Watch this lol
[youtube]http://www.youtube.com/watch?v=t-qjmsJyFbs[/youtube]
-
haha :L
-
http://www.vice.com/the-vice-guide-to-travel/the-japanese-love-industry
-
http://www.vice.com/the-vice-guide-to-travel/the-japanese-love-industry
http://forum.adrenalinex.co.uk/index.php/topic,5551.msg139095.html#msg139095
-
http://www.vice.com/the-vice-guide-to-travel/the-japanese-love-industry
http://forum.adrenalinex.co.uk/index.php/topic,5551.msg139095.html#msg139095
I found it funny
-
Driving Simulator (RUSSIA):
[youtube]http://www.youtube.com/watch?v=uV59R6Vf72c#t=48[/youtube]
-
lol in Costa Rica this kind of driver usually get gunned down
-
sorry if re-post
(http://joemonster.org/images/vad/a25436_11.gif)
(http://joemonster.org/images/vad/a25436_5.jpg)
(http://joemonster.org/images/vad/a25436_7.jpg)
(http://joemonster.org/images/vad/a25436_12.jpg)
(http://joemonster.org/images/vad/a25436_15.jpg)
-
(http://joemonster.org/images/vad/a25436_12.jpg)
lool
-
WEIRD
http://www.vice.com/the-vice-guide-to-travel/the-japanese-love-industry
-
wtf @ the part with the whore lol
WEIRD indeed, i'm never going to japan
-
[youtube]IHQr0HCIN2w[/youtube]
-
Watch this lol
[youtube]http://www.youtube.com/watch?v=t-qjmsJyFbs[/youtube]
[youtube]PTptuXAEFiA[/youtube]
-
lol what a joey
[youtube]http://www.youtube.com/watch?v=Cn4QBoexWtM[/youtube]
-
(http://24.media.tumblr.com/773ec1e379b41f3d8f201cc64f9a9f60/tumblr_mv2wm0iOnu1sq530qo1_250.gif)
-
(http://lolhehehe.com/wp-content/uploads/2013/10/ASDASD1.jpg)
-
I nearly cried XD
-
lol, that cat's look is priceless
-
(https://fbcdn-sphotos-h-a.akamaihd.net/hphotos-ak-ash4/q71/1393760_524703617624417_75294672_n.jpg)
(https://fbcdn-sphotos-c-a.akamaihd.net/hphotos-ak-prn2/q71/s720x720/1377108_626621990733702_252570346_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=_1XCxeFgwuY[/youtube]
-
uu Ken Box
[youtube]http://www.youtube.com/watch?v=sKOaF7esBFY&list=FLnViAsR78YDScPn2vxlFpoQ&index=1[/youtube]
-
[youtube]http://www.youtube.com/watch?v=tEF6tQUhd5E[/youtube]
-
LMAO
[youtube]http://www.youtube.com/watch?v=fcmrGvNmcV4[/youtube]
-
(http://img.myepicwall.com/2013/10/5021353337f884e3ab55d09a506e8587.gif)
-
lol
-
(http://i.imgur.com/vXEe8Iv.jpg)
This makes me so sad :(
-
one of the biggest clothing websites of Brazil.
(http://images.immedia.com.br//10/10788_2_L.jpg)
-
[youtube]http://www.youtube.com/watch?v=Xq7HV3D6J2M[/youtube]
Hahahahahaah
-
[youtube]http://www.youtube.com/watch?v=v88G1Ly-FuA[/youtube]
-
lol @ adv
(http://i.imgur.com/1xuSxyM.jpg)
-
lol @ adv
http://i.imgur.com/1xuSxyM.jpg
hah!
why the censore btw, what are you hiding? :L
-
[youtube]http://www.youtube.com/watch?v=zxeSCb5Pxc0[/youtube]
[youtube]http://www.youtube.com/watch?v=wtkBHjwUqRs[/youtube]
Rofl
-
the second one is awesome lol
-
hah!
why the censore btw, what are you hiding? :L
because of 'strange' people like simon
-
:L :L :L :L :L
[youtube]http://www.youtube.com/watch?v=jdn80q3r3Dg[/youtube]
-
uu Ken Box
[youtube]http://www.youtube.com/watch?v=sKOaF7esBFY&list=FLnViAsR78YDScPn2vxlFpoQ&index=1[/youtube]
(https://fbcdn-sphotos-h-a.akamaihd.net/hphotos-ak-ash3/536921_433956396716245_1149349650_n.jpg)
-
(http://i1.kwejk.pl/site_media/obrazki/2013/10/743bdb6936004f6187314253548eb05e_original.jpg?1383216039)
(http://img.myepicwall.com/2013/10/26b5c29cdc66cdf4e65dc303fdada202.gif)
(http://img.myepicwall.com/2013/10/b4dedc3639c6c44b4f097989afb3c4b4.gif)
[youtube]http://www.youtube.com/watch?v=KBxSntGGm8U[/youtube]
-
best episode of the new season so far imo! my laughter almost killed me
http://www.southparkstudios.com/full-episodes/s17e05-taming-strange
preview: :L
(http://24.media.tumblr.com/55c799ad8a3fa02163e7eff70259e6e7/tumblr_mvlth0Q89d1rlo1q2o1_400.gif)
-
[spoiler=europe map in pictures](http://i1.kwejk.pl/site_media/obrazki/2013/11/f3ab3533e7a8a11b41a34282064aa3a6_original.jpg?1383307976)[/spoiler]
-
(https://fbcdn-sphotos-h-a.akamaihd.net/hphotos-ak-ash4/q71/1461162_639112589473177_1811548733_n.jpg)
-
(https://fbcdn-sphotos-h-a.akamaihd.net/hphotos-ak-ash4/q71/1461162_639112589473177_1811548733_n.jpg)
Agus...
-
[youtube]http://www.youtube.com/watch?v=eCCrkN6KwPM[/youtube]
-
pay 1400 USD for embrace Justin Bieber and after be treated like animals :L
[youtube]http://www.youtube.com/watch?v=AROdm4v19KQ[/youtube]
-
LOOOOOOOOOOOOOOOOOOL I love this guy
[youtube]http://www.youtube.com/watch?v=4Yx1IuZN5wI[/youtube]
-
:L
-
click on it to see bigger picture
(http://i.imgur.com/aINLbgWl.jpg) (http://i.imgur.com/aINLbgW.jpg)
http://store.steampowered.com/app/238260
-
[spoiler](http://i1.kwejk.pl/site_media/obrazki/2013/11/dbe402cf66131a062aa004c45783e954_original.jpg?1383674305)
(http://i1.kwejk.pl/site_media/obrazki/2013/11/1cb83e3a0eaf596f07386bd3157f4063_original.jpg?1383746018)
(http://i1.kwejk.pl/site_media/obrazki/2013/11/30d5f9877060846edfdc92f5f57c3cbe_original.jpg?1383657071)
(http://i1.kwejk.pl/site_media/obrazki/2013/11/aa2ed37da60b76eec5be4798e3686b4e_original.jpg?1383745446)
(http://i1.kwejk.pl/site_media/obrazki/2013/11/9db697ba736ce90483f87edb32d675bd_original.jpg?1383741634)
(http://i1.kwejk.pl/site_media/obrazki/2013/11/909421e0c87307007a29bc089c32ce35_original.gif?1383671881)
(http://i1.kwejk.pl/site_media/obrazki/2013/11/36e3a0eba77410777c4bc4e0c4ed7066_original.jpg?1383654215)[/spoiler]
-
click on it to see bigger picture
(http://i.imgur.com/aINLbgWl.jpg) (http://i.imgur.com/aINLbgW.jpg)
http://store.steampowered.com/app/238260
hah that sucks lol
-
(http://i1.kwejk.pl/site_media/obrazki/2013/11/135614930a799bf52c1c2cd31339ecee_original.jpg?1383818956)
-
(http://cloud-2.steampowered.com/ugc/903264587013835262/45F158A6845398D18CDBAFF4E05B06C8FE338611/)
-
(http://s17.postimg.org/uflcjp9v3/1355524983814.jpg)
-
(http://imag.sector.sk/files/users/disk/289465/3876777/289465-12408-2246.jpg)
-
:L
-
(http://cloud-2.steampowered.com/ugc/903264587013835262/45F158A6845398D18CDBAFF4E05B06C8FE338611/)
lol
-
^ :L :L :L :L :L :L :L
-
(http://img.myepicwall.com/2013/11/ab40fc19d0804af12fccfcad7acd3e5b.png)
-
[youtube]http://www.youtube.com/watch?v=RHENrNMGQ0A[/youtube]
-
S.U.C.K ▄█▀█▀█▄
MY D1CK ▄█▀ █ ▀█▄
GOOGLE+ ▄█▀ ▀█▄
COMMENTS █ █
█ █
COPY/PASTE ▀█▄▄ █ ▄█▀
THIS SH1T █ ▄▀▄ █
ON EVERY █ ▀ ▀ █
VIDEO █ █
█ █
OR WE'LL NEVER █ █
GET YOUTUBE █ █
BACK █ █
▄█▀▀█▄█▀ ▀ █▄█▀█▄
▄█▀▀ ▀█
█▀ ▀█
█ █
█ ▄█▄ █
▀█ █▀ ▀█ █▀
▀█▄ █▀ ▀█ ▄█▀
▀█▄▄▄█▀▀▀ ▀█▄▄▄█▀
░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░
░█████░█████░█████░█████░█░░░░█████░░
░█░░░░░█░░░█░█░░░█░█░░░░░█░░░░█░░░░░░
░█░███░█░░░█░█░░░█░█░███░█░░░░█████░░
░█░░░█░█░░░█░█░░░█░█░░░█░█░░░░█░░░░░░
░█████░█████░█████░█████░████░█████░░
░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░
░█████░█░░░█░█████░█░░██░░█████░░░██░
░█░░░░░█░░░█░█░░░░░█░██░░░█░░░░░░░██░
░█████░█░░░█░█░░░░░███░░░░█████░░░██░
░░░░░█░█░░░█░█░░░░░█░██░░░░░░░█░░░░░░
░█████░█████░█████░█░░██░░█████░░░██░
░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░
░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░
░░█████░░░░░░░░░███████████████████░░
░░█████░░░░░░░░░███████████████████░░
░░█████░░░░░░░░░███████████████████░░
░░█████░░░░░░░░░█████░░░░░░░░░░░░░░░░
░░█████░░░░░░░░░█████░░░░░░░░░░░░░░░░
░░█████░░░░░░░░░█████░░░░░░░░░░░░░░░░
░░█████░░░░░░░░░█████░░░░░░░░░░░░░░░░
░░█████░░░░░░░░░█████░░░░░░░░░░░░░░░░
░░█████████████████████████████████░░
░░█████████████████████████████████░░
░░█████████████████████████████████░░
░░░░░░░░░░░░░░░░█████░░░░░░░░░█████░░
░░░░░░░░░░░░░░░░█████░░░░░░░░░█████░░
░░░░░░░░░░░░░░░░█████░░░░░░░░░█████░░
░░░░░░░░░░░░░░░░█████░░░░░░░░░█████░░
░░░░░░░░░░░░░░░░█████░░░░░░░░░█████░░
░░███████████████████░░░░░░░░░█████░░
░░███████████████████░░░░░░░░░█████░░
░░███████████████████░░░░░░░░░█████░░
░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░
░░░░░░░░░░░▄▄▄▄▄░░░░░░░░░░░░░░░░░░░░░
░░░░░░░░░▄▄█████████▄▄░░░░░░░░░░░░░░░
░░░░░░▄▀▀▀▀█▀▀▀▀▀▀█████▄░░░░░░░░░░░░░
░░░░▄██████░░░░░░░░░░░▀██░░░░░░░░░░░░
░░░▐██████▌░░░░░░░░░░░░░▐▌░░░░░░░░░░░
░░░███████▌░░░░░░░░░░░░░░█░░░░░░░░░░░
░░▐████████░░░░░░░░░░░░░░░█░░░░░░░░░░
░░▐██████▌░░░░░▄▀▀▀▀▀▄░▀░▄▄▌░░░░░░░░░
░░░█▀▀███▀░░░░░░▄▀█▀░░░▐▄▄▄▌░░░░░░░░░
░░▐░▌▀▄░░░░░░░░░░▄▄▄▀░░░▌▀░▌░░░░░░░░░
░░░▌▐░░▌░░░░░░░░░░░▀░░░░▐░▐ ░░░░░░░░░
░░░▐░▀▄▐░░░░░░░░░░░▌▌░▄▄░▐░▌░░░░░░░░░
░░░░▀█░▄▀░░░░░░░░░▐░▐▄▄▄▄▀▐░░░░░░░░░░
░░░░░▌▀░▐░░░░░░░░▄▀░░▀▀▀▀░▌░░░░░░░░░░
░░░░░▐░░░░░░░░░▌░░░▄▀▀▀▀▄▐░░░░░░░░░░░
░░░░░▌░░░░░░░░░▐░░░░░▄▄░░▌░░░░░░░░░░░
░░░░█▀▄░░░▐░▐░░░░░░░░░░░█░░░░░░░░░░░░
░░░█░█░▀▀▄░▌░█░░░▀▀▄▄▄▄▀░░░░░░░░░░░░░
░░█░░░▀▄░░▀▀▄▄█░░░░░▄▀░░░░░░░░░░░░░░░
░░█░░░░░▀▄░░░░▀▀▄▄▄▀▐░░░░░░░░░░░░░░░░
░░█░░░░░░░▀▄░░░░░▐░▌▐░░░░░░░░░░░░░░░░
░░░█░░░░░░░░▀▄░░░▌░▐▌▐░░░░░░░░░░░░░░░
░░░░█░░░░░░░░░█░▐░▄▄▌░█▀▄░░░░░░░░░░░░
░░░░░█░░░░░░░░░█▌▐░▄▐░░▀▄▀▀▄▄░░░░░░░░
░░░░░░█░░░░░░░░░▀▄░░▐░░░▀▄░░░▀▀▄▄░░░░
░░░░░░░▀▄░▄▀█░░░░░█░░▌░░░░▀▄░░░░░█░░░
░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░
░░░░░░░░░░░░░░░░░▄█▄░░░░░░░░░░░░░░░░░
░░░░░░░░░░░░░░░▄▀░░░▀▄░░░░░░░░░░░░░░░
░░░░░░░░░░░░░▄▀░░░░▄▀█░░░░░░░░░░░░░░░
░░░░░░░░░░░▄▀░░░░▄▀░▄▀░▄▀▄░░░░░░░░░░░
░░░░░░░░░▄▀░░░░▄▀░▄▀░▄▀░░░▀▄░░░░░░░░░
░░░░░░░░░█▀▄░░░░▀█░▄▀░░░░░░░▀▄░░░░░░░
░░░░░▄▀▄░▀▄░▀▄░░░░▀░░░░▄█▄░░░░▀▄░░░░░
░░░▄▀░░░▀▄░▀▄░▀▄░░░░░▄▀░█░▀▄░░░░▀▄░░░
░░░█▀▄░░░░▀▄░█▀░░░░░░░▀█░▀▄░▀▄░▄▀█░░░
░░░▀▄░▀▄░░░░▀░░░░▄█▄░░░░▀▄░▀▄░█░▄▀░░░
░░░░░▀▄░▀▄░░░░░▄▀░█░▀▄░░░░▀▄░▀█▀░░░░░
░░░░░░░▀▄░▀▄░▄▀░▄▀░█▀░░░░▄▀█░░░░░░░░░
░░░░░░░░░▀▄░█░▄▀░▄▀░░░░▄▀░▄▀░░░░░░░░░
░░░░░░░░░░░▀█▀░▄▀░░░░▄▀░▄▀░░░░░░░░░░░
░░░░░░░░░░░░░░░█▀▄░▄▀░▄▀░░░░░░░░░░░░░
░░░░░░░░░░░░░░░▀▄░█░▄▀░░░░░░░░░░░░░░░
░░░░░░░░░░░░░░░░░▀█▀░░░░░░░░░░░░░░░░░
░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░
░█████░█████░█████░█████░█░░░░█████░░
░█░░░░░█░░░█░█░░░█░█░░░░░█░░░░█░░░░░░
░█░███░█░░░█░█░░░█░█░███░█░░░░█████░░
░█░░░█░█░░░█░█░░░█░█░░░█░█░░░░█░░░░░░
░█████░█████░█████░█████░████░█████░░
░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░
░█████░█░░░█░█████░█░░██░░█████░░░██░
░█░░░░░█░░░█░█░░░░░█░██░░░█░░░░░░░██░
░█████░█░░░█░█░░░░░███░░░░█████░░░██░
░░░░░█░█░░░█░█░░░░░█░██░░░░░░░█░░░░░░
░█████░█████░█████░█░░██░░█████░░░██░
░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░
░░░░░░░▄▄▄▄▀▀▀▀▀▀▀▀▄▄▄▄▄▄░░░░░░░░░░░░
░░░░░░░█░░░░▒▒▒▒▒▒▒▒▒▒▒▒░░▀▀▄░░░░░░░░
░░░░░░█░░░▒▒▒▒▒▒░░░░░░░░▒▒▒░░█░░░░░░░
░░░░░█░░░░░░▄██▀▄▄░░░░░▄▄▄░░░░█░░░░░░
░░░▄▀▒▄▄▄▒░█▀▀▀▀▄▄█░░░██▄▄█░░░░█░░░░░
░░█░▒█▒▄░▀▄▄▄▀░░░░░░░░█░░░▒▒▒▒▒░█░░░░
░░█░▒█░█▀▄▄░░░░░█▀░░░░▀▄░░▄▀▀▀▄▒█░░░░
░░░█░▀▄░█▄░█▀▄▄░▀░▀▀░▄▄▀░░░░█░░█░░░░░
░░░░█░░░▀▄▀█▄▄░█▀▀▀▄▄▄▄▀▀█▀██░█░░░░░░
░░░░░█░░░░██░░▀█▄▄▄█▄▄█▄████░█░░░░░░░
░░░░░░█░░░░▀▀▄░█░░░█░█▀██████░█░░░░░░
░░░░░░░▀▄░░░░░▀▀▄▄▄█▄█▄█▄█▄▀░░█░░░░░░
░░░░░░░░░▀▄▄░▒▒▒▒░░░░░░░░░░▒░░░█░░░░░
░░░░░░░░░░░░▀▀▄▄░▒▒▒▒▒▒▒▒▒▒░░░░█░░░░░
░░░░░░░░░░░░░░░░▀▄▄▄▄▄░░░░░░░░█░░░░░░
░░░░░░░░░░░░░░░░░░░░░░▄▄▄▄▄▄▄█░░░░░░░
░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░░
-
(http://img.myepicwall.com/2013/11/ab40fc19d0804af12fccfcad7acd3e5b.png)
:L :L :L :L :L :L :L
-
Epic <3
[youtube]http://www.youtube.com/watch?v=jofNR_WkoCE[/youtube]
[youtube]http://www.youtube.com/watch?v=vyMv4kkSCvk[/youtube]
-
[youtube]http://www.youtube.com/watch?v=nFPqNEHeca0[/youtube]
-
huge thumbs up for american diplomats saying these czech tongue twisters in Prague lol
it can't have been easy for them to learn it
[youtube]http://www.youtube.com/watch?v=loZnmBPI9hI&sns=fb[/youtube]
-
Polish version :L
[youtube]http://www.youtube.com/watch?v=jniKtV-ny5o[/youtube]
-
haha epic :D
-
(http://s17.postimg.org/uflcjp9v3/1355524983814.jpg)
(http://i41.tinypic.com/sf9yk7.jpg)
-
more action and emotions than F1: polish edition of wreck race
[youtube]http://www.youtube.com/watch?v=NIRamh_g-gQ#t=209[/youtube]
-
(http://s17.postimg.org/uflcjp9v3/1355524983814.jpg)
(http://i41.tinypic.com/sf9yk7.jpg)
:L :L :L :L :L :L
-
(http://i.imgur.com/ARLMZYL.jpg)
-
:L
[youtube]http://www.youtube.com/watch?v=CZT0LNwdKCc[/youtube]
-
True polish history
(http://vader.joemonster.org/upload/zbo/3107450faa473b254a683f9230.jpg)
-
if only they taught history this way at school, maybe i'd remember more stuff now :L
-
[youtube]http://www.youtube.com/watch?v=4YfvrVwIIig[/youtube]
-
lol
-
Seems simple but I couldn't hold myself from laughing when I read that lol:
(http://i41.tinypic.com/29lfy9j.png)
-
[youtube]http://www.youtube.com/watch?v=XlUMyKgmy6k[/youtube]
-
lol
[youtube]http://www.youtube.com/watch?v=fa3sCgTNjAA[/youtube]
-
epic for an avatar
(http://files-cdn.formspring.me/photos/20120502/n4fa1a8d5bb48c.jpg)
-
(http://cdn.smosh.com/sites/default/files/bloguploads/family-guy-cheetos.gif)
-
i arrived
(http://s7.postimg.org/xnet5apqz/CHEGUEI.gif)
-
(http://24.media.tumblr.com/38f2f23d248419f12234f11d2ed9439f/tumblr_mw72w3e7WV1sk07bco1_400.gif)
-
this is important
[youtube]http://www.youtube.com/watch?v=5Pn0JKmy5-M[/youtube]
-
this is important
[youtube]http://www.youtube.com/watch?v=5Pn0JKmy5-M[/youtube]
haha I didn't know what to expect
-
(http://cilichili.cz/wp-content/uploads/2013/11/slohovka.jpg)
-
It's masterful!!! How dare this "teacher" give him a 0? O_O
-
0:31 - 0:41 makes me WTF, how someone like that could even think about this
[youtube]http://www.youtube.com/watch?v=2Fl-aU6X7MM[/youtube]
EDIT:
(http://joemonster.org/images/vad/a25818_11.jpg)
-
[youtube]http://www.youtube.com/watch?v=W6DmHGYy_xk&feature=share[/youtube]
HAHAAH
-
[youtube]nITLob098W8[/youtube]
-
Mute.
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=uc59DD-BCDk[/youtube]
-
Mute.
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=uc59DD-BCDk[/youtube]
LOOL i think no one needs a video to do it :L
-
:L
-
Mute.
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=uc59DD-BCDk[/youtube]
LOOL i think no one needs a video to do it :L
stole my words m8, didn't know we needed a video for that XD
-
Look at his other videos and then realize he has > 14.000 subscriptions.
Obviously, some people learned how to turn shit into money.
-
[youtube]http://www.youtube.com/watch?v=ugo7Y2lRsxc[/youtube]
-
[spoiler](http://i1.kwejk.pl/site_media/obrazki/2013/11/eb74be0066dc8e2e35e1eac9f85a4faf_original.jpg?1385547936)[/spoiler]
-
[youtube]http://www.youtube.com/watch?feature=endscreen&NR=1&v=ZclaXQWVRCg[/youtube]
-
NSFW!! but hilarious lol
http://s9.postimg.org/6rdr4iey7/113447.gif
-
LMAO :L
[spoiler=NSFW](http://s9.postimg.org/6rdr4iey7/113447.gif)[/spoiler]
-
Is there any need to re post something or are you just begging for attention again?
-
Is there any need to re post something or are you just begging for attention again?
well... mr tom...
1. how you can understand, I dont live in forums.. that implies that I am NOT checking ONE BY ONE all posts that are made here..
2. at any time i wanted to claim attention from none of you since i am here, if you take it that way its your problem :D if i would want to begg any attention from you i would use "other things"
3. please dont start to provoke me, cause you know i wont shut the fuck up :) its not my problem if this issue gets any longer <3 ;)
-
LMAO :L
[spoiler=NSFW](http://s9.postimg.org/6rdr4iey7/113447.gif)[/spoiler]
Ew.
-
russians..
(http://i.imgur.com/FhZmrLU.jpg)
(http://i.imgur.com/GfSR49D.jpg)
(http://i.imgur.com/hZTkxUK.jpg)
(http://i.imgur.com/U6MIrX5.jpg)
(http://i.imgur.com/PVIjR3f.jpg)
(http://i.imgur.com/oxkQTbK.jpg)
(http://i.imgur.com/QbrghuU.jpg)
(http://i.imgur.com/zEidJuV.jpg)
(http://i.imgur.com/fns9mkS.jpg)
(http://i.imgur.com/zP9mvXi.jpg)
(http://i.imgur.com/HWx2PCB.jpg)
(http://i.imgur.com/pxGv8K7.jpg)
(http://i.imgur.com/KNXHc8U.jpg)
(http://i.imgur.com/U1ocYn2.jpg)
(http://i.imgur.com/XipfSqt.jpg)
(http://i.imgur.com/Hue8hVh.jpg)
(http://i.imgur.com/xvm3I8K.jpg)
(http://i.imgur.com/PNRp7w5.jpg)
(http://i.imgur.com/fwmlTN7.jpg)
(http://i.imgur.com/1YNqZKT.jpg)
(http://i.imgur.com/EmcJTQR.jpg)
(http://i.imgur.com/Kkl6jkx.jpg)
(http://i.imgur.com/mu7UxYb.jpg)
(http://i.imgur.com/x8yvWxI.jpg)
(http://i.imgur.com/1i0FhCL.jpg)
-
lol so true
-
actually I doubt some of those are russians xD
-
supposedly all the photos have been taken from some russian social networks
-
[youtube]http://www.youtube.com/watch?v=fizrFUdaS5c[/youtube]
-
lol
(http://i.imgur.com/rY1MRwk.jpg)
-
[youtube]http://www.youtube.com/watch?v=fizrFUdaS5c[/youtube]
hahaha yeah that's hilarious :L
-
(https://fbcdn-sphotos-d-a.akamaihd.net/hphotos-ak-ash4/1472091_448650755236351_503077170_n.png)
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/aM1E7bG_460sa.gif)
-
[youtube]http://www.youtube.com/watch?v=KIt7vvPfpWA[/youtube]
LOL
-
Czech policeman got bored
[youtube]http://www.youtube.com/watch?v=g9fHqTOYpm4[/youtube]
-
[youtube]http://www.youtube.com/watch?v=cJvqMcflcbQ#t=162[/youtube]
This Guy is a Genius lol
-
"I'm hardcore and I'm bi so i'm allowed to talk about girls body parts" lmaooo
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=Sm5nKR-YJVY[/youtube]
-
(http://i.imgur.com/Wv4GTI9.gif)
[youtube]http://www.youtube.com/watch?v=wwrreWsS3Vs[/youtube]
-
The immortal
(http://leninja.com.br/wp-content/uploads/2013/12/pharrell-williams.jpg)
-
pharell never gets old :( unfair
-
i couldn't click on cromiell video when i saw that ugly frog
-
The immortal
http://leninja.com.br/wp-content/uploads/2013/12/pharrell-williams.jpg
There's even a game: http://www.vulture.com/2013/06/quiz-which-pharrell-is-older.html
I got 5/8 lol.
-
(https://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-prn2/1472990_428656190594731_1285103874_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=Q-GdGAzqLgQ[/youtube]
-
kinda old but it made me laugh anyway :L
(http://i.imgur.com/3OBXUiZ.png)
-
kinda old but it made me laugh anyway :L
(http://i.imgur.com/3OBXUiZ.png)
(http://www.memegenerator.es/imagenes/memes/0/1606464.jpg)
-
I find this to be quite true...
(http://d24w6bsrhbeh9d.cloudfront.net/photo/a3Y4GKv_700b_v1.jpg)
-
2013 in 1 picture
http://joemonster.org/i/2013/12/2013-w-pigulce01.jpg
too big to post here, so putting a link
-
awesome!
-
[youtube]http://www.youtube.com/watch?v=TfUzpaJ_OsI[/youtube]
-
I find this to be quite true...
(http://d24w6bsrhbeh9d.cloudfront.net/photo/a3Y4GKv_700b_v1.jpg)
gamer gurl = slut that doesnt care about games fights, shes just there like a kind of entertainment for men (like those girls that say they love cars and you ask them to change a tire and theyre afraid of breaking a nail)
girl that plays video games = real gamer (when someone makes her go mad xD)
its that simple ^ :D
-
so which are you? the first one of course
-
(http://lh3.ggpht.com/_herGjU-beLI/S5NOHn6JfJI/AAAAAAAAL8Y/vKqqwnSpcaw/HomeroSimpsondrogandose-www.Biokytec.com-cool.gif)
Flyhacks.
-
so which are you? the first one of course
I think that question is more than answered since I joined ax ;) and I think you have several girls to compair with me to determinate which one is which.. :L :L dont make me laugh please
-
[youtube]http://www.youtube.com/watch?v=pQK9W0juEYY[/youtube]
-
so which are you? the first one of course
I think that question is more than answered since I joined ax ;) and I think you have several girls to compair with me to determinate which one is which.. :L :L dont make me laugh please
well, i apologize for my honest opinion :)
-
[youtube]http://www.youtube.com/watch?v=9WoM2bHfr48[/youtube]
:L
-
[youtube]http://www.youtube.com/watch?v=T-D1KVIuvjA[/youtube]
-
x'D
(http://i1303.photobucket.com/albums/ag155/CrazyGirlKitten/1471165_644728208902136_1398731060_n_zps1ff7fb3a.jpg) (http://s1303.photobucket.com/user/CrazyGirlKitten/media/1471165_644728208902136_1398731060_n_zps1ff7fb3a.jpg.html)
(http://static2.wikia.nocookie.net/__cb20120626053154/meme/es/images/a/ab/Exito_meme.jpg)
-
(http://i.imgur.com/afx0iik.jpg)
-
http://fun.drno.de/flash/rocky_is_back.swf
-
(http://i.imgur.com/7Dz4Pxw.jpg)
-
:L
-
lmao! :L
-
http://i.imgur.com/wBF06Xz.png
-
:L
-
http://vinescope.com/the-life-of-juan-tapatio-on-my-taco-1068.html
-
[youtube]http://www.youtube.com/watch?v=ZRMMUC2XVpg[/youtube]
I don't even know..
-
dafuq did i just watch
-
dafuq did i just watch
-
best drift ive ever seen in my life ♥ xD
[youtube]http://www.youtube.com/watch?v=ltpBga3N-_s[/youtube]
-
dafuq did i just watch
-
best drift ive ever seen in my life ♥ xD
[youtube]http://www.youtube.com/watch?v=ltpBga3N-_s[/youtube]
Drifting with 1 horse power, he's a fuckin god
-
[youtube]http://www.youtube.com/watch?v=gsHdrW8xsho[/youtube]
-
nobody can beat us
(http://i.imgur.com/JzkmG0b.jpg)
-
OMG
(https://31.media.tumblr.com/88eb49fe539fae5848e4bda8e6bacaa8/tumblr_mxy4kx2FQI1t5aysno1_500.jpg)
-
[youtube]http://www.youtube.com/watch?v=GsrEPLE7aAY[/youtube]
-
lmaoooo
(http://24.media.tumblr.com/a4f18297bd7ecdba3421c1196602decd/tumblr_mwwbqjdwIp1rbl71oo1_500.jpg)
(http://24.media.tumblr.com/244920233e48af96903732d13870888f/tumblr_myfgzu4inX1r4t7abo1_500.jpg)
-
[youtube]http://www.youtube.com/watch?v=xYIUFEQeh3g[/youtube]
-
http://youtu.be/py3nbsnASgg
-
[spoiler](http://www.chamsko.pl/demot/0_1_48320_Niezle_gowno_przez_arnold77.gif)[/spoiler]
-
Hey guys,
does anyone have $ 152,000 ? If yes, you can buy this UHD-TV
http://www.latimes.com/business/technology/la-fi-tn-samsung-4k-tv-150000-20131230,0,1017210.story#axzz2p2F2Q9bl (http://www.latimes.com/business/technology/la-fi-tn-samsung-4k-tv-150000-20131230,0,1017210.story#axzz2p2F2Q9bl)
Kind Regards
Plato :L
-
Back 2 Topic:
(https://fbcdn-sphotos-f-a.akamaihd.net/hphotos-ak-ash3/1524801_10200342338920246_661133313_n.jpg)
-
haha this is so hilarious!! best 7 minutes of the day :L
[youtube]http://www.youtube.com/watch?v=ile2mDiofWw[/youtube]
-
And what if milk buys you?
[youtube]http://www.youtube.com/watch?v=m84M71FRdbw[/youtube]
-
[youtube]http://www.youtube.com/watch?v=-T2r5XZQqIs[/youtube]
That music video
-
[youtube]http://www.youtube.com/watch?v=-T2r5XZQqIs[/youtube]
That music video
Dafuq did I see.. :blank:
Lol that black guy with his fake dildo :L :L
I
-
Polish girl ;)
-
O M G
[youtube]http://www.youtube.com/watch?v=N6ihCQZK-r0[/youtube]
-
(http://i1.kwejk.pl/site_media/obrazki/2014/01/5ec15a000dd828d1a35ae07ee602f701_original.jpg?1389004018)
-
Click on the picture to see it in big uncesored version
WARNING: it's NOT really nice and certainly NSFW :L
(http://www.agresori.com/data/26118/maly/nahledy/2.jpg) (http://www.agresori.com/data/26118/2.jpg)
-
[youtube]http://www.youtube.com/watch?v=VH_m6bTTRJ4[/youtube]
[youtube]http://www.youtube.com/watch?v=IVgnTU03qoM[/youtube]
-
lol
[youtube]http://www.youtube.com/watch?v=n7mEth2EzG8[/youtube]
-
LOOL almost 45 minutes? Seriously?
[youtube]http://www.youtube.com/watch?v=Ida5tdWYZRs[/youtube]
-
lol imagine a few people put so many effort into that 45min movie.. lol!
-
ye, however kinda lame... gta and waiting for green lights... ok
meanwhile, chuck norris mario
(http://1.bp.blogspot.com/-2lE0bqBHndw/UWuW6ZCG38I/AAAAAAAAOZI/e5VSDw4Jww8/s400/chuck+norris.gif)
-
[youtube]http://www.youtube.com/watch?v=s97_TFLYVYU[/youtube]
-
looooooooooooool :L
-
[youtube]http://www.youtube.com/watch?v=XREnvJRkif0[/youtube]
Watch this video with speed 2 ( settings at right bottom)
-
rofl :L :L
-
lol
-
[youtube]http://www.youtube.com/watch?v=sPJ0UOCDjJA[/youtube]
HAHAHAAHAHAHA
-
[youtube]http://www.youtube.com/watch?v=Fmban3Fio14[/youtube]
[youtube]http://www.youtube.com/watch?v=3wIr6oI2s14[/youtube]
-
lol
[youtube]http://www.youtube.com/watch?v=ABrv4qlyItw[/youtube]
-
(https://i.chzbgr.com/maxW500/7993944064/h1ED24F96/)
-
how many times would Marv and Harry die in real life lol
[youtube]http://www.youtube.com/watch?v=8WKgNyvsNDM[/youtube]
-
(http://mistrzowie.org/uimages/services/mistrzowie/i18n/pl_PL/201312/1386581517_by_dzianyxd.jpg?1389030328)
-
Ha!
-
lol that's funny
[youtube]http://www.youtube.com/watch?v=oCB1ac4jIrE[/youtube]
-
dafuq lol
[youtube]http://www.youtube.com/watch?v=lkqtQ61k58E[/youtube]
[youtube]http://www.youtube.com/watch?v=mJB4jyr0gQ8[/youtube]
-
[youtube]http://www.youtube.com/watch?feature=player_detailpage&v=0RClFPv5r-0#t=1[/youtube]
-
massive respect
http://9gag.tv/v/2752
-
[youtube]http://www.youtube.com/watch?v=YI-MIhsx1xg[/youtube]
-
[youtube]http://www.youtube.com/watch?v=beROUHV5jPc[/youtube]
-
(http://maneggs.com/wp-content/uploads/2011/02/superheros1.jpg)
(http://maneggs.com/wp-content/uploads/2010/08/mario.jpg)
(http://maneggs.com/wp-content/uploads/2009/10/grouch_12b.jpg)
(http://maneggs.com/wp-content/uploads/2009/04/scissors.jpg)
(http://maneggs.com/wp-content/uploads/2009/02/tooth_fairy_15b.jpg)
(http://maneggs.com/wp-content/uploads/2008/11/swan_lake_22.jpg)
le grand finale
(http://maneggs.com/wp-content/uploads/2014/01/cat_meeting.jpg)
-
[youtube]http://www.youtube.com/watch?v=72ITLaTvypc[/youtube]
2:00 Min
-
(http://i40.tinypic.com/zn8xv8.png)
-
[youtube]http://www.youtube.com/watch?v=UQQRkNbNTw8#t=65[/youtube]
-
[youtube]http://www.youtube.com/watch?v=TCpOoAFfcEA[/youtube]
-
[youtube]http://www.youtube.com/watch?v=TCpOoAFfcEA[/youtube]
people are so stupid sometimes lol
-
SPAM SPAM SPAM
[youtube]http://www.youtube.com/watch?v=s3zjRcMnRNY[/youtube]
[youtube]http://www.youtube.com/watch?v=YuOBzWF0Aws[/youtube]
-
Brilliant haha!
-
lmaooooo
[youtube]http://www.youtube.com/watch?v=3X1bc4kNLHI[/youtube]
-
suprising how two shits of commercial are so similar
(http://i1.kwejk.pl/site_media/obrazki/2014/01/8a1d8f064ec52baf9c3f9ed96aa07003_original.gif?1390505032)
-
[youtube]http://www.youtube.com/watch?v=pIJrwP3WavM[/youtube]
-
haha!
(http://weknowmemes.com/wp-content/uploads/2012/11/if-you-type-coughing-into-google-images.jpg)
-
(http://i.imgur.com/vghEWml.gif)
-
(http://i.imgur.com/vghEWml.gif)
So true that it hurts
-
just dont put it on your tongue and youll be alright xDDDD :L :L :L :L :L :L :L
[youtube]http://www.youtube.com/watch?v=pVQySyAuNXQ[/youtube]
-
Why do people bother reuploading other people's videos, trying to make profits from someone else is ridiculous
-
Why do people bother reuploading other people's videos, trying to make profits from someone else is ridiculous
1. cause people like her upload videos like those cause they want and they are big enough to know what theyre doing (making laugh is their intention) ;)
2. cause this is a "funny videos/pictures" post ;)
3. Why do people like you complain for a simple thing like that just cause its me, and just to try to claim for attention ^^?
And I could even say more: what profits should someone get making this? wtf... Is this suppost to lead to some kind of profits? think with the right head boy.. and calm down...
-
Erm, yes they can profit from it if they get advertising offers from youtube obviously.
As for attention seeking I'm not one to attention seek like yourself, I use to be, not anymore I'm better than that.
People like me have an opinion and you should respect it as much as I respect yours.
-
Yes, people shouldn't be re-upping videos that aren't theirs because aside from profiting from stolen ad revenue it's just plain plagiarism. But to be fair this isn't the first re-upped video posted here, and considering the videos are embedded and many of us use AdBlock, nothing is lost really. :L
-
I love when someone answers their own question lol
Why do people bother reuploading other people's videos
trying to make profits
-
(http://i.imgur.com/zpn2ClT.jpg)
-
I love when someone answers their own question lolWhy do people bother reuploading other people's videos
trying to make profits
mooman strikes again lol
-
(http://i1.kwejk.pl/site_media/obrazki/2014/01/61a20f74dac6843c787edc4bbdbe3c7c_original.png?1390744834)
(http://i1.kwejk.pl/site_media/obrazki/2014/01/38137d294ddc2e6c8eb16c24c2597e26_original.jpg?1390733608)
-
[youtube]http://www.youtube.com/watch?v=tsN4u5UZqno[/youtube]
[youtube]http://www.youtube.com/watch?v=rRqKYXcL-2U[/youtube]
Za duzo popitku pane bramkarku
[youtube]http://www.youtube.com/watch?v=jDEN_8ehXmo[/youtube]
[youtube]http://www.youtube.com/watch?v=bvbEuPVtVNc[/youtube]
-
Erm, yes they can profit from it if they get advertising offers from youtube obviously.
As for attention seeking I'm not one to attention seek like yourself, I use to be, not anymore I'm better than that.
People like me have an opinion and you should respect it as much as I respect yours.
did i say in any moment that video was mine? ... its useless to keep on arguing about this...
(http://m.memegen.com/kv0gyf.jpg)
-
[youtube]http://www.youtube.com/watch?v=jDEN_8ehXmo[/youtube]
:L yeah that's great lol
and dafuq is this :L :L
[youtube]http://www.youtube.com/watch?v=I9OJBO62TtU[/youtube]
-
(http://i1.kwejk.pl/site_media/obrazki/2014/01/102869ea4ace9b2cbe5b7368a33b4a62_original.jpg?1390755434)
(http://i1.kwejk.pl/site_media/obrazki/2014/01/727ee1e1a0b09277cc39d18285db938d_original.gif?1390672550)
(http://i1.kwejk.pl/site_media/obrazki/2014/01/0bf76dd742cd171f513891c23b8b73cf_original.jpg?1390783878)
-
screw tunnel of love, this must be better
(http://i1.kwejk.pl/site_media/obrazki/2014/01/381efd38a8c55033b7aacd3a7a4fbba8_original.jpg?1390826006)
(http://i1.kwejk.pl/site_media/obrazki/2014/01/06375cc4483c90effe62963bcc468d26_original.jpg?1390817611)
(http://i1.kwejk.pl/site_media/obrazki/2014/01/65056db59cfa45046e33244c99cdfac5_original.jpg?1390773036)
(http://i1.kwejk.pl/site_media/obrazki/2014/01/37855348370615920de7984df337e1e7_original.png?1390744871)
(http://i1.kwejk.pl/site_media/obrazki/2014/01/d3ec27dc2b24958166b3b13a904395a1_original.jpg?1390737387)
(http://i1.kwejk.pl/site_media/obrazki/2014/01/83ed8cbd146aa431e37aacf87654bd65_original.jpg?1390737304)
-
(http://i1.kwejk.pl/site_media/obrazki/2014/01/83ed8cbd146aa431e37aacf87654bd65_original.jpg?1390737304)
lol - i laughed hard into that one
btw
[youtube]http://www.youtube.com/watch?v=9nJcO-kekS4[/youtube]
[youtube]http://www.youtube.com/watch?v=Tr9KoXwm7qA[/youtube]
-
(http://i.imgur.com/TUs6Huy.jpg)
-
Haha, took me a while to get that one. :L
-
[youtube]http://www.youtube.com/watch?v=m4luHEVjqKA[/youtube]
-
(https://fbcdn-sphotos-a-a.akamaihd.net/hphotos-ak-prn2/1623645_446626972131182_1602351047_n.jpg)
-
Is this fun?
(http://i.imgur.com/9KJW6rn.png)
-
[youtube]wzuJj85C3lw[/youtube]
-
[youtube]http://www.youtube.com/watch?v=HVA3g0vDDLM[/youtube]
[youtube]http://www.youtube.com/watch?v=C9a38irX48o[/youtube]
[youtube]http://www.youtube.com/watch?v=y-WqmVsdEZw[/youtube]
-
Normal life of not famous superhero.
[youtube]http://www.youtube.com/watch?v=s0OAu5fbvtM[/youtube]
-
hahahaha
[youtube]http://www.youtube.com/watch?v=zMdua8D8iAs[/youtube]
-
(https://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-frc1/t1/1796499_594675223952364_1033252916_n.jpg)
-
Lol facebook! A picture I "liked"?
-
nope lol just saw it on facebook but not from what you liked
-
:(
-
How do you do?
Hope, you are fine! I am good, because I can send this letter to you! Okay, My name Anastasiya, I am 28, but I don't have prince in real life. And you? My friends say about me, that I am sociable woman. I have many friends, but they are only friends.
I have many outside interests. We can chat about our interests and more, if you will answer me. I will send to you my photo, hope you will like my image. Please write me back soon! I will be wait your letter. Best regards.
Yours new friend Anastasiya.
-
Polish drivers having fun:
[youtube]http://www.youtube.com/watch?v=1jHfcgFAuUs[/youtube]
-
[youtube]http://www.youtube.com/watch?v=3cc12dU1u0Y[/youtube]
Also, is it just me who can only see Miley Cyrus? The other person goes too fast for me lol
suprising how two shits of commercial are so similar
(http://i1.kwejk.pl/site_media/obrazki/2014/01/8a1d8f064ec52baf9c3f9ed96aa07003_original.gif?1390505032)
-
made it slower for you :P
(http://i.imgur.com/GhZI4Rn.gif)
-
ahhhh lol, idk how i didn't see it now that i know
-
[youtube]WgTQglGvNUs[/youtube]
-
lmao wtf
[youtube]http://www.youtube.com/watch?v=rl12afrfLD8[/youtube]
-
Satan, take him away from us.
-
(https://scontent-b-lga.xx.fbcdn.net/hphotos-prn1/t1/1524581_10202764621216646_2050114557_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=wsvymV8C2zs[/youtube]
-
[youtube]http://www.youtube.com/watch?v=c0n97rxE76I[/youtube]
-
(https://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-prn1/t1/524095_363233667054730_185972558_n.jpg)
(https://fbcdn-sphotos-e-a.akamaihd.net/hphotos-ak-ash3/t1/561803_368370736541023_1627681769_n.jpg)
(https://scontent-a-lga.xx.fbcdn.net/hphotos-ash2/t1/554293_371277349583695_332212067_n.jpg)
(https://fbcdn-sphotos-a-a.akamaihd.net/hphotos-ak-prn2/t1/426004_426111820766914_993523903_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=2vcJibyBRAM[/youtube]
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/awrOGb4_460sa.gif)
-
[youtube]http://www.youtube.com/watch?v=eiJWCJc4Oec[/youtube]
-
[youtube]http://www.youtube.com/watch?v=0WNOPW63k3o[/youtube]
That's me
-
oh you're an invalid youtube link... interesting XD
-
[youtube]http://www.youtube.com/watch?v=1V0Pt-aSPQE[/youtube]
(http://www.chamsko.pl/demot/0_1_50416_Kaaaabum_p_przez_templar1983.gif)
(http://www.chamsko.pl/demot/0_1_50245_Bohater_przez_ChamskiBuszmen0105.gif)
-
oh you're an invalid youtube link... interesting XD
woops lol , fixed it
-
this is my favourite tweet ever
(http://i.imgur.com/kpuW2Xb.jpg)
-
[youtube]http://www.youtube.com/watch?v=kSiV5HlsKNo[/youtube]
[youtube]http://www.youtube.com/watch?v=D3CFc95E_ns[/youtube]
[youtube]http://www.youtube.com/watch?v=lkGFw7gzgkQ[/youtube]
[youtube]http://www.youtube.com/watch?v=TatWY5HknuE[/youtube]
-
7 years ago today
(https://24.media.tumblr.com/d00216232ee1877ca2c63c912b1e509a/tumblr_mfrstxOVDn1qkh06wo1_500.gif)
-
??? bad topic?
-
This town is where i always go to on summer holiday, i laughed my ass off :L
[youtube]http://www.youtube.com/watch?v=2LRK5VVBaQk[/youtube]
-
[youtube]http://www.youtube.com/watch?v=ejr20TbPBms[/youtube]
-
http://steamcommunity.com/sharedfiles/filedetails/?id=229343410
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=qCBsJ673tRI[/youtube]
LOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOL
-
STILL GOING!!
(http://i.imgur.com/83bFtu0.png)
-
I hope you're not sitting in front of the PC though.
-
I am.
-
(http://img.myepicwall.com/2014/02/3bb7b4d631ac643783196baa2a5ee945.gif)
(http://img.myepicwall.com/2014/02/74fadb6258fe3bf7c6301c1ab43930f5.jpg)
(http://img.myepicwall.com/2014/02/332d7369af98daa29392e201a74d64d0.gif)
(http://img.myepicwall.com/2014/02/05db20feb6af76bd7cbfc62c9a70b411.gif)
(http://img.myepicwall.com/2014/02/4b23fb2392d9a70a4d821c0bdb147a10.jpg)
-
lmaoooo
[youtube]http://www.youtube.com/watch?v=ZprNwUFCHpM[/youtube]
-
That's really good idea Mr. DHL :L
[youtube]http://www.youtube.com/watch?v=vHVWegNfQl0[/youtube]
Phobos, something for you:
[youtube]http://www.youtube.com/watch?v=5NueJsN2luA[/youtube]
[youtube]http://www.youtube.com/watch?v=MuyMuLGXxTs[/youtube]
-
its 5 posts above yours
-
fixed
-
I'm not saying the police aren't prejudiced, but that "Black Guy Breaks Into A Car" video is very biased.
Firstly, the white guy is wearing new designer clothes, while the black guy is wearing a dark scruffy tracksuit. The black guy's expression and body language looks like he's trying to steal a car whereas the white guy looks like he is poking a car with a stick while pulling silly faces. And finally, the black guy is going after the white guy so they had already drawn attention to the car and people may remember the same car is associated with another person.
Sorry, I would have posted it on Youtube but my commenting ability has been revoked because I didn't join Google+ lol. :L
-
(http://i.wp.pl/a/f/gif/32804/wpadki_sportowcow_25.gif)
(http://i.wp.pl/a/f/gif/32807/wpadki_sportowcow_41.gif)
(http://i.wp.pl/a/f/jpeg/32807/wpadki_sportowcow_18.jpeg)
(http://i.wp.pl/a/f/gif/32807/wpadki_sportowcow_38.gif)
(http://i.wp.pl/a/f/jpeg/32807/wpadki_sportowcow_29.jpeg)
(http://i.wp.pl/a/f/gif/32804/wpadki_sportowcow_31.gif)
(http://i.wp.pl/a/f/gif/32804/wpadki_sportowcow_23.gif)
(http://i.wp.pl/a/f/gif/32807/wpadki_sportowcow_42.gif)
(http://i.wp.pl/a/f/gif/32805/trolling_like_a__boss.gif)
(http://i.wp.pl/a/f/jpeg/32807/wpadki_sportowcow_13.jpeg)
-
(http://i.imgur.com/DO3XZKg.png)
-
[youtube]http://www.youtube.com/watch?v=kRq2M_AaMjs[/youtube]
-
classic! :police:
-
[youtube]http://www.youtube.com/watch?v=kRq2M_AaMjs[/youtube]
-
(http://i.imgur.com/9EPjv74.jpg)
-
time to dump
balls of steel?
(http://img.myepicwall.com/2014/02/5988fc17a942af9b98394afb1f53e373.gif)
awsom joke evah!
(http://img.myepicwall.com/2014/02/5f6527a7bf0d038f0d1cc84667790737.gif)
screw you stevie jobs!
(http://img.myepicwall.com/2014/02/6b7281f6fb2caf4c7eca0404ba4fb02d.jpg?1393432789)
classic advert
(http://img.myepicwall.com/2014/02/0b808052990518a7100021d1e5a2cb4e.gif)
(http://img.myepicwall.com/2014/02/80b0e54ce480c17efe834a40c3e16189.jpg?1393418728)
(http://img.myepicwall.com/2014/02/d4ea265228a5987b2d7af0848875464d.jpg?1393418638)
(http://img.myepicwall.com/2014/02/624d8b6a8d3f449c65fb134a60b44518.png?1393412035)
(http://img.myepicwall.com/2014/02/fb593eb0ed1cf17367fe610ec9c144fb.jpg?1393362206)
[spoiler=nsfw?](http://img.myepicwall.com/2014/02/a506e0dfcc36a2db5170f96ad8d53a2a.jpg?1393362139)[/spoiler]
loved them classic toon show
(http://img.myepicwall.com/2014/02/0ba7ce8916a1da83e0de544ed59393a0.jpg?1393362051)
driving blind? why not
(http://img.myepicwall.com/2014/02/4cb446f89d28ec2167b1b5d08dfcf664.gif)
(http://img.myepicwall.com/2014/02/ad871868c8c51993582a1a9fd8ab945c.gif)
(http://img.myepicwall.com/2014/02/e76bc3db542ef90a11eb42af52cd473a.png)
(http://i0.kym-cdn.com/photos/images/newsfeed/000/512/435/65f.jpg)
(http://img.myepicwall.com/2014/02/3b409dcf9932e7b9e86e8a1d432d3e3b.gif)
(http://img.myepicwall.com/2014/02/a5495cb880d1d22ffb43d41d395a4351.jpg)
[spoiler=brutal, but may find it funny (dark humour tho)](http://img.myepicwall.com/2014/02/e98af00ddce4e112d92eec4a58b534d9.gif)[/spoiler]
-
bizarre germans
[youtube]http://www.youtube.com/watch?v=jxVcgDMBU94[/youtube]
-
(http://i.imgur.com/x0LfmsR.jpg)
-
(http://i38.photobucket.com/albums/e114/adiarmstrong/e9cdfb73700967a562199c21ffc0f8d61ff282b27ea00ba099c41c1e016a8c2f1_zps9c0eef5c.jpg) (http://s38.photobucket.com/user/adiarmstrong/media/e9cdfb73700967a562199c21ffc0f8d61ff282b27ea00ba099c41c1e016a8c2f1_zps9c0eef5c.jpg.html)
-
I think my pc is trying to tell me something, lol
(http://i61.tinypic.com/5uebtl.png)
btw, it says " Cant connect to the internet" :I
-
(https://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-ash3/t1/923513_10152364501033714_928041655_n.jpg)
-
MadMax, what's the reason of this? People say it's because the car is happy seeing its owner:
[youtube]http://www.youtube.com/watch?v=a8m9T9WhQYA[/youtube]
-
(http://i.nahraj.to/f/Cl6.jpg)
-
(https://fbcdn-sphotos-a-a.akamaihd.net/hphotos-ak-ash3/t1/1513710_10202571402399660_2075397476_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=FpuJSe398Uc[/youtube]
Hahaha
-
Cromiells be like...
(http://i.imgur.com/7tEr1KN.jpg)
-
lol
-
(http://24.media.tumblr.com/ad174409145b9ebc1c7c64403cdc7345/tumblr_n1cwjeU6t81r41unfo1_250.gif)
-
(http://i.imgur.com/j120e61.jpg)
-
haha! Friends - nazi version :L
[youtube]http://www.youtube.com/watch?v=sEGeHxF0tF4[/youtube]
-
[youtube]http://www.youtube.com/watch?v=cNY-53TtObE[/youtube]
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/av0vE0n_700b.jpg)
-
haha! Friends - nazi version :L
[youtube]http://www.youtube.com/watch?v=sEGeHxF0tF4[/youtube]
loool :L
-
lmfao
-
this always makes me laugh :L
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=GuH-ULZ69DM[/youtube]
-
(http://i.wp.pl/a/f/jpeg/32899/mem1.jpeg)
(http://i.wp.pl/a/f/jpeg/32899/mem6.jpeg)
(http://i.wp.pl/a/f/jpeg/32899/mem5.jpeg)
(http://i.wp.pl/a/f/jpeg/32900/mem10.jpeg)
(http://i.wp.pl/a/f/jpeg/32900/mem9.jpeg)
(http://i.wp.pl/a/f/jpeg/32899/mem8.jpeg)
-
this is never not funny
[youtube]http://www.youtube.com/watch?v=jJfpjY10mIA[/youtube]
-
(http://www7.pic-upload.de/09.03.14/dkfnt4er2rw.png)
hm lol
-
Don't take it personal :L
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/awr39jW_700b.jpg)
-
I found a nice town in spain. :L :L
Google Maps
(http://s14.directupload.net/images/140310/jiuwou2c.png)
Google StreetView
(http://s1.directupload.net/images/140310/soen4wdy.png)
-
Hah zero, thats cool, happens sometimes
-
lol i just saw few minutes ago, that we both have the same time :blank:
-
haha!
[youtube]http://www.youtube.com/watch?v=ZlPoPMbiffU[/youtube]
-
lol this is just perfect
+ masturbating in future:
[youtube]http://www.youtube.com/watch?v=I60BhhL9H30[/youtube]
-
(http://i1.kwejk.pl/site_media/obrazki/2014/03/af912b6d41bee572f0ea86bd5a16eb56_original.gif?1394732891)
wtf???
(http://i1.kwejk.pl/site_media/obrazki/2014/03/402b528ce676fff94c57ed1df6a242a1_original.jpg?1394707643)
(http://i1.kwejk.pl/site_media/obrazki/2014/03/dab4c207a0feaa1ca96d710187d981c8_original.jpg?1394694851)
-
(https://dl.dropboxusercontent.com/u/20689087/emoticons/wololo.png)
-
who the hell came up with this shit :L
(http://i.imgur.com/QsGV2HY.gif)
(http://i.imgur.com/pB5N3C9.jpg)
(http://i.imgur.com/1fdunv9.jpg)
(http://i.imgur.com/yL1XnpQ.jpg)
(http://i.imgur.com/56lmQeC.jpg)
(http://i.imgur.com/ngPjAFi.gif)
(http://i.imgur.com/sabynzG.jpg)
(http://i.imgur.com/NdFSQmA.jpg)
(http://i.imgur.com/HOILO9C.jpg)
(http://i.imgur.com/zyui2mB.jpg)
-
[youtube]http://www.youtube.com/watch?v=98LoiMZ59Jw[/youtube]
and wtf? beans on bread with milk?! ???
[youtube]http://www.youtube.com/watch?v=nViWpVc1x_4[/youtube]
-
[youtube]http://www.youtube.com/watch?v=eFJWrDCeOa0[/youtube]
-
^ :L :L :L
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=4y7JsvOtYcw[/youtube]
-
Always knew mooman was a good dancer lol
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=4y7JsvOtYcw[/youtube]
Couldn't watch that with headphones on, felt too weird lol
-
(http://i.imgur.com/kocCTAX.jpg)
-
Oh, don't get me started on Jaden Smith...
(http://cdnl.complex.com/mp/620/400/80/0/bb/1/ffffff/8cc59ffbad91652bcb5e1c531b99f278/images_/assets/CHANNEL_IMAGES/TECH/2013/11/jaden-smith-dumbest-tweets/fllqc_jadensmithdumbtweet_01_765281.jpg)
(http://cdnl.complex.com/mp/620/400/80/0/bb/1/ffffff/cfae183e34dc6c51040e0577cb37a6bd/images_/assets/CHANNEL_IMAGES/TECH/2013/11/jaden-smith-dumbest-tweets/zxbvw_jadensmithdumbtweet_02_765281.jpg)
(http://cdnl.complex.com/mp/620/400/80/0/bb/1/ffffff/29c01b6f247b5f20a487d7872db12c75/images_/assets/CHANNEL_IMAGES/TECH/2013/11/jaden-smith-dumbest-tweets/ymqmu_jadensmithdumbtweet_03_765281.jpg)
(http://cdnl.complex.com/mp/620/400/80/0/bb/1/ffffff/23d4bdaf01bda51cef29827049f451ec/images_/assets/CHANNEL_IMAGES/TECH/2013/11/jaden-smith-dumbest-tweets/uyqnr_jadensmithdumbtweet_04_765281.jpg)
(http://cdnl.complex.com/mp/620/400/80/0/bb/1/ffffff/35cfa40bcf514e5c2619b3edc2ef1716/images_/assets/CHANNEL_IMAGES/TECH/2013/11/jaden-smith-dumbest-tweets/keyvt_jadensmithdumbtweet_05_765281.jpg)
(http://cdnl.complex.com/mp/620/400/80/0/bb/1/ffffff/7c26d8ac7621fd42551a30ec91e3eb16/images_/assets/CHANNEL_IMAGES/TECH/2013/11/jaden-smith-dumbest-tweets/zbedx_jadensmithdumbtweet_06_765281.jpg)
(http://cdnl.complex.com/mp/620/400/80/0/bb/1/ffffff/ee6e9f461e1dc089694c5971860011a8/images_/assets/CHANNEL_IMAGES/TECH/2013/11/jaden-smith-dumbest-tweets/ddoix_jadensmithdumbtweet_07_765281.jpg)
(http://cdnl.complex.com/mp/620/400/80/0/bb/1/ffffff/0faf427a7fcfdd50c3bec08d7de0b689/images_/assets/CHANNEL_IMAGES/TECH/2013/11/jaden-smith-dumbest-tweets/rfcpa_jadensmithdumbtweet_09_765281.jpg)
(http://cdnl.complex.com/mp/620/400/80/0/bb/1/ffffff/09885f69e112d383643595b355e4b6d8/images_/assets/CHANNEL_IMAGES/TECH/2013/11/jaden-smith-dumbest-tweets/fkhnb_jadensmithdumbtweet_10_765281.jpg)
(http://cdnl.complex.com/mp/620/400/80/0/bb/1/ffffff/271058d5ecefdc7139e84155aa130c79/images_/assets/CHANNEL_IMAGES/TECH/2013/11/jaden-smith-dumbest-tweets/dvnhb_jadensmithdumbtweet_12_765281.jpg)
(http://cdnl.complex.com/mp/620/400/80/0/bb/1/ffffff/99962ba5bfd634655273d96b8be7d5a7/images_/assets/CHANNEL_IMAGES/TECH/2013/11/jaden-smith-dumbest-tweets/jalth_jadensmithdumbtweet_13_765281.jpg)
(http://cdnl.complex.com/mp/620/400/80/0/bb/1/ffffff/8b93babb28b8845a9a2756879f13b893/images_/assets/CHANNEL_IMAGES/TECH/2013/11/jaden-smith-dumbest-tweets/pkrbe_jadensmithdumbtweet_14_765281.jpg)
-
this is so iconic
[youtube]http://www.youtube.com/watch?v=RzDr18UYO18[/youtube]
-
Oh that's Katie from Coronation Street
-
Oh that's Katie from Coronation Street
lmaooooo
-
:L
[youtube]http://www.youtube.com/watch?v=w3pmG_8rl_E[/youtube]
:L
[youtube]http://www.youtube.com/watch?v=PGHfTstfWwk[/youtube]
:L
-
(https://fbcdn-sphotos-e-a.akamaihd.net/hphotos-ak-prn2/t1.0-9/970829_716582015053769_268319163_n.jpg)
-
MadMax, is that your car? :L
[youtube]http://www.youtube.com/watch?v=X7wBFoMuqfs[/youtube]
-
no, but now know what wannna for xmass!
-
LOOOOOOL
[youtube]http://www.youtube.com/watch?v=mWQ-GvVpus4[/youtube]
-
Still a better song than rebecca black's friday :L
-
(http://img.ibxk.com.br/2014/3/materias/3750283491510411-t640.jpg)
-
FOX News was showing some pictures from twitter and they found something they weren't looking for (Live broadcast):
[youtube]http://www.youtube.com/watch?v=5PAPced8IjU[/youtube]
-
[youtube]http://www.youtube.com/watch?v=e74BB7jSoL4[/youtube]
Listen that laugh
-
[youtube]http://www.youtube.com/watch?v=H8slqbNdacM[/youtube]
:L :L
-
ha
-
He totally nailed the "Ohhhhhhhhhhhhhhhhhhhhh..." at 0:50 and the "Ahahahahahah" at the end. :L
-
nsfw
[youtube]http://www.youtube.com/watch?v=NtpwUyN-0-Y&list=UUR4s1DE9J4DHzZYXMltSMAg[/youtube]
-
(https://scontent-a-fra.xx.fbcdn.net/hphotos-ash3/t1.0-9/1966801_716251185099535_2002405199_n.jpg)
:L :L :L :L
-
so interesting:
[youtube]http://www.youtube.com/watch?v=xrdHe__tt3U[/youtube]
-
Had a workout in gym
(http://i60.tinypic.com/sfdxck.jpg)
-
this is awesome! AC/DC played on cello :D
[youtube]http://www.youtube.com/watch?v=uT3SBzmDxGk[/youtube]
-
(http://img.myepicwall.com/2014/03/6cc9290b0e4c45793db19ed0d0e2ce7c.gif)
(http://img.myepicwall.com/2014/03/9837d7ef1f768c48130fe4fc5b4834d6.jpg?1395683942)
-
the girl with 2d face.
(http://i.imgur.com/E0Abf.jpg)
-
lol
-
(http://i.wp.pl/a/f/jpeg/32986/test_n_5.jpeg)
(http://i.wp.pl/a/f/jpeg/32986/test_n_2.jpeg)
(http://i.wp.pl/a/f/jpeg/32986/test_n_10.jpeg)
(http://i.wp.pl/a/f/jpeg/32986/test_n_22.jpeg)
(http://i.wp.pl/a/f/jpeg/32986/test_n_14.jpeg)
(http://i.wp.pl/a/f/jpeg/32986/test_n_20.jpeg)
(http://i.wp.pl/a/f/jpeg/32986/test_n_15.jpeg)
-
just.... lolete
[youtube]http://www.youtube.com/watch?v=t3xJeUNpDOA[/youtube]
-
lmfao
-
just.... lolete
http://www.youtube.com/watch?v=t3xJeUNpDOA
what the hell were you looking for on youtube when you found this? :L
-
WTF
-
(http://i200.photobucket.com/albums/aa264/tdpirate2/n00b-1.jpg)
-
lmao she's amazing
[youtube]http://www.youtube.com/watch?v=jx7oJLmhgL0[/youtube]
-
The main reason why I don't play DayZ anymore...
(http://d24w6bsrhbeh9d.cloudfront.net/photo/apq8qDE_700b_v1.jpg)
-
test drive of polish truck 'Jelcz'
if you can't understand, don't worry, all he say is flamming and offensive language without much of sense
[youtube]http://www.youtube.com/watch?v=IGyMqsCR-Ww[/youtube]
-
(https://scontent-a-lga.xx.fbcdn.net/hphotos-prn1/t1.0-9/p403x403/10151935_295368790627548_1042141670_n.jpg)
-
Lol!
Same can be said about GTA:Online imo.
-
(https://scontent-a-lga.xx.fbcdn.net/hphotos-prn1/t1.0-9/p403x403/10151935_295368790627548_1042141670_n.jpg)
lol
stalin took selfie on 17th September.
-
Rappers Delight by NBC :L
https://www.youtube.com/watch?v=-YCeIgt7hMs (https://www.youtube.com/watch?v=-YCeIgt7hMs)
-
Haha, Plato that's excellent. That's the best video of that kind I've seen.
-
lol this is epic
[youtube]http://www.youtube.com/watch?v=iiTE3tfe7qM[/youtube]
and new rémi gaillard :D
[youtube]http://www.youtube.com/watch?v=dDuxFSpwj0M[/youtube]
-
Meanwhile in Vertigo land...
(http://i.imgur.com/FGY83lw.jpg)
-
Alaska > Australia
-
(http://i.imgur.com/S5xZz6I.gif)
:L
-
I'm not really sure what's worse in this video. The idotic girl blocking the left line with a maniac behaviour or the instant karma. Probably both (action after the 1:00):
[youtube]http://www.youtube.com/watch?v=3XqZoaWKv2k[/youtube]
Remi, oh Remi:
[youtube]http://www.youtube.com/watch?v=dDuxFSpwj0M[/youtube]
-
(http://i.imgur.com/S5xZz6I.gif)
:L
[youtube]http://www.youtube.com/watch?v=btwG0E4xke0[/youtube]
classic :L
-
indeed :L
-
[youtube]http://www.youtube.com/watch?v=elIAMgSulWM[/youtube]
-
LOLETE, it's blocked in my country :L
-
here too
-
Does this work for you?
[youtube]http://www.youtube.com/v=elIAMgSulWM[/youtube]
-
Remi, oh Remi:
[youtube]http://www.youtube.com/watch?v=dDuxFSpwj0M[/youtube]
4th post above yours lol
and new rémi gaillard :D
[youtube]http://www.youtube.com/watch?v=dDuxFSpwj0M[/youtube]
-
I'm blind for the 2nd time.
-
http://www.youtube.com/watch?v=aPlf6JXpuSo#t=294
:L maybe nsfw
-
lol asians
Does this work for you?
[youtube]http://www.youtube.com/v=elIAMgSulWM[/youtube]
nope
-
http://www.youtube.com/watch?v=aPlf6JXpuSo#t=294
:L maybe nsfw
ha!
-
(http://24.media.tumblr.com/09895ff97e943135a5cc49e8afaec73f/tumblr_n1klu34WTx1r1yhiqo1_500.png)
(http://25.media.tumblr.com/65ed9ab7d66904fd05f030352ff0d8ba/tumblr_n1klu34WTx1r1yhiqo2_500.png)
(http://25.media.tumblr.com/5cc69e8c7ece461974d956e0f24f90fe/tumblr_n1klu34WTx1r1yhiqo3_500.png)
(http://24.media.tumblr.com/54ffe45b7df3aff761635785a10eef2f/tumblr_n1klu34WTx1r1yhiqo4_500.png)
(http://24.media.tumblr.com/3015625cb24c63b2d21acbb37c609da5/tumblr_n1klu34WTx1r1yhiqo5_500.png)
-
(https://dl.dropboxusercontent.com/u/20689087/screens/DIE/2014-03-29.jpg)
-
[youtube]http://www.youtube.com/watch?v=EwVj8ilHLkw[/youtube]
-
(http://25.media.tumblr.com/d34ef2c41ea43c2d2637c960f92c75e5/tumblr_n3b2xvJdMm1scn6d0o1_500.jpg)
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/agyj6En_460s.jpg)
-
is that really Gabe? :L
-
[youtube]http://www.youtube.com/watch?v=dvWGLcdI8o8[/youtube]
-
[youtube]http://www.youtube.com/watch?v=dvWGLcdI8o8[/youtube]
[youtube]http://www.youtube.com/watch?v=-o2gPstZ5oA[/youtube]
[youtube]http://www.youtube.com/watch?v=vmPsgxcuSEQ[/youtube]
-
[youtube]http://www.youtube.com/watch?v=vmL72sgVdAQ[/youtube]
Vertigo and his brother at the train station
-
[youtube]aUeQRm0TyoE[/youtube]
-
[youtube]aUeQRm0TyoE[/youtube]
i saw the banner of Jorrovi Calçados, it's in Paraná (where i born), a state in south of Brazil.
-
read adverts and corresponding titles
(http://joemonster.org/images/vad/img_27571/ecc216472271f7ecf7c96b9262b7256b.jpg)
(http://joemonster.org/images/vad/img_27571/2f3471c4bf448cf34b00ad033028d58c.jpg)
(http://joemonster.org/images/vad/img_27571/ff928673ea245a506b5d531873c796b3.jpg)
(http://joemonster.org/images/vad/img_27571/cd2eb80a9f32ae801f1b88a4abb34a9a.jpg)
(http://joemonster.org/images/vad/img_27571/3c2971f0f2115aa94ff9b049016b9e27.jpg)
(http://joemonster.org/images/vad/img_27571/386ca0af9261dddbaeb92190cc17fb49.jpg)
(http://joemonster.org/images/vad/img_27571/663ac391d7bf05b9687c4d4d78aa0365.jpg)
(http://joemonster.org/images/vad/img_27571/d52e4e12d4afde9e630818295b45f3a4.jpg)
(http://joemonster.org/images/vad/img_27571/00a076ee0eb289bf0ef20a9930f09be2.jpg)
(http://joemonster.org/images/vad/img_27571/7b12210f31d2f0a0cef55b7b124184c8.jpg)
(http://joemonster.org/images/vad/img_27571/f9acd5fe385dddae3e450348b19f733a.jpg)
and gifs
[spoiler]
(http://i3.kym-cdn.com/photos/images/original/000/676/038/96f.gif)
(http://i1.kwejk.pl/site_media/obrazki/2014/04/b092361876565a5e87771051b15a69d8_original.gif?1396531335)[/spoiler]
-
(https://pbs.twimg.com/media/BkS2N2EIMAEu3_U.jpg:large)
-
(http://i3.kym-cdn.com/photos/images/original/000/676/038/96f.gif)
ouchhhhhhh :L
-
Saw this in shop today :L
Special for Uuuush!
(http://cs616220.vk.me/v616220716/923b/5dsIkXhGQyU.jpg)
-
OMFG
(https://31.media.tumblr.com/e46307d70c4f21deef81c048d55624fc/tumblr_mvl8kbukZN1r3gb3zo1_400.gif)
-
OMFG
(https://31.media.tumblr.com/e46307d70c4f21deef81c048d55624fc/tumblr_mvl8kbukZN1r3gb3zo1_400.gif)
Good, there's still hope!!!
-
Saw this in shop today :L
Special for Uuuush!
(http://cs616220.vk.me/v616220716/923b/5dsIkXhGQyU.jpg)
hahaha I am glad that they are selling my underwear in Russia as well :)
-
prepare to have your ears raped! :L
[youtube]http://www.youtube.com/watch?v=k21nZsf6kHM[/youtube]
-
^ lol what the hell :L
-
how sexy is this car?
(https://scontent-b-mia.xx.fbcdn.net/hphotos-prn2/t1.0-9/p720x720/10154211_10152410692242448_2732614344399253295_n.jpg)
-
Funny looking car
-
German car plate 8)
German car plates actually offer a lot of room for creativity :L
(http://img169.imageshack.us/img169/2/647s.jpg)
WHORE
(http://www.witzige-kennzeichen.de/images/sexyhase.jpg)
SEXY BUNNY
(http://www.witzige-kennzeichen.de/images/KUH%20(BILD).jpg)
Perfect car for mooman.
(http://lustigekennzeichen.de/wp-content/uploads/2012/02/37443_404884502554_324958872554_4565358_589084_n1.jpg)
CUNT
(http://www.beeindruckendes.de/Humor/Images/PkwKennzeichen/PKW-Kennzeichen_01.jpg)
STOP (probably read that too late...)
(http://lustigekennzeichen.de/wp-content/uploads/2012/02/MUELL1.jpg)
TRASH
There are a lot more, too lazy to post more...
-
(http://i.imgur.com/RTQAhsV.jpg)
(http://i.imgur.com/j4cfl9o.jpg)
(http://i.imgur.com/ZHoxjBa.jpg)
(http://i.imgur.com/f3NobN5.jpg)
(http://i.imgur.com/ndWE25A.jpg)
(http://i.imgur.com/xFckSHd.jpg)
(http://i.imgur.com/JjfwvJ2.jpg)
(http://i.imgur.com/wSiBQsB.jpg)
(http://i.imgur.com/vAqoMFY.jpg)
(http://i.imgur.com/vJRuJtt.jpg)
(http://i.imgur.com/bJni7tk.jpg)
(http://i.imgur.com/uQSkGZ9.jpg)
(http://i.imgur.com/GIxaowT.jpg)
(http://i.imgur.com/besuThn.jpg)
(http://i.imgur.com/RlSw2kC.jpg)
(http://i.imgur.com/O7Ox8h0.jpg)
(http://i.imgur.com/eQXKF64.jpg)
(http://i.imgur.com/9GOB2nr.jpg)
(http://i.imgur.com/4JS0j74.png)
(http://i.imgur.com/r5Zhu6n.jpg)
-
(http://i.imgur.com/j4cfl9o.jpg)
we still do that sometimes when we're drunk lol
-
2 years ago we were trolling people this way that they ordered a taxi and it is waiting. Reactions were kinda funny :L
-
this time only one, but really epic one.
actually this isn't NSFW, (even if seems like for 1st few seconds) but spoilering it anyway
[spoiler]
(http://img.myepicwall.com/2014/04/0740f50082c02f2f96fca43510a123dc.gif)[/spoiler]
-
:L :L :L
-
lol!
-
lmao :L
(http://24.media.tumblr.com/2fe7cfca074798558134c521557a6565/tumblr_n3s5buQ8wv1r6g7k5o1_1280.jpg)
(http://24.media.tumblr.com/27e8ff06a2aa3b67594ec1e28c98fbde/tumblr_mzh4roHedo1rccello1_1280.jpg)
(http://25.media.tumblr.com/949fe32e543f3775ac805a6503d6cb5d/tumblr_n3n5iuboDY1sgxyuyo1_1280.jpg)
-
[youtube]http://www.youtube.com/watch?v=9mEq_PZY4ds[/youtube]
-
too many pics to post, so here instruction
1. go to Google Picture
2. search for "sean connery funny" pictures
3. have fun reading, lol
-
(http://i.imgur.com/j4cfl9o.jpg)
we still do that sometimes when we're drunk lol
lol yeah, I hate the people ringing at my doorbell at 6am because they're drunk xD
-
Lol anyone remember this?
Someone should tell him LSR/LSD have been around for over 5 years!
http://forum.adrenalinex.co.uk/index.php/topic,411.msg4685.html#msg4685
-
hah yeah i remember :L
-
(http://www.upload.ee/image/3999257/a9dNb00_700b_v1.jpg)
-
:L
-
[youtube]http://www.youtube.com/watch?v=sAVofZ0CZMQ[/youtube]
haha :L
-
[youtube]http://www.youtube.com/watch?v=HkLk1YUEoKA[/youtube]
-
damn hahahaha
(https://scontent-b.xx.fbcdn.net/hphotos-prn2/t1.0-9/10013591_10152352916549802_6768486353610487939_n.png)
-
Matemática = Math.
(https://fbcdn-sphotos-e-a.akamaihd.net/hphotos-ak-frc3/t1.0-9/10151247_632037266870664_2861867240878871098_n.jpg)
-
haha this is so hilarious!
[youtube]http://www.youtube.com/watch?v=KXCHTsVp4EI[/youtube]
-
train accident with collapsing railroads bridge, NSFW? well judge yourself
[spoiler]
(http://img.sadistic.pl/pics/85f0ff6dabf8.gif)[/spoiler]
-
[youtube]http://www.youtube.com/watch?v=8pQAWOCofXo[/youtube]
-
:L
-
train accident with collapsing railroads bridge, NSFW? well judge yourself
[spoiler]
(http://img.sadistic.pl/pics/85f0ff6dabf8.gif)[/spoiler]
OH NOOOOOOO!!!! What a terrible tragedy, hope nobody had to walk through that mess
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/axNnRXK_700b.jpg)
-
[youtube]9B61dNeboWE[/youtube]
-
[youtube]https://www.youtube.com/watch?v=9B61dNeboWE[/youtube]
cool :D
-
[youtube]6MG8ZqMqf00[/youtube]
-
:L :L :L :L :L :L :L :L :L
-
l m a o
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=g10DqPbbUuw[/youtube]
-
Dvořák must be rolling over in his grave now..
-
[youtube]http://www.youtube.com/watch?v=3Y34NSUbEjY[/youtube]
Listen to that dog lol
-
[youtube]5Uzu58N-Sso[/youtube]
Sweet promo for some movie :D
-
went into a alfa romeo/fiat showroom for a couple of parts, on the way out I got a WTF:
(http://i.imgur.com/Xgvosi3.jpg)
-
(http://37.media.tumblr.com/tumblr_m4smrzARky1rvvf3co1_500.jpg)
-
this is so cute
[youtube]http://www.youtube.com/watch?v=bqpRoVxH2jc[/youtube]
-
My city, so beautiful <3 almost the Russia....
[youtube]http://www.youtube.com/watch?v=5-fgxfnLJ3g[/youtube]
-
haha :L if this really is an Easter tradition, then it's a good way to celebrate it
-
dat loled me really hard tho
-
(http://i.imgur.com/N2XG1CC.gif)
-
[youtube]yqZ7cMbUz1c[/youtube]
-
How to steal a car... if you are a dog:
[youtube]http://www.youtube.com/watch?v=-K-zDK4wrI4[/youtube]
-
[youtube]yqZ7cMbUz1c[/youtube]
Best admin 2014 nominee :L
Good job!
-
(http://d24w6bsrhbeh9d.cloudfront.net/photo/a3YpvA7_700b.jpg)
(http://i1.kwejk.pl/site_media/obrazki/2014/04/d4b280d00bf99c2ef701f5604c76c907_original.jpg?1398252392)
-
[youtube]Hnvoz91k8hc[/youtube]
-
(http://i.imgur.com/2hnaaKh.jpg)
:L :L :L
[youtube]http://www.youtube.com/watch?v=rp8hvyjZWHs[/youtube]
-
[youtube]http://www.youtube.com/watch?v=OJORQb_FjXA[/youtube]
-
lol @ farts
-
Japanese people don't care:
(http://global3.memecdn.com/nigga_fb_1052609.jpg)
-
[spoiler](http://media.tumblr.com/235423d0fcac61f6dd016b11b0223b58/tumblr_inline_mglwjw80jt1qz4l2k.jpg)[/spoiler]
-
okay lol... Actually when I was looking for the picture in google to post here I saw the one you posted on the 1st place and was like "oh, that one sucks - some text over the picture. I will post the other one, it looks good". Fail :L
-
haha nice
-
[youtube]http://www.youtube.com/watch?v=2enxp-sSqPA[/youtube]
-
[youtube]http://www.youtube.com/watch?v=LRGz2pDjfKI[/youtube]
lol
-
[youtube]Odax7F3tWhM[/youtube]
-
[youtube]https://www.youtube.com/watch?v=FdUTnE1Hm7U[/youtube]
-
(http://i.imgur.com/cv4Z7xy.jpg)
Nice
-
[youtube]FdUTnE1Hm7U[/youtube]
-
(http://i.imgur.com/cv4Z7xy.jpg)
Nice
(http://3.bp.blogspot.com/-40HPv4s2C3Q/Ufhwc42K7BI/AAAAAAAADlA/hIPeXK0lriM/s1600/cat1.png)
-
[youtube]http://www.youtube.com/watch?v=CXAuuW411HQ[/youtube]
Ahahaahahahah
-
Living with a LAG
[youtube]http://www.youtube.com/watch?v=_fNp37zFn9Q[/youtube]
-
Living with a LAG
[youtube]http://www.youtube.com/watch?v=_fNp37zFn9Q[/youtube]
Wow 1:00 makes me really appreciate that Brazilians are really good dancers even with all the lag they have to live with. :L
-
Living with a LAG
[youtube]http://www.youtube.com/watch?v=_fNp37zFn9Q[/youtube]
Wow 1:00 makes me really appreciate that Brazilians are really good dancers even with all the lag they have to live with. :L
we are amazing
-
sry if repost, but this ownssssssssss
sssssss
(http://www.chamsko.pl/demot/0_1_54041_Ktora_godzina_przez_Lipton20.gif)
-
:L
-
lol
-
:L :L :L :L
(https://24.media.tumblr.com/tumblr_lz27y2Xdxp1r8ayzqo1_500.jpg)
-
gta online gif to start with:
(http://img.joemonster.org/i/2014/05/fizykagry_02.gif)
kind of funny, coz merges a seriious crash with cheery cat and soft music, but it's grim humor anyway and not everyone will like
[spoiler]
[youtube]http://www.youtube.com/watch?v=ksuN8BdtasE[/youtube][/spoiler]
(http://i1.kwejk.pl/site_media/obrazki/2014/05/435db6d7dad7689074f2dc63dfe3a8de_original.png?1399312031)
(http://img.myepicwall.com/2014/05/0c300fce6c35a9a7dee9e0f5c8c7e3da.jpg)
(http://img.myepicwall.com/2014/05/a4a007e63edb98d151517982f80cff79.jpg?1399305574)
(http://img.myepicwall.com/2014/05/45a7fde2a88f8687e4a7de6d6a53978a.jpg)
(http://img.myepicwall.com/2014/05/91bb8d70144e62d98d0a5e2e3ae1ae38.jpg)
(http://img.myepicwall.com/2014/05/c4e7c8d40c600d5c5d6ba9d73c9afb5d.jpg)
rememebr this guy?
(http://img.myepicwall.com/2014/05/7397df0596cad4fa215f488319d37ff7.gif)
and end, nasty and funny :D
[spoiler](http://img.myepicwall.com/2014/05/f426c4f595cb4feee22a44fa1c8d4021.gif)[/spoiler]
-
rememebr this guy?
(http://img.myepicwall.com/2014/05/7397df0596cad4fa215f488319d37ff7.gif)
and end, nasty and funny :D
He recently started making videos again
https://www.youtube.com/channel/UCfLGZs8bSDbkNJjCRIE7NSg
-
don't watch if you get scared easily:[spoiler](http://i.imgur.com/RcK2w5l.gif)[/spoiler]
-
I want to but... only if something doesn't popout :L
-
don't watch if you get scared easily:[spoiler](http://i.imgur.com/RcK2w5l.gif)[/spoiler]
Thank you. I fuck up :L
-
don't watch if you get scared easily:[spoiler](http://i.imgur.com/RcK2w5l.gif)[/spoiler]
Nothing happens lol
-
don't watch if you get scared easily:[spoiler](http://i.imgur.com/RcK2w5l.gif)[/spoiler]
Nothing happens lol
It was just a hypnosis..
What should happen in a dream :L
-
don't watch if you get scared easily:[spoiler](http://i.imgur.com/RcK2w5l.gif)[/spoiler]
here better one too
[spoiler]
(http://37.media.tumblr.com/3913461e7113a78f1408d9c498cf3a98/tumblr_n0e8ez5yTU1s6cgsmo1_400.gif)[/spoiler]
-
(http://i.gyazo.com/65a497c3fe3bb0e3183baae6eeffb1c9.png)
-
[youtube]zflPekytajA[/youtube]
-
japan... :o
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=b0A9-oUoMug[/youtube]
-
rofl this is awesome :L
[youtube]http://www.youtube.com/watch?v=OGJAUnNzbhE[/youtube]
-
(http://img.myepicwall.com/2014/05/2b8a7469fbc818ecfa35e14e1ec36e6f.jpg?1399652108)
-
(http://img.myepicwall.com/2014/05/2b8a7469fbc818ecfa35e14e1ec36e6f.jpg?1399652108)
useless kkkkkkkkkkkkkkkkkkk
-
rofl this is awesome :L
[youtube]http://www.youtube.com/watch?v=OGJAUnNzbhE[/youtube]
lmao omg
-
Bollywood ftw :L
lol yeah
-
Bollywood ftw :L
tbh the crowd actually enjoys that shit :L
-
omg
[youtube]http://www.youtube.com/watch?v=nS5wlXW7Jcw[/youtube]
-
[youtube]http://www.youtube.com/watch?v=wYAOXpkZJiM[/youtube]
-
[youtube]http://www.youtube.com/watch?v=PbQbVVJ1tx0[/youtube]
HAHAHAHAHAHA LOOL
-
(http://cdn.smosh.com/sites/default/files/ftpuploads/bloguploads/0613/vandalized-billboards-mustache.jpg)
-
deadmau5 ftw :L
(http://i.imgur.com/gWUsjwu.jpg)
-
omg :L
[youtube]http://www.youtube.com/watch?v=QPWA-sRQdMI[/youtube]
-
http://vimeo.com/93175979
-
[youtube]http://www.youtube.com/watch?v=oo8mIX9Gwe8[/youtube]
-
[youtube]http://www.youtube.com/watch?v=iLpLane1LxQ[/youtube]
[youtube]http://www.youtube.com/watch?v=5_ylr-iA3Yk[/youtube]
-
(http://img.joemonster.org/images/vad/img_28188/b1e9049a346393574e1ff3472c208fe4.gif)
(http://img.joemonster.org/images/vad/img_28188/6a65159f1d7484d996b57c7036bcee14.gif)
(http://img.joemonster.org/images/vad/img_28188/61669b505c0c0e717ac58b256ca198dc.gif)
(http://img.joemonster.org/images/vad/img_28188/3cd9db17944cb23e7cc93aeba0595554.gif)
(http://img.joemonster.org/images/vad/img_28188/f8961b315b77dc6a5cb7095257b73423.gif)
(http://img.joemonster.org/images/vad/img_28188/f407123327b04cd010888771683ae9a3.gif)
-
roflmao
-
LMAO
[youtube]http://www.youtube.com/watch?v=2zizSqLiwfA[/youtube]
-
[youtube]h2NbLYTIdsQ[/youtube]
-
https://www.youtube.com/watch?v=QZbciVwQScs#t=80
-
https://www.youtube.com/watch?v=QZbciVwQScs#t=80
[youtube]Odax7F3tWhM[/youtube]
-
:(
-
C(ute)&C(lever) boy :L :L
[youtube]8cQruSrslSU[/youtube]
-
rofl
[youtube]http://www.youtube.com/watch?v=XCawU6BE8P8[/youtube]
-
(http://static.fjcdn.com/pictures/reasons_f2b169_2604872.jpg)
-
rofl
[youtube]http://www.youtube.com/watch?v=XCawU6BE8P8[/youtube]
The Lonely Island > All
-
Steve-O at his best lol... That's hilarious, you can find more there:
[youtube]http://www.youtube.com/watch?v=j8e6zT4qWic[/youtube]
-
[youtube]http://www.youtube.com/watch?v=lQlIhraqL7o[/youtube]
a woman let me put my penis inside of her!
laughing so fucking hard :L :L :L :L
---
funny fact: it's the Akon's most viewed video.
-
[youtube]http://www.youtube.com/watch?v=GJCJoLzgTEE[/youtube]
enjoy :)
-
How the fuck is that remotely funny making a beetle die in agony :-\
-
i think you overestimate its ability to feel pain
-
I think you underestimate the fucked-up-ness of chewing something still alive.
-
i think chewing it is a quicker way for it to go than getting cooked or something.
-
[youtube]http://www.youtube.com/watch?v=GJCJoLzgTEE[/youtube]
enjoy :)
(https://i2.ytimg.com/vi/Xn937O5mfLA/mqdefault.jpg)
he wanna one!
-
I think you overunderestimated the lack of salt and pepper on this beetle.
-
gifs
[spoiler](http://joemonster.org/images/vad/img_28254/4d99901a6aacfb0fb30c84a4c970c408.gif)
(http://joemonster.org/images/vad/img_28254/aa6aa92605f3c690ca087d57adee01d2.gif)
(http://joemonster.org/images/vad/img_28254/ca265782eb36f2e579f988b9df3fcb66.gif)
(http://joemonster.org/i/2014/05/21-20140521154931.gif)[/spoiler]
-
[youtube]http://www.youtube.com/watch?v=_9r-oUxq-EU[/youtube]
-
(https://i.imgur.com/WT5fQEH.gif)
(https://i.imgur.com/0AnSs3j.gif)
(https://i.imgur.com/jehLFBS.gif)
(https://i.imgur.com/HTTeufI.gif)
-
Car owned by slut? Found it today on parking :L
(http://i.imgur.com/cEBLRvF.jpg)
-
I know what you was doing falky ;) (fot0_gg = falky)
(http://i.imgur.com/nTu4bVq.jpg?2)
-
did you.......
Did you just take a picture of your screen with a camera :O
-
it's from playstation 3... dont you know that gta v isnt on pc?
-
I thought there was a key combination for some consoles to take screenshots might be wrong
-
dafuq is this shit :L :L :L :L
[youtube]http://www.youtube.com/watch?v=uzGzMYS2Gnc[/youtube]
[youtube]http://www.youtube.com/watch?v=J1c2KzJbcGA[/youtube]
-
you visit bad side of youtube too much :L
-
nope, my friend who sent me those vids does :L
-
[youtube]http://www.youtube.com/watch?v=OlyUke5XFw4[/youtube]
-
[youtube]http://www.youtube.com/watch?v=OlyUke5XFw4[/youtube]
aw you were so cute :D
-
[youtube]http://www.youtube.com/watch?v=OlyUke5XFw4[/youtube]
aw you were so cute :D
yes :D
-
[youtube]http://www.youtube.com/watch?v=B7-6nXGflec[/youtube]
-
(http://narf-archive.com/pix/9741b115357a8c30f5147581b3bcda2b587239b0.gif)
-
[youtube]http://www.youtube.com/watch?v=pP3hm78BxqA[/youtube]
-
season 6 was everything
[youtube]http://www.youtube.com/watch?v=NjmOkfzi0xc[/youtube]
-
:O
-
(http://37.media.tumblr.com/f0f414677c5571ae6d1c19ec318bc251/tumblr_n5zofhakUZ1trumwjo1_400.gif)
-
(http://i.imgur.com/IYwzP2B.png)
-
lmfao
-
Hahahaahaha
-
fixed,
(http://i.imgur.com/smBIrMs.png)
-
:L :L :L
-
lol
-
[youtube]hC83kY3rywE[/youtube]
-
fixed,
(http://i.imgur.com/smBIrMs.png)
:L
-
[youtube]http://www.youtube.com/watch?v=BTnmVK666CU[/youtube]
LOL at this :L
-
[youtube]http://www.youtube.com/watch?feature=player_embedded&v=oJSHBingKS4[/youtube]
-
[youtube]http://www.youtube.com/watch?v=BTnmVK666CU[/youtube]
LOL at this :L
haha
-
(http://i.imgur.com/6R1f20L.jpg)
Putin just don't care.
-
what an arsehole
-
surely there's a limit to how many people can effectively help lol
-
lol i agree, i'm usually the putin of the group when something is happening so i stand there like an idiot with nothing to do. been like that my whole life.
i remember walking down the street once and a disabled bloke fell out of his wheelchair, so this random woman called me over to help when there were loads of other people there so i stood there doing nothing because there was nothing for me to do, when i walked away i was like what was the point in that, i didn't do anything but watch lol
-
Merkel be like "fall you stupid bitch"
-
Oh yeah, definitely everyone is just doing it for appearances: you don't need that many people to help, and the one person helping should be firmly holding the other person to make sure they don't fall (if they actually risk falling over). It's all because no one wants to look like they weren't helping and then it turn into a diplomatic explosion "QUEEN OF ENGLAND FALLS OVER, NO ONE WAS THERE TO HELP" plus all the reverence everyone has to show to the royal family.
Anyhoo, I thought it was funny because it perfectly reflects the relationships between the Western countries and Russia at the moment. :L
-
(http://24.media.tumblr.com/b44f9f2f27774fb4604c9121f8e5333d/tumblr_n6qgkuJhNd1r41unfo1_250.gif)
-
:L
-
:L
-
NSFW
[spoiler](http://www.chamsko.pl/demot/0_0_292285214_Chujowe_ubranka_przez_alfred77_middle.jpg)[/spoiler]
-
chujowe
-
lol this music video is so weird but also amazing :L
[youtube]http://www.youtube.com/watch?v=clLqaaGJJZ8[/youtube]
-
Monument in MALTA -_- what's going on... lol :blank:
(http://i1316.photobucket.com/albums/t605/zurriequnited/monument-to-mintoff_zps9bfd0deb.jpg)
-
[youtube]http://www.youtube.com/watch?v=a2jngmAM17U[/youtube]
Huehuehuehuehuuheuheuhueuhehu
-
lol really....
(http://multipla.weebly.com/uploads/2/9/5/2/2952425/5446996_orig.jpg)
(http://www.forumsamochodowe.pl/galeria/fiat-a15/fiat-multipla-gt-przod-czarny-mat-m11124.jpg)
-
FIAT MULTIPLA :D
(http://www.quickmeme.com/img/65/65ead520ce2d0b4052cf4f48698ec8606aaa09f2bdbc3985b3993dc68e60d441.jpg)
(http://f.kulfoto.com/pic/0001/0033/baqbz32984.jpg)
>:D
-
at least if you're inside it you don't have to see it :L
-
[youtube]http://www.youtube.com/watch?v=B5VmIndFwHg[/youtube]
-
FIAT MULTIPLA :D
(http://www.quickmeme.com/img/65/65ead520ce2d0b4052cf4f48698ec8606aaa09f2bdbc3985b3993dc68e60d441.jpg)
(http://f.kulfoto.com/pic/0001/0033/baqbz32984.jpg)
>:D
legendary 1st series, 2nd one they tonned down
(http://www.honestjohn.co.uk/imagecache/file/fit/730x700/media/3380360/Fiat%20Multipla%20(2).jpg)
-
still ugly lol
-
[youtube]vaePaXhSQDw[/youtube]
-
classic lol
-
[youtube]tRxcSNaVCPA[/youtube]
-
LMAO
(https://38.media.tumblr.com/819203a19448becbe93409d97651b1d7/tumblr_n7brqgxPud1ruitpdo1_500.png)
-
rofl, "pizza hut" :D
-
[youtube]http://www.youtube.com/watch?v=CNhhXmXQ_bY[/youtube]
Cant stop laughing
-
(https://i.imgur.com/3YdJs.jpg)
-
[youtube]http://www.youtube.com/watch?v=lYm4GkzeaTg[/youtube]
-
(http://s1v2.irc.lv/files/1/0/0/475/Ffc9Void.gif)
-
:L
-
(http://i.imgur.com/4WdOyjG.png)
-
(http://global3.memecdn.com/generosity-lvl-activision_c_1840015.webp)
(https://funixx.files.wordpress.com/2013/11/defgjdfgfghault.jpg)
(http://static.fjcdn.com/pictures/Steam+Summer+Sale.+Steam+Summer+Sale_e9b210_3900646.jpg)
-
(http://s1v2.irc.lv/files/1/0/0/475/Ffc9Void.gif)
kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk
-
I wonder if it's fake or not but... it's Russia so: https://www.youtube.com/watch?v=tzme8XqR5xY&feature=youtu.be&t=9m45s
-
[youtube]http://www.youtube.com/watch?v=_li_d_YviZ4[/youtube]
[youtube]http://www.youtube.com/watch?v=E53CQVabLew[/youtube]
just lol
-
(http://37.media.tumblr.com/b823255bac40403e5907e44fbcc49f50/tumblr_n7hmabBXRy1qdlh1io1_500.gif)
-
:L
-
LOL
-
[youtube]UxXSHDdlh_E[/youtube]
-
(http://i59.tinypic.com/v4ry80.jpg)
HAHAHHHA
-
[youtube]http://www.youtube.com/watch?v=ufueWjyMwFQ[/youtube]
-
[youtube]http://www.youtube.com/watch?v=5J3Jw2xdszQ#t=144[/youtube]
-
[youtube]http://www.youtube.com/watch?v=5J3Jw2xdszQ#t=144[/youtube]
This reminds me Latvian version of terminator movie "Terminators 3 Pirdēju Sacelšanās" (Terminator 3 Rise of the Farts)
trailer
[youtube]http://www.youtube.com/watch?v=73H2iEthI7Q[/youtube]
-
Poop on everything!
[youtube]http://www.youtube.com/watch?v=OeG3dwk8D6w[/youtube]
-
[youtube]http://www.youtube.com/watch?v=EiaRxX3PyGM[/youtube]
-
[youtube]http://www.youtube.com/watch?v=SePH50rdg-g[/youtube]
-
lmao
[youtube]http://www.youtube.com/watch?v=dARvz2x3dMg[/youtube]
-
It's on the same page lol
-
Oh, didn't figure out :D
-
(http://d3dsacqprgcsqh.cloudfront.net/photo/a09rrnL_700b_v1.jpg)
(http://d3dsacqprgcsqh.cloudfront.net/photo/aG9mPA7_460sa_v1.gif)
-
What are those stats? Interesting. Is there any way to check out if the picture is not fake?
-
i dont know because the teams are changing their positions so fast with every win, loss and draw...
-
It's fake - checked in the google. There are articles about it.
-
ok
-
lol that's not about football, it's this http://en.wikipedia.org/wiki/List_of_countries_by_Human_Development_Index
-
L...OL
[YOUTUBE]http://www.youtube.com/watch?v=WxU-cQvmi-k&feature=youtu.be[/YOUTUBE]
-
:L
(http://i61.tinypic.com/25u2qrr.jpg)
-
(http://giant.gfycat.com/FaithfulSolidGemsbuck.gif)
-
https://www.youtube.com/watch?v=Ob0GbuUr8wc
-
[youtube]http://www.youtube.com/watch?v=GumUWckvSaI[/youtube]
-
[youtube]http://www.youtube.com/watch?v=yJ-jvEd0pDw[/youtube]
Lol watch this
-
[youtube]http://www.youtube.com/watch?v=YThkirVXzoU[/youtube]
-
Anybody head of Kulula Airlanes? :L http://www.southafrica.to/transport/Airlines/Kulula-flights/Kulula-humour.php5
some of their onboard jokes:
"Please pay attention to the safety announcement, because you will be writing a test shortly".
"If you are caught smoking, you will be asked to leave the aircraft".
"You could be fined up to R7999 for smoking on the plane, and for these prices you could be flying SAA"
"Ladies and gentlemen, we've reached cruising altitude and will be turning down the cabin lights. This is for your comfort and to enhance the appearance of your flight attendants."
"Me Tarzan, You on hold", when phoning Kulula and being put on hold.
"To operate your seat belt, insert the metal tab into the buckle, and pull the belt tight. It works just like every other seat belt; and, if you don't know how to operate one by now, then you probably shouldn't be allowed out in public unsupervised."
"There may be 50 ways to leave your lover, but there are only 4 ways out of this airplane."
"In the event of a sudden loss of cabin pressure, masks will descend from the ceiling. Stop screaming, grab the mask, and pull it over your face. If you have a small child travelling with you, secure your mask before assisting with theirs. If you are travelling with more than one small child, pick your favourite."
"Your seat cushions can be used for flotation; and in the event of an emergency water landing, please paddle to shore and take them with our compliments."
As the plane landed and was coming to a stop at Durban Airport, a lone voice came over the loudspeaker: "Whoa, big fella. WHOA!"
"Please be sure to take all of your belongings. If you're going to leave anything, please make sure it's something we'd like to have."
"Ladies and gentlemen, we have landed in Cape Town . Please take all your possessions. Anything left behind will be shared equally between staff. Please note we do not accept unwanted mothers-in-laws or children."
"Kulula Airlines is pleased to announce that we have some of the best flight attendants in the industry. Unfortunately, none of them are on this flight!"
"Welcome to Johannesburg, if this is not where you were intending to go then you have a bit of a problem."
"Anyone caught jumping on the bed at any Protea Hotel will be charged R2,50 per jump and will be billed when you check out."
-
[youtube]http://www.youtube.com/watch?v=ZhG4V4yrPfs[/youtube]
-
lol the title
-
[youtube]pvn71JUliTk[/youtube]
-
:L :L :L
[youtube]http://www.youtube.com/watch?v=yzx-HSSV0YU[/youtube]
-
malipop, what the fuck is this? who makes such shows? :L
-
I see, I see, I see... ouch :L
[youtube]http://www.youtube.com/watch?v=1uxMeuGViMM[/youtube]
-
:L
[youtube]http://www.youtube.com/watch?v=Cy8_gFPzS7U[/youtube]
[youtube]http://www.youtube.com/watch?v=_DAp505wuRs[/youtube]
-
haha
-
malipop, what the fuck is this? who makes such shows? :L
it's called rupaul's drag race and it's amazing
-
[youtube]shCYA2J-De8[/youtube]
-
lmaoo :L :L
-
[youtube]http://www.youtube.com/watch?v=mjsQXlj3ssM[/youtube]
-
[youtube]http://www.youtube.com/watch?v=79Vy01wIlPA[/youtube]
-
(https://scontent-b-fra.xx.fbcdn.net/hphotos-xpf1/t1.0-9/10410120_821591837874848_1400434603661952558_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=4ChPgNv3IEs[/youtube]
-
[youtube]http://www.youtube.com/watch?v=QSilIwlqZXM[/youtube]
[youtube]http://www.youtube.com/watch?v=02OHSFspHPw[/youtube]
[youtube]http://www.youtube.com/watch?v=SRgiqXNNV40[/youtube]
-
[youtube]http://www.youtube.com/watch?v=Snph22qSUMU[/youtube]
-
[youtube]http://www.youtube.com/watch?v=pE5YFrZpr-I[/youtube]
-
(http://i1.wp.com/www.sopitas.com/site/wp-content/uploads/2014/07/meme-9.jpg?resize=640)
(http://global3.memecdn.com/match_o_3497483.gif)
-
[youtube]http://www.youtube.com/watch?v=Ql1dLUEWECg[/youtube]
-
[youtube]NuaRIpZDnp0[/youtube]
-
lol
-
haha
-
[youtube]http://www.youtube.com/watch?v=xQdPt2xUPXo[/youtube]
[youtube]http://www.youtube.com/watch?v=Q9vDtZvDHCQ[/youtube]
LOOOOL
-
/
-
lol
-
[youtube]http://www.youtube.com/watch?v=32z4ILDjijU[/youtube]
-
that is a cool banana for sure!
-
[youtube]6PYdEpwwf5k[/youtube]
-
[spoiler=better putting this is spoiler, lol](http://i.imgur.com/xW8JcpP.png)
[/spoiler]
-
(http://i57.tinypic.com/2gspb8i.jpg)
-
lmao
-
:L
[youtube]http://www.youtube.com/watch?v=rvsuYssoTw0[/youtube]
-
(http://i57.tinypic.com/2gspb8i.jpg)
Lionel Robben and Arjen Messi :L
-
https://www.facebook.com/photo.php?v=587157788071163&fref=nf
-
[youtube]http://www.youtube.com/watch?v=RbKzmP_fDjs[/youtube]
Haha , watch this :L
-
[youtube]http://www.youtube.com/watch?v=ZOJCmPKaYN8[/youtube]
-
lol
(http://38.media.tumblr.com/3441a046119a2fd7ea5940be117313ec/tumblr_mltvzaJjSr1s7cv54o1_400.png)
-
(http://s9.postimg.org/smnjltjfj/10422182_377657852385187_7298037167181931866_n.jpg)
lol
-
(http://i57.tinypic.com/34rzihs.jpg)
lol
-
:L :L :L :L
(http://i1316.photobucket.com/albums/t605/zurriequnited/washingmachine_zps0db49d83.jpg)
-
[spoiler](http://i.imgur.com/MwIDGoN.png)
-
:L
-
[youtube]http://www.youtube.com/watch?v=ZzDFbhSkQjc[/youtube]
:L :L
-
[youtube]http://www.youtube.com/watch?v=WzYkzMh1tRk[/youtube]
note, this is acoustic, playback, playback heh fail
(http://i1.kwejk.pl/site_media/obrazki/2014/07/45846d67e0bd7f9ed9e2a8944887b90f_original.jpg?1405362755)
-
(http://38.media.tumblr.com/7cb0902505e2914d610f9df240fdcd4e/tumblr_ms035dLZIx1rw8qnjo1_400.jpg)
(http://media.tumblr.com/1368bd6b9cb2460bf0b09a5d8045b4cc/tumblr_inline_myjeegvV6b1r3ph42.png)
-
found it!
[spoiler]
[youtube]http://www.youtube.com/watch?v=yQ9hPcPSb1A[/youtube]
[/spoiler]
-
dude, what the fuck :L
-
iconic
[youtube]http://www.youtube.com/watch?v=B4CTReuSw08[/youtube]
-
Ughhhhhhhh Rylan!!
-
lol rylan was everything
-
with his fake teeth lol
-
(http://i.imgur.com/4rVzqD1.gif)
-
[youtube]http://www.youtube.com/watch?v=c5NJwS286co[/youtube]
-
[youtube]http://www.youtube.com/watch?v=ymiHvyNgd7s[/youtube]
-
R.I.P. earphones :L
-
[youtube]http://www.youtube.com/watch?v=jdBzPj7Raco[/youtube]
-
[youtube]http://www.youtube.com/watch?v=7SXs3JZgZtk[/youtube]
Czech out this video :L
-
[youtube]http://www.youtube.com/watch?v=rAW_TxnFI-M[/youtube]
-
[youtube]http://www.youtube.com/watch?v=7SXs3JZgZtk[/youtube]
Czech out this video :L
lol very good
-
lmao
(https://38.media.tumblr.com/17020faa8427188986bee2c3e1b2d7ad/tumblr_n9ba8tnFoH1rzhcyfo1_400.png)
-
[youtube]http://www.youtube.com/watch?v=_41HlTi2ouU#t=24[/youtube]
Welcome to Poland, where everything is (im)possible. :DDDDDDD
-
lol
-
[youtube]http://www.youtube.com/watch?v=rAW_TxnFI-M[/youtube]
I want to punch the guy with the beard and the non-existant haircut in the face. Because ... reasons....
-
(http://wowpics.in/wp-content/uploads/World%E2%80%99s-Longest-Car-Limousine2.jpg)
-
(http://wowpics.in/wp-content/uploads/World%E2%80%99s-Longest-Car-Limousine2.jpg)
(http://www.volocars.com/contentimages/contentimages/img_175261977.jpg)
-
mess
[youtube]http://www.youtube.com/watch?v=AESQiNXIIE0[/youtube]
-
[youtube]http://www.youtube.com/watch?v=l85gy-axIjI[/youtube]
[2F2F]RedBull playing in public :L
-
[youtube]http://www.youtube.com/watch?v=WzhW20hLp6M[/youtube]
lol this is brilliant, spoilers though so if you haven't finished breaking bad don't watch it.
-
(http://i1.kwejk.pl/site_media/obrazki/2014/07/a8afdc54e92101da02e492c261661172_original.jpg?1406829398)
-
[youtube]http://www.youtube.com/watch?v=bFNpxzwng0Q[/youtube]
-
[youtube]http://www.youtube.com/watch?v=td8MgXCfjZc[/youtube]
-
so stupid that i had to post, lol
(http://i1.kwejk.pl/site_media/obrazki/2014/08/80f7ec70129914c844e6d3a88e96517a_original.jpg?1407072242)
-
(https://scontent-a-fra.xx.fbcdn.net/hphotos-xfp1/l/t1.0-9/10524729_10152582647274706_6561484673162720528_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=VvTvtIeXJ1I[/youtube]
-
(http://i1.kwejk.pl/site_media/obrazki/2014/07/a8afdc54e92101da02e492c261661172_original.jpg)
fixed
so stupid that i had to post, lol
(http://i1.kwejk.pl/site_media/obrazki/2014/08/80f7ec70129914c844e6d3a88e96517a_original.jpg)
and fixed
-
(http://i1.kwejk.pl/site_media/obrazki/2014/07/a8afdc54e92101da02e492c261661172_original.jpg)
fixed
so stupid that i had to post, lol
(http://i1.kwejk.pl/site_media/obrazki/2014/08/80f7ec70129914c844e6d3a88e96517a_original.jpg)
and fixed
(http://i.imgur.com/N3gbN0s.png)
fixed!
-
(https://scontent-a.xx.fbcdn.net/hphotos-xpa1/t1.0-9/10420210_666178866805540_7868469332197111046_n.jpg)
-
[youtube]http://www.youtube.com/watch?v=XZP5RsaRg6k[/youtube]
-
New hair dress, moo? :L :L
(http://files1.isnichwahr.de/media/CyyCXpXmLkt4Rx1krwiG9A,1407535200/cont/640/inwlive_gifdump_130614/61181623.gif)
-
[youtube]http://www.youtube.com/watch?v=5Jd9AmepgdM[/youtube]
-
That guy is awesome lol
-
Lol :L
(http://i57.tinypic.com/f2ub5z.jpg)
-
(http://s10.postimg.org/of2jgoavp/huahua.gif)
-
[youtube]http://www.youtube.com/watch?v=InR7tip2Izk[/youtube]
Lololololol :L :L :L
-
(http://s27.postimg.org/hm1l83ybn/1458522_547489842002220_1884676099_n.jpg)
-
(http://s29.postimg.org/7v7ha6pzr/1347140355979.jpg)
(http://s29.postimg.org/gpzlclgyf/1354989846778.jpg)
(http://s18.postimg.org/okynapr89/1355447981153.jpg)
(http://s9.postimg.org/4lngzlbv3/1356804846791.jpg)
(https://lh5.googleusercontent.com/-izsD-A_4U3Q/U-kmg50kEgI/AAAAAAAAAP8/0-9xSRWRG2w/s640/1357546908814.jpg)
(https://lh5.googleusercontent.com/-rJRzCrZF6ow/U-kqJmwRQoI/AAAAAAAAAQI/5ylsggyK_OY/s435/escritoriohomemaranha.jpg)
(https://lh5.googleusercontent.com/-WJusmvea-rg/U-kq7gMNZNI/AAAAAAAAAQQ/oV55zUcdor8/s512/Leonardo-Da-Vin-Diesel_o_95199.jpg)
(https://lh3.googleusercontent.com/-CLsats_Yo88/U-ksQCmZKOI/AAAAAAAAAQc/fX9MuJIHRYc/s433/so-hardcore_262432-403x.jpg)
(https://lh6.googleusercontent.com/-2LLg5dY5_r4/U-ksitK6mHI/AAAAAAAAAQk/WehKl5mgrGM/s512/tumblr_mqfcbz7vRE1sp8xpjo1_500.jpg)
(https://lh3.googleusercontent.com/-9He_RM_yvw4/U-ksl-vW0sI/AAAAAAAAAQs/06l2cnHwVo0/s640/ugh.jpeg)
-
lmaoo :L
(http://38.media.tumblr.com/29d81ae4446dd357e5283ead00073ea8/tumblr_na5z5k3vk91rw8qnjo1_400.jpg)
-
https://www.facebook.com/photo.php?v=607052182742050
-
Cool idea:
[youtube]http://www.youtube.com/watch?v=AR8hV41O0z8[/youtube]
-
Cool idea:
[youtube]http://www.youtube.com/watch?v=AR8hV41O0z8[/youtube]
:L :L :L :L :L
-
https://www.facebook.com/photo.php?v=607052182742050
:blank: they are dwarves?? if yes then okay...but if they are girls....bye bye world :blank:
-
https://www.facebook.com/photo.php?v=607052182742050
:blank: they are dwarves?? if yes then okay...but if they are girls....bye bye world :blank:
yes :L :L
-
[youtube]http://www.youtube.com/watch?v=x9LRHlMdZmA[/youtube]
-
woo it's michal's annual post :L see you next year
-
yeah see u in 2015 O0 :L
-
wow
[spoiler=OPENING BEER with BANANA o.O](http://i1.kwejk.pl/k/obrazki/2014/08/53b21331-4eb6-4787-b37e-177ae0e1419e_gif.gif)[/spoiler]
and few odd designs... how to make every day use items more useless and frustrating
(http://i1.kwejk.pl/k/obrazki/2014/08/6a27bb8d-2295-4862-bbd0-0d137792f698_original.jpg)
(http://i1.kwejk.pl/k/obrazki/2014/08/da3405d9-e045-43de-a31c-fe721db54769_original.jpg)
(http://i1.kwejk.pl/k/obrazki/2014/08/0f151a57-61f7-47ad-a3f6-a20a1b5655a0_original.jpg)
(http://i1.kwejk.pl/k/obrazki/2014/08/72ab43b0-6412-45bf-8deb-b5d02d341af1_original.jpg)
(http://i1.kwejk.pl/k/obrazki/2014/08/8bfa9b63-42e0-46d8-8fff-9efec7989ad9_original.jpg)
(http://i1.kwejk.pl/k/obrazki/2014/08/058424a0-97d1-4996-882f-948cf12ec50a_original.jpg)
-
:L :L :L :L :L :L :L :L :L :L
-
it's not funny (it's embarrasing maybe), and i'll not create a thread only for this.
(http://i.imgur.com/fkdGAY8.png)
[su]razor, playing CS:GO for a national team? maybe?
http://www.hltv.org/match/2292373-romania-montenegro-european-championship-2014-qualification-round-1
-
i dont think so
-
haha, i nearly died laughing when he starts naming all Pokemons at 2:03 :L :L
[youtube]http://www.youtube.com/watch?v=xMq-FyDBeBA[/youtube]
-
This made me laugh harder then I probably should have...
(http://d3dsacqprgcsqh.cloudfront.net/photo/aMbbDEP_460sa_v1.gif)
-
lol
[youtube]http://www.youtube.com/watch?v=Euvh8kL8yaI[/youtube]
-
[youtube]j6SlXS6GGZE[/youtube]
-
[youtube]cBkWhkAZ9ds[/youtube]
-
(http://thechive.files.wordpress.com/2014/08/dar22.gif)
-
This is the most random & hilarious thing that has ever happened in my entire SA:MP gaming life. Participants:
Hulka - victim.
Wadeon - assassin.
Vril - random.
(http://i58.tinypic.com/4kz3eq.png)
(http://i58.tinypic.com/2n6htgh.png)
-
This is the most random & hilarious thing that has ever happened in my entire SA:MP gaming life. Participants:
Hulka - victim.
Wadeon - assassin.
Vril - random.
(http://i58.tinypic.com/4kz3eq.png)
(http://i58.tinypic.com/2n6htgh.png)
this post should be in screenshots not here :p
-
You must be very fun at parties, Zurri. :L I bet you get all the ladies with a simple sentence.
-
(https://38.media.tumblr.com/6f7aadff68639c24daa48bc3127ef350/tumblr_naf2s8MqKk1qb5gkjo1_500.jpg)
(https://31.media.tumblr.com/da15b8de4e15c27d647569905747543d/tumblr_naqv7g5BI31qlmszwo1_500.jpg)
(http://31.media.tumblr.com/8d42cea266277c586ef105dcba2d18e4/tumblr_n9942unBkW1qbdvgio1_400.png)
lmao african american
(https://41.media.tumblr.com/2d3454106dce464517385b38ff031513/tumblr_n95cpcUtvc1qe3q9wo1_500.jpg)
-
Do you need any talent to make pop-radio hit?
not really, dont belive, then check this out
[youtube]kKnxcvNqrCo[/youtube]
sad but true.... and we can see it in around 70% so-called top charts 'artists'
-
Brett Domino did it better (and first!)
[youtube]JV2s0UIPOQY[/youtube]
Steven Peavis is awesome too lol
-
How to produce an EDM song. :L
[youtube]dZSHqVkNRyQ[/youtube]
-
Steam trolls
(http://i.imgur.com/xbNY2vF.png)
-
(http://i61.tinypic.com/296g0g.png)
ROFLL!! :L
-
cosplay lvl hard: FIFA bugged animation play
(http://i1.kwejk.pl/k/obrazki/2014/08/9df26531-5aa1-4a93-b961-ce832e46540a_gif.gif)
-
LMAO
[youtube]http://www.youtube.com/watch?v=a5bQzQjxM4A[/youtube]
-
I don't know if you see this, It's a lil' sad but it cracks me up. :L
https://www.facebook.com/photo.php?v=764698990240468&fref=nf
-
lmao :L
-
Reminded me of this video
[youtube]r7m7ZQ5bsQk[/youtube]
-
Hahaha I love that kind of videos
btw rob my edit on your video is just because it said ''invalid youtube link'' hue
-
:L :L :L :L :L :L :L :L
-
oh my god :L
[youtube]http://www.youtube.com/watch?v=wgTZUU4gJ2U[/youtube]
-
(http://i.imgur.com/krq9xl3.png)
Oh my...
-
[youtube]http://www.youtube.com/watch?v=Gd10ixjoTp4[/youtube]
-
:L
-
slay
[youtube]http://www.youtube.com/watch?v=59LrsaH6ZaA[/youtube]
-
[youtube]http://www.youtube.com/watch?v=Gd10ixjoTp4[/youtube]
classic :L
-
(http://vader.joemonster.org/upload/qlm/12446834d8eb63020140725102426uid351.gif)
-
(http://vader.joemonster.org/upload/qlm/12446834d8eb63020140725102426uid351.gif)
It should be in Dramatic Videos/Pictures :L
-
Martina Hill, german comedian/actress, her show is just super awesome (and sometimes a little bit fucked up...).
Some outtakes:
[youtube]FPA4XVsEgOo[/youtube]
-
[youtube]GurS7JI_1Kk[/youtube]
http://www.thedenverchannel.com/news/local-news/parents-warned-of-active-shooter-near-broadway-and-mineral
-
(http://vader.joemonster.org/upload/qlm/12446834d8eb63020140725102426uid351.gif)
It should be in Dramatic Videos/Pictures :L
I actually know how this feels like (by mistake) just finished mexican food course
-
[youtube]GurS7JI_1Kk[/youtube]
http://www.thedenverchannel.com/news/local-news/parents-warned-of-active-shooter-near-broadway-and-mineral
It's happened with Cloud9-n0thing a month ago.
-
[youtube]GurS7JI_1Kk[/youtube]
http://www.thedenverchannel.com/news/local-news/parents-warned-of-active-shooter-near-broadway-and-mineral
It's happened with Cloud9-n0thing a month ago.
no kill me or i report u
-
:L :L :L
[youtube]http://www.youtube.com/watch?v=0HTeX4AhFaA[/youtube]
-
[youtube]0eD7DcrRLvU[/youtube]
-
(https://scontent-a.xx.fbcdn.net/hphotos-xpf1/v/t1.0-9/10488317_262834450574968_8993702623923510026_n.jpg?oh=a0dc842c769103284ba0280441bf4fe2&oe=545BCE8A)
(https://scontent-a.xx.fbcdn.net/hphotos-xpf1/t1.0-9/1604829_262834260574987_3582189683276663972_n.jpg)
(https://scontent-b.xx.fbcdn.net/hphotos-xpa1/v/t1.0-9/q81/s720x720/10325212_261900977334982_4219993269360085549_n.jpg?oh=b15bc68bf32922e7f9c84d840d4af194&oe=5477D8FE)
(https://scontent-b.xx.fbcdn.net/hphotos-xfp1/v/t1.0-9/10485282_261091930749220_8429398560334289021_n.jpg?oh=82049a391492aa5528cc0c01c5508617&oe=546E8FA2)
(https://scontent-a.xx.fbcdn.net/hphotos-xpa1/v/t1.0-9/10462475_260883864103360_6485770510748625288_n.png?oh=20a6555e9bc16a347c7aba06c8ebbac2&oe=5479EAC4)
(https://scontent-b.xx.fbcdn.net/hphotos-xap1/v/t1.0-9/p403x403/10491127_260343910824022_6658041786301655715_n.jpg?oh=5db4a0c3b9ff704719ea64555b0c2c44&oe=545F4460)
(https://scontent-a.xx.fbcdn.net/hphotos-xpa1/v/t1.0-9/p403x403/10502413_260883810770032_2048340638682846690_n.jpg?oh=31531380c71278f395bc8fecc165da2c&oe=547DD488)
(https://scontent-b.xx.fbcdn.net/hphotos-xap1/v/t1.0-9/10513244_260344137490666_7797779947267026656_n.jpg?oh=aab1b595604a7e68fbe0206867d87fb6&oe=5475514F)
(https://scontent-a.xx.fbcdn.net/hphotos-xfp1/v/t1.0-9/q81/p526x296/10404160_260341610824252_4918004582257061191_n.jpg?oh=2e8109d89e9a683e1bb67072c45f7cb2&oe=546AA0A4)
(https://scontent-a.xx.fbcdn.net/hphotos-xpa1/t1.0-9/q85/p403x403/10460116_259921814199565_470346819730890910_n.jpg)
(https://scontent-b.xx.fbcdn.net/hphotos-xpa1/t1.0-9/q85/p526x296/10443609_259220030936410_5236901597917429122_n.jpg)
(https://scontent-b.xx.fbcdn.net/hphotos-xfp1/v/t1.0-9/1970984_259076644284082_2916751156152395651_n.jpg?oh=c6abdce031f1176ca0deff8c79629baf&oe=546C4CF1)
(https://scontent-b.xx.fbcdn.net/hphotos-xpf1/v/t1.0-9/p526x296/10300971_259076510950762_6925580961786659896_n.jpg?oh=63e35bcf7fd6307d5c409daac390f67a&oe=546186B4)
(https://scontent-a.xx.fbcdn.net/hphotos-xpa1/v/t1.0-9/q87/p526x296/10446627_258997607625319_5673915063393370863_n.jpg?oh=048372255bee9b4422c6244d0c676101&oe=54632115)
(https://scontent-b.xx.fbcdn.net/hphotos-xap1/t1.0-9/10411816_258957187629361_5140462337976403313_n.jpg)
(https://scontent-b.xx.fbcdn.net/hphotos-xpf1/t1.0-9/q86/p403x403/10488149_258837864307960_7909890107895629035_n.jpg)
(https://scontent-b.xx.fbcdn.net/hphotos-xpa1/v/t1.0-9/10411808_258798204311926_6276222304220396743_n.jpg?oh=81f277737c9055dc446d5d6514a21125&oe=547C9331)
(https://scontent-b.xx.fbcdn.net/hphotos-xpf1/v/t1.0-9/q82/p403x403/10464076_258778604313886_4606223881632392709_n.jpg?oh=b42b39bbee29814b1f3a41b442eab0ca&oe=54792EB4)
(https://scontent-a.xx.fbcdn.net/hphotos-xaf1/t1.0-9/p480x480/10409161_258727617652318_8417891861141222285_n.jpg)
(https://scontent-a.xx.fbcdn.net/hphotos-xaf1/v/t1.0-9/q83/p526x296/10487428_258711337653946_385431106593292673_n.jpg?oh=d39ec5365b670dd521373ff0761e0216&oe=545E0414)
-
(https://scontent-b.xx.fbcdn.net/hphotos-xap1/v/t1.0-9/10513244_260344137490666_7797779947267026656_n.jpg?oh=aab1b595604a7e68fbe0206867d87fb6&oe=5475514F)
:L :L :L :L :L :L :L
-
this can't be real :L
(https://scontent-b.xx.fbcdn.net/hphotos-xpf1/v/t1.0-9/p526x296/10300971_259076510950762_6925580961786659896_n.jpg?oh=63e35bcf7fd6307d5c409daac390f67a&oe=546186B4)
-
actually they say it was real, coz that was a promotion of some this kind of toy/playgrounds factory, in china
-
and btw.. :L
[youtube]http://www.youtube.com/watch?v=fv--npievoI[/youtube]
-
(http://weknowmemes.com/wp-content/uploads/2012/03/dolan-yo-mimmy.jpg)
-
(https://scontent-b.xx.fbcdn.net/hphotos-xfp1/v/t1.0-9/1970984_259076644284082_2916751156152395651_n.jpg?oh=c6abdce031f1176ca0deff8c79629baf&oe=546C4CF1)
Oh God, think of the splash. :o
-
GTA SA Mesa (car)
(http://buffetoblog.files.wordpress.com/2014/03/its-a-jeep-thing-you-wouldnt-understand1.jpg?w=608)
-
Say: cheese :L :L
[youtube]eupIKc5Z1qU[/youtube]
-
(https://scontent-b.xx.fbcdn.net/hphotos-xpa1/v/t1.0-9/q81/s720x720/10325212_261900977334982_4219993269360085549_n.jpg?oh=b15bc68bf32922e7f9c84d840d4af194&oe=5477D8FE)
http://steamcommunity.com/sharedfiles/filedetails/?id=183828635
Im actually thinking to put doors on my wall, and to the guests i will tell thats the door to the toilet xD
-
https://www.youtube.com/watch?v=j2yo8YWZ5e4
49:20
-
Only in Malta :L :L :L
[youtube]gw-EXGqNlJ0[/youtube]
-
Haha, poor guy! It really takes skills to drive with this. :L
-
He got suspended xD
http://www.timesofmalta.com/articles/view/20140902/local/updated-driver-bus-suspended-from-service.534085
-
suspended because of company's bus is broken?
-
suspended because of company's bus is broken?
yeh...AND he kept on driving with broken steering...xD it was his fault. He should have stopped driving and tell the service that the wheel is broken etc bla bla xD
-
suspended because of company's bus is broken?
yeh...AND he kept on driving with broken steering...xD it was his fault. He should have stopped driving and tell the service that the wheel is broken etc bla bla xD
hahahahahhha xD
-
lol
[youtube]http://www.youtube.com/watch?v=Wnsdc7cTPuU[/youtube]
-
lol
[youtube]http://www.youtube.com/watch?v=Wnsdc7cTPuU[/youtube]
fully gta style xD
-
[youtube]-w-58hQ9dLk[/youtube]
[youtube]X2WH8mHJnhM[/youtube]
-
[youtube]https://www.youtube.com/watch?v=-w-58hQ9dLk[/youtube]
[youtube]https://www.youtube.com/watch?v=X2WH8mHJnhM[/youtube]
Can't see any of them xd
-
I have no idea, it happened the last time to.
Can someone fix it please?
-
fixed, you are supposed to enter the part after watch?=
-
Thanks :)
-
Also it's because of https instead of http if you put whole link
-
(http://thatsfreakingfunny.com/wp-content/uploads/2013/06/walmart-people-897.jpg)
-
(http://img-9gag-lol.9cache.com/photo/aMb9b6M_700b.jpg)
-
fully true
-
[spoiler=may seems to be NSFW, but in fact it isn't + a new level of 'ice bucket challenge']
(http://i1.kwejk.pl/k/obrazki/2014/09/605d7ac8-0611-41dc-a21c-94a53dfae6b5_original.jpg)
WTF? ? ? ? ? ?
[youtube]0CX2CqrGiWY#t=117[/youtube]
[/spoiler]
-
[youtube]3ZPL4ER2ohg[/youtube]
-
[youtube]http://www.youtube.com/watch?v=WEWG6kSYqlY[/youtube]
-
(http://s11.postimg.org/6l0so3z8z/1620685_812162658809737_1835339781_n.jpg)
-
(http://i.imgur.com/urnAyo6.jpg)
OP ZLATAN IN FIFA 15 :OO
FIFA 15 Demo avaible on origin, so download!
-
[youtube]http://www.youtube.com/watch?v=yOpQdzyQeoE[/youtube]
-
[youtube]http://www.youtube.com/watch?v=_F6dcxYPrxI[/youtube]
-
(http://media-cache-ec0.pinimg.com/236x/0f/b6/d0/0fb6d087e83c64b30bf6dbafc24773b4.jpg)
-
omg
[youtube]http://www.youtube.com/watch?v=gIwjMRUU4oQ[/youtube]
-
(http://fat.gfycat.com/HappygoluckyVioletDavidstiger.gif)
-
(https://i.imgur.com/FzT6LAH.jpg)
-
ive watched this like 10 times lol
[youtube]http://www.youtube.com/watch?v=EzVxEVfr8Og[/youtube]
-
(http://fat.gfycat.com/HappygoluckyVioletDavidstiger.gif)
h3uh3u3hu3hu3
-
[youtube]B7nLEJrYGZU[/youtube]
-
[youtube]http://www.youtube.com/watch?v=NLW__F4JzAI[/youtube]
paper plane Cessna 172, flying and detailed
-
[youtube]http://www.youtube.com/watch?v=NLW__F4JzAI[/youtube]
paper plane Cessna 172, flying and detailed
I thought that would keep flying by itself getting ride from the fan.
-
if you would hang it on some very thin rope to that fan, maybe it would
weight is too small so fan normally blows it away
-
First iPhone 6 owner. Oh wait... I just dropped it :L
[youtube]http://www.youtube.com/watch?v=2bPwfLe13Uo[/youtube]
-
lol who cares about iPhone? :L welcome back to 2012 iPhone 6 users!
-
(http://i.imgur.com/cCMUsg5.jpg)
-
[youtube]http://www.youtube.com/watch?v=1DSIXXBx-Zw[/youtube]
-
LOL... never tough of that
[spoiler=some may find this offensive, but on longer run it's "kinda true"]
[youtube]http://www.youtube.com/watch?v=6jdXfiFgxFM[/youtube][/spoiler]
-
that name...... :L :L
(http://i1316.photobucket.com/albums/t605/zurriequnited/datname_zpsca2eb9c3.jpg)
-
(http://img1.wikia.nocookie.net/__cb20110812073406/half-life/en/images/8/86/Fan_pickets_HL3_gabe.jpg)
-
(http://joemonster.org/images/vad/img_29852/f6634eb8b4a02ad31d4437c20ee10f20.jpg)
(http://joemonster.org/images/vad/img_29852/e13c47c4a0ba41d54252cddd7d83df3b.jpg)
(http://joemonster.org/images/vad/img_29852/49fb4b1a244b08e74cd0d16986b8ae58.jpg)
(http://joemonster.org/images/vad/img_29852/f92202cd3f6bbac17019504d7c203ea1.jpg)
Polish-english dictionary:
(http://i1.kwejk.pl/k/obrazki/2014/09/930e986f-ae47-4088-a303-b25916a7426b_original.jpg)
-
I got bored and decided to test this config out :L
(http://cloud-4.steampowered.com/ugc/540753385244001698/BC666DA3385EB1CAF3ED5692EC22813FCA5CDD08/)
-
whole thing is epic funny
but jump at 33:35 and that comment after it "I'm Glad You made it down safetly" nailed it
[youtube]http://www.youtube.com/watch?v=INqD9q8I2Cc[/youtube]
-
(https://scontent-b-cdg.xx.fbcdn.net/hphotos-xap1/v/t1.0-9/1975001_10152720595026840_507051550047099921_n.jpg?oh=f855391d7eb6f04f7ac51167a8c5ecbb&oe=54BCAE2B)
:L
-
(http://i.imgur.com/WMC73KT.gif)
-
(http://img-9gag-lol.9cache.com/photo/a9MAV01_460s.jpg)
:D
-
(http://img1.wikia.nocookie.net/__cb20110812073406/half-life/en/images/8/86/Fan_pickets_HL3_gabe.jpg)
lol @ car behind lord gaben :L
-
(https://scontent-b-fra.xx.fbcdn.net/hphotos-xfp1/v/t1.0-9/10494753_872579279442770_6890396374360443360_n.jpg?oh=37c75e55ac94567bbf1057308f69b892&oe=54B77997)
lauren is that you????? :'( :L :L :L :L
-
No, but i'd do the same, with nba instead and energy drinks with pepsi :police:
-
Pssh I bet you guys even kiss girls. What casuals
-
[youtube]http://www.youtube.com/watch?v=Y3wU2cldRsU[/youtube]
-
lol these japanese
-
hahahahahhahaahhahahahahahahahah
-
That is China, but it's okay because Audi drivers are the same all over the world. :L
-
Yeah, probably Taiwan. And I thought Audi drivers were the worst ones only in France :L
-
Audi drivers worldwide... When I see I'm gonna have an Audi behind me I know they're gonna be like 5 inches away from the bumper and overtake as soon as they can, going back into the lane a few inches from the front bumper and then suddenly brake...
I have also seen some assholes in Toyota LandCruiser and 4Runner
-
What a shame for that beautiful Audi. In Poland we have the same thinking about BMW drivers though. Didn't hear anything bad about Audi lol. Also Volkswagen drivers are idiots sometimes. A few times when I was in a no hurry I was driving 60-70kph and most of VW want to overtake. Some of them do it and brake in front of you afterwards so you just know "oh hey asshole you are so slow so imma scam your insurance"
-
What a shame for that beautiful Audi. In Poland we have the same thinking about BMW drivers though. Didn't hear anything bad about Audi lol. Also Volkswagen drivers are idiots sometimes. A few times when I was in a no hurry I was driving 60-70kph and most of VW want to overtake. Some of them do it and brake in front of you afterwards so you just know "oh hey asshole you are so slow so imma scam your insurance"
Same in my Country lol
-
In Germany, most Audi A3/A4 and some BMW models are mostly used as company cars. So this might explain their bad driving.
If someone pisses me off too much and there is a company logo somewhere on the car, I just send the company and e-mail and described behaviour of the drivers. Only way to make them learn.
-
This is even better. Courier company in Poland:
[youtube]http://www.youtube.com/watch?v=WoOM1qHIQdg[/youtube]
-
well well...I didn't see any problems about them in Malta xD they just drive in peace :D
-
koreans on some serious drugs :L
[youtube]http://www.youtube.com/watch?v=gZa4yre0uEk[/youtube]
-
what happens if a man screaming at the night in Sweden
[youtube]QfCn2CS8jT0[/youtube]
-
:L :L :L :L :L :L :L :L :L :L :L :L
[youtube]http://www.youtube.com/watch?v=vbvjChd0mZE[/youtube]
-
what happens if a man screaming at the night in Sweden
[youtube]QfCn2CS8jT0[/youtube]
lol if you did that here in CZR, someone pissed off would just shout "shut up" and the police would have to answer hundreds of calls made by old people
-
lol it's a tradition, not just random screaming. google 'flogsta scream'.
-
[youtube]Vuv3y3r7UXA[/youtube]
The opera guy hahahahahahahh
-
How you see Ferrari F12
(http://i.imgur.com/4uIXe6S.jpg)
can't be unseen...
-
well actually if you pay attention most cars have a nice face, well BMW 1 series (the old one) seems to be sad, but most look happy XD
-
(http://www.lincolnshire.me.uk/gallery/d/1827-2/Happy+Car)
-
lol thats one happy car
-
(https://img.4plebs.org/boards/o/image/1389/63/1389639141381.jpg)
-
(http://i.imgur.com/Na5xIXh.jpg)
-
"this is an interesting ground"
-
(http://i.imgur.com/Na5xIXh.jpg)
i wanna see someone driving using the car this way :L
-
FART METAL, no more words needed!
[youtube]http://www.youtube.com/watch?v=Qj1JnOd7c9M&feature=youtu.be[/youtube]
-
(http://i.imgur.com/Na5xIXh.jpg)
Poor Isuzu NKR :L
-
This makes me laugh a lot more than it should lol
(http://31.media.tumblr.com/76eeefb8a253d6a822d28dc624cadcb6/tumblr_msiyj2bGf21s2eiu1o1_250.gif)
-
What an embarrassing moment for him lol... Poor guy.
-
lmao
-
https://www.facebook.com/video.php?v=10203364141959933&set=vb.1102803105&type=2&theater
-
[youtube]http://www.youtube.com/watch?v=Jo1tjBmwuXI[/youtube]
-
[youtube]kKq3hErU0QQ[/youtube]
-
MadMax
(http://images.orkut.com/orkut/photos/OgAAAPwH8NM_ZMh90hoRSdg9bne4vxomAgJbv62huyNWoV_W5ZqVE7XEVDL1YeGPVrhVXbUtw_nWy338AIILVUuMkiMAm1T1UE3Bi5InlIHrwA5H_XXXVTbnp2eg.jpg)
-
https://www.facebook.com/video.php?v=485163021623683&set=vb.100003899697375&type=3&theater
Best song 2014
-
[youtube]unwujSVpZwA[/youtube]
-
Russians trying to get the cat off a tree. Well, Russians... You can guess what's coming next :L A compilation of failures haha:
[youtube]http://www.youtube.com/watch?v=V_Nr31Lv6H8[/youtube]
-
Russians trying to get the cat off a tree. Well, Russians... You can guess what's coming next :L A compilation of failures haha:
Wooooow loool. Even the cat is stupid. :L
-
hahahhahahahahahahahhahha Soviet Union failed
-
:L
(https://41.media.tumblr.com/ffc430764eab089fa537bf11138d7089/tumblr_muvwjjgOW11qgtnlxo1_500.jpg)
-
Verona fcking beach
(http://i.imgur.com/WSF3QkX.jpg)
Wat?
(http://i.imgur.com/pQB46g1.jpg)
dont really understand 1st one
-
(http://img-9gag-lol.9cache.com/photo/apoNyR9_700b.jpg)
swag overload
-
(http://image-store.slidesharecdn.com/3bad87a1-387a-48da-87bc-4cfcf5a26b28-large.jpeg)
:L :L :L :L
-
[youtube]http://www.youtube.com/watch?v=4y6npuKXonE[/youtube]
-
The guy is like "idc, jajajaja" :L
-
.................... O0...................
____________________________________________________________________________________________________________________
(http://i62.tinypic.com/10hkbco.png)
-
You must watch this lol :L
[youtube]http://www.youtube.com/watch?v=ifCmvLNQl3s[/youtube]
-
:L :L :L :L :L :L :L :L :L :L :L :L
-
:L :L :L
-
HAHA OH MY GOD! :L
-
lol wtf :L
-
[youtube]http://www.youtube.com/watch?v=KaqC5FnvAEc[/youtube]
-
(tokyo, new york, são paulo)
(https://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-xpa1/v/t1.0-9/551449_727896313971991_4843187585728108618_n.jpg?oh=6035714cb82a622d22aedad9cf157436&oe=54E401CE&__gda__=1424861772_45c68e564a4cc5a2ec1b43edb179ddba)
-
lol Tóquio
-
That's cute, what's that big bird called?
-
[youtube]Dn5i5AYQQ-g[/youtube]
-
That's cute, what's that big bird called?
Galinha Pintadinha, it's for kids.
>>>https://www.youtube.com/watch?v=LSrC65i9kkA
-
<Angry Ghetto Gamer video>
That's just mean. :(
-
[youtube]http://www.youtube.com/watch?v=cAsTmaQqeyY[/youtube]
-
(https://scontent-b-ams.xx.fbcdn.net/hphotos-xpf1/v/t1.0-9/10698579_770926489639522_1606232005941862868_n.jpg?oh=c7de5e6f1878ea3c7118f207f5e0d5f3&oe=54F295A4)
-
[youtube]http://www.youtube.com/watch?v=ojiMI3lCH9k#t=38[/youtube]
-
lol
(https://scontent-b-gru.xx.fbcdn.net/hphotos-xap1/v/t1.0-9/10455698_999420436751323_1758878319199166143_n.jpg?oh=f05b6b1733148302f9c9f523449aa776&oe=54AE6D04)
btw:
by myself = sozinho
by himself = sozinho
by herself = sozinha
by yourself = sozinho/sozinha
by ourselves = sozinhos
by themselves = sozinhos
example: "I made this by myself" = "Eu fiz isso sozinho"
-
ponto ponto ponto :L :L :L :L :L
-
(http://abload.de/img/10702227_7935155440248hpof.jpg)
-
How would I understand that shit? :blank:
-
Learn German :L
-
Learn German :L
life is too short to learn german.
-
Learn German :L
life is too short to learn german.
yee, but You may really need it in afterlife... if You are bad and go to hell, for example. :L
*important notr: it's was just refference to an old joke, not to get offened by it
-
Learn German :L
life is too short to learn german.
yee, but You may really need it in afterlife... if You are bad and go to hell, for example. :L
*important notr: it's was just refference to an old joke, not to get offened by it
:L :L :L :L :L :L :L
-
(http://i.imgur.com/laxsJHr.jpg)
(http://i.imgur.com/FbB1037.jpg)
-
lol
-
[youtube]KPHDzvd8wzo[/youtube]
-
Does everyone remember Barbapapa?
(http://www.barbapapa.fr/image/barbapapa_d_01.gif)
[spoiler][youtube]http://www.youtube.com/watch?v=7gzrAmwWqF8[/youtube][/spoiler]
:L
-
[youtube]bHXr8aAT-pI[/youtube]
-
[youtube]http://www.youtube.com/watch?v=UIz48gG5hV4[/youtube]
-
Look what I found just outside my work today, would've never expected to see one of these actually on the road:
(http://abload.de/img/img_141053o3m.jpg)
(http://abload.de/img/img_1409fpp7b.jpg)
-
No pics gg
-
http://instagram.com/p/vBQpAKvm2i/?utm_source=partner&utm_medium=embed&utm_campaign=video
-
[youtube]http://www.youtube.com/watch?v=01noMDs4oM4[/youtube]
-
Pictures from my post work fine for me, anybody else having problems like terrorfist? :-\
-
Pictures from my post work fine for me, anybody else having problems like terrorfist? :-\
Nvm it's fixed now, the problem is annoying. Pretty much happens in South East Asia due to broken communication cable under the sea in Vietnam.
-
lol wicked plate too 666 >:D
-
(http://2.bp.blogspot.com/-wa49Tpi-sLI/Tud96dEAuwI/AAAAAAAAD2k/jo_524AZ1VQ/s400/fat+pervert.jpg)
-
Feeding roboter? Sounds like a great idea...
(http://img-9gag-lol.9cache.com/photo/a2PMVQe_460sa_v1.gif)
-
Tight pants are tight, but catchy song is catchy... :L
[youtube]-0AlZ3a32Lk[/youtube]
-
nowadays dance this way is ridiculous :L :L :L
-
[youtube]http://www.youtube.com/watch?v=Kn0689gvLFQ#t=70[/youtube]
Listen to this guy's laugh :L :L :L :L :L :L
-
CEO of Yahoo lol
[youtube]mcSujceZDmg[/youtube]
-
CEO of Yahoo lol
[youtube]mcSujceZDmg[/youtube]
hahahahahahahahahahaha
-
[youtube]CkG9CbBuLqM[/youtube]
-
[youtube]http://www.youtube.com/watch?v=01noMDs4oM4[/youtube]
ROOOFL 2:23 spanish sentence
-
(https://fbcdn-sphotos-c-a.akamaihd.net/hphotos-ak-xpa1/v/t1.0-9/1503381_10152890027461840_7224923621089205035_n.jpg?oh=73941766a82ef0f9f91a439b787c16fb&oe=54D30172&__gda__=1425030680_e6f936b1f5224c98a309e28fd62c4c62)
-
[youtube]http://www.youtube.com/watch?v=DSumbNiCQpM[/youtube]
:-X
-
[youtube]http://www.youtube.com/watch?v=DSumbNiCQpM[/youtube]
:-X
a fucking shame that she and her shitty music got that famous, and then the music genius called ''Mike Oldfield'' isn't as famous as her.. makes me wanna cry :blank:
-
portuguese > all
(https://fbcdn-sphotos-d-a.akamaihd.net/hphotos-ak-xfp1/v/t1.0-9/10802041_761300613940405_5728564489779441331_n.jpg?oh=266894df9d8108a0dd8c9c2248ad0eed&oe=54DCC157&__gda__=1424185054_ebe7ef91ee86095fdac1e723bf523b13)
-
kkkkkkkkkkkkkkkkk
-
[youtube]http://www.youtube.com/watch?v=9tsZu8UpUXg[/youtube]
:L :L :L
-
[youtube]FiB-Es2VSGk[/youtube]
-
[youtube]http://www.youtube.com/watch?v=9tsZu8UpUXg[/youtube]
:L :L :L
:L :L :L :L
-
[youtube]http://www.youtube.com/watch?v=9tsZu8UpUXg[/youtube]
:L :L :L
:L :L :L :L
it's mooman and snoopy :L :L
-
[youtube]_KbBDC6i_a8[/youtube]
-
[youtube]_KbBDC6i_a8[/youtube]
nearly to get an epileptic attack with that shit ???
-
Best kettle joke's from Turkey O0
[youtube]http://www.youtube.com/watch?v=chYEiSKG5k4[/youtube]
[youtube]http://www.youtube.com/watch?v=lcXMlic7BPs[/youtube]
-
U WOT M8
(http://files1.isnichwahr.de/media/zC7t555L0nbgcs2yprPcGg,1416092400/cont/640/inwlive_gifdump_111114/15403271.gif)
-
U WOT M8
(http://files1.isnichwahr.de/media/zC7t555L0nbgcs2yprPcGg,1416092400/cont/640/inwlive_gifdump_111114/15403271.gif)
90's gif :L :L :L :L
-
:L :L :L :L :L :L :L :L
[youtube]PyzpBzsWulM[/youtube]
-
FATTTTTTTTTTTTTT :L :L :L :L :L
-
[youtube]b8HO6hba9ZE[/youtube]
-
Gymkhana 7 is out
[youtube]5qanlirrRWs[/youtube]
-
Gymkhana 7 is out
[youtube]5qanlirrRWs[/youtube]
nice, 2F2F, Los Angeles City ftw
-
(http://cdn.themetapicture.com/media/funny-ACDC-ball-Miley.jpg)
from 1996... miley was like... 4-5 years old?
[youtube]http://www.youtube.com/watch?v=vtw3IPYTfmA[/youtube]
-
Gymkhana 7 is out
[youtube]5qanlirrRWs[/youtube]
awesome! how the hell can he be so precise in all that smoke lol
and the mustang looks sexy ^-^
-
(http://i.imgur.com/b1JOIfD.gif)
-
(http://forum.adrenalinex.co.uk/index.php?action=dlattach;attach=4957;type=avatar)
:L :L :L :L :L
-
(http://forum.adrenalinex.co.uk/index.php?action=dlattach;attach=4957;type=avatar)
:L :L :L :L :L
OMG REMOVE IT PLEASE :blank: :'(
-
(http://forum.adrenalinex.co.uk/index.php?action=dlattach;attach=4958;type=avatar)
:L :L :L :L :L :L
-
haha wtf :L
[youtube]http://www.youtube.com/watch?v=kmwisVEjJFo[/youtube]
-
haha wtf :L
[youtube]http://www.youtube.com/watch?v=kmwisVEjJFo[/youtube]
HAHAHAHAAHAHAHAHAHAHAHHAAHAHAHAHAHAHAHAHAH
-
lol
https://vine.co/v/MBw2a2PWi76/embed (https://vine.co/v/MBw2a2PWi76/embed)
-
[youtube]http://www.youtube.com/watch?v=NvJ7KWlgCaU[/youtube]
-
[youtube]http://www.youtube.com/watch?v=NvJ7KWlgCaU[/youtube]
lol :L
-
(http://i1.kwejk.pl/k/obrazki/2014/11/c1212b7105cb83f684f615abceab3976.jpg)
-
:L :L :L :L :L :L
-
anyway "Fuel" got insane big map for a racing game, from 1 side to other you must keep driving for around 2 hours real time
-
anyway "Fuel" got insane big map for a racing game, from 1 side to other you must keep driving for around 2 hours real time
Now that's real driving.
-
I would like to see TDU2 in there, Hawaii part is big, full lap takes a while to drive
-
fuel got biggest area for any car game, compared to hawai tdu:
http://i.imgur.com/DGmayzb.jpg
here guy is doing a 8 hour trip, worth reading, never seen any bigger area in racing game
http://www.rockpapershotgun.com/2009/06/22/fuel-around-the-world-in-eight-hours/
back to topic:
(http://i1.kwejk.pl/k/obrazki/2014/11/2db07ff5dd13df9375c87e890f0c721c.jpg)
(http://i1.kwejk.pl/k/obrazki/2014/11/4d399810ad2f815974899d1be7ec4566.jpeg)
(http://i1.kwejk.pl/k/obrazki/2014/11/f77013b4e55a7a4f61859f50cb119958.gif)
(http://i1.kwejk.pl/k/obrazki/2014/11/610a36b161a4d069bcf73f96ae1c1ec6.jpeg)
(http://img.myepicwall.com/2014/11/11583ceaa27c29c00501705d951aae3f.jpg)
(http://img.myepicwall.com/2014/11/3aa11fc9c0d91304b2d81f40d3b27984.jpg)
-
[youtube]http://www.youtube.com/watch?v=6fZwJFjiA0A[/youtube]
-
Opening car like GTA :L
[youtube]http://www.youtube.com/watch?v=MYcEwKmjnys[/youtube]
-
Opening car like GTA :L
[youtube]http://www.youtube.com/watch?v=MYcEwKmjnys[/youtube]
:L :L :L :L :L :L :L
-
[youtube]http://www.youtube.com/watch?v=V3Vgptnstyc[/youtube]
-
HURR DURR LOOK AT ME, I'M A DOG!
(http://38.media.tumblr.com/f28bcc4761c6cf72689bf5727e431f91/tumblr_nd1ndiKmhy1ta83ebo1_400.gif)
-
[youtube]http://www.youtube.com/watch?v=E-Fe1DFjhgM[/youtube]
:L :L :L
-
(http://i.imgur.com/NHpc4th.jpg) :L
-
https://www.youtube.com/watch?v=dTCYZjeAC0E
-
[youtube]http://www.youtube.com/watch?v=tND6WneJrgA[/youtube]
-
she shits avoid :L :L :L :L :L :L :L :L
-
(https://farm9.staticflickr.com/8574/15756614218_730a48cd16_b.jpg)
-
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-01.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-02.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-03.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-04.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-05.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-06.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-07.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-08.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-09.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-10.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-11.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-12.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-13.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-14.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-15.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-16.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-17.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-18.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-19.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-20.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-21.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-22.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-23.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-24.jpg)
(http://img.joemonster.org/i/2014/12/artists-mashes-faces-names-hybrids-25.jpg)
-
lol
-
[youtube]ynNOa5-P4Bg[/youtube]
-
(http://img-9gag-ftw.9cache.com/photo/aGVOEM0_700b.jpg)
(http://img-9gag-ftw.9cache.com/photo/azLY8Mq_700b_v1.jpg)
-
(http://s.cdaction.pl/obrazki//nadgodziny-12-10-14-50_bzowk.jpg)
-
(http://s.cdaction.pl/obrazki//nadgodziny-12-10-14-50_bzowk.jpg)
:L :L :L :L :L
-
Not sure if repost, but main reason why I stopped playing DayZ
(http://img-9gag-ftw.9cache.com/photo/aPy1xgQ_700b_v1.jpg)
-
Not sure if repost, but main reason why I stopped playing DayZ
http://img-9gag-ftw.9cache.com/photo/aPy1xgQ_700b_v1.jpg
Reminds me of GTA:Online lol. :L
-
Yeah, GTA:O is kinda like this, but it's easier to stay away from fucktards and if they actually get you, you don't lose hours of work.
-
(https://pbs.twimg.com/media/B2icuWwCcAEP5nv.jpg)
-
(https://pbs.twimg.com/media/B2icuWwCcAEP5nv.jpg)
it's very noisy
-
Shit:
(http://www.ericdoeringer.com/shitstream/shitstream.jpg)
More Shit:
(http://www.ericdoeringer.com/shitstream/shitmonth.jpg)
-
*disgusting pictures*
Why would you even post that?
-
you need a psychiatrist
-
i think max is getting hungry
-
NSFW? (click on own risk)
http://i.imgur.com/c37cLIO.jpg
-
rofl
[youtube]http://www.youtube.com/watch?v=iKvoJdp3iRs[/youtube]
-
rofl
[youtube]http://www.youtube.com/watch?v=iKvoJdp3iRs[/youtube]
like a boss 8)
-
[youtube]http://www.youtube.com/watch?v=NNYyOGsEE84[/youtube]
-
This is FPS Games Logic
[spoiler](http://img-9gag-ftw.9cache.com/photo/aVQBQ5d_700b.jpg)[/spoiler]
-
:L :L :L :L :L :L :L :L
-
[youtube]gArcd8I2X28[/youtube]
-
oh lol my vid
-
(http://s12.postimg.org/fkhk2catp/998652_10151674539874624_1649379339_n.jpg)
-
/\?
-
/\?
easy password :L
-
(http://r2-store.distractify.netdna-cdn.com/postimage/201412/10/adafda69ea58fbbbe6f2dbfdba33102f_650x.jpg)
(http://r2-store.distractify.netdna-cdn.com/postimage/201412/10/f761dfdc3d8eee08a9c087ee9181059d_650x.jpg)
(http://r2-store.distractify.netdna-cdn.com/postimage/201412/10/7074211e2890c817defba521f5fc6db1_650x.jpg)
(http://r2-store.distractify.netdna-cdn.com/postimage/201412/10/0ee6c3aa8b3d85f5aef6ebfec50deaca_650x.jpg)
(http://r2-store.distractify.netdna-cdn.com/postimage/201412/10/fd1523adcce0c8a92a89674fb9c48a78_650x.jpg)
(http://r2-store.distractify.netdna-cdn.com/postimage/201412/10/5edb04780da100f8c249e40cca89278a_650x.jpg)
(http://r2-store.distractify.netdna-cdn.com/postimage/201412/10/c00b3230eee2963955deec27f9acd92c_650x.png)
(http://r2-store.distractify.netdna-cdn.com/postimage/201412/10/5f3020cdc49b1c76cdf9293142163e26_650x.jpg)
(http://r2-store.distractify.netdna-cdn.com/postimage/201412/10/e58b641384cc3a71f45d5058a62a7ead_650x.png)
-
I'm on the wrong side of the forums again.
-
it's becoming deep web
-
...
More:
http://coloringbookcorruptions.com/
http://www.reddit.com/r/coloringcorruptions
-
haha those are awesome! :L
-
[g]old
[youtube]http://www.youtube.com/watch?v=cVy7YeeqGZQ[youtube]
-
Merry Christmas
Merry Christmas
[youtube]vgaODLvQ-Ew[/youtube]
Merry Christmas
Merry Christmas
-
Merry Christmas
Merry Christmas
[youtube]vgaODLvQ-Ew[/youtube]
Merry Christmas
Merry Christmas
:L :L :L :L :L :L
-
Merry Christmas lazy's :L
[youtube]http://www.youtube.com/watch?v=Cjl34Mgg2Vw[/youtube]
-
[g]old
[youtube]http://www.youtube.com/watch?v=cVy7YeeqGZQ[/youtube]
-
Santa is getting later (riding a Faggio) :L
(http://www.skuola.net/news_foto/babbo-natale-vespa.jpg)
-
Weird Al Yankovic - The Night Santa Went Crazy :L
[youtube]http://www.youtube.com/watch?v=HTGlUMvbhSw[/youtube]
Lyrics:
[spoiler]Down in the workshop all the elves were makin' toys
For the good Gentile girls and the good Gentile boys
When the boss busted in, nearly scared 'em half to death
Had a rifle in his hands and cheap whiskey on his breath
From his beard to his boots he was covered with ammo
Like a big fat drunk disgruntled Yuletide Rambo
And he smiled as he said with a twinkle in his eye,
"Merry Christmas to all - now you're all gonna die!"
The night Santa went crazy
The night St. Nick went insane
Realized he'd been gettin' a raw deal
Something finally must have snapped in his brain
Well, the workshop is gone now, he decided to bomb it
Everywhere you'll find pieces of Cupid and Comet
And he tied up his helpers and he held the elves hostage
And he ground up poor Rudolph into reindeer sausage
He got Dancer and Prancer with an old German Luger
And he slashed up Dasher just like Freddy Krueger
And he picked up a flamethrower and he barbequed Blitzen
And he took a big bite and said, "It tastes just like chicken!"
The night Santa went crazy
The night Kris Kringle went nuts
Now you can't hardly walk around the North Pole
Without steppin' in reindeer guts
There's the National Guard and the F.B.I.
There's a van from the Eyewitness News
And helicopters circlin' 'round in the sky
And the bullets are flyin', the body count's risin'
And everyone's dyin' to know, oh Santa, why?
My my my my my my
You used to be such a jolly guy
Yes, Virginia, now Santa's doin' time
In a federal prison for his infamous crime
Hey, little friend, now don't you cry no more tears
He'll be out with good behavior in 700 more years
But now Vixen's in therapy and Donner's still nervous
And the elves all got jobs working for the postal service
And they say Mrs. Clause, she's on the phone every night
With her lawyer negotiating the movie rights
They're talkin' bout - the night Santa went crazy
The night St. Nicholas flipped
Broke his back for some milk and cookies
Sounds to me like he was tired of gettin' gypped
Wo, the night Santa went crazy
The night St. Nick went insane
Realized he's gettin' a raw deal
Something finally must have snapped in his brain
Wo, something finally must have snapped in his brain
Tell ya, something finally must have snapped... in his brain [/spoiler]
-
(https://fbcdn-sphotos-b-a.akamaihd.net/hphotos-ak-xpa1/v/t1.0-9/1544329_768471059907351_8006732803504892908_n.jpg?oh=b9e3cce83b2eb27b8ff6c47d40094988&oe=5530DB18&__gda__=1430732581_9797f7cb36204e2c8d1d03e4a86fa975)
-
(http://s2.postimg.org/dmybqju7d/cat_black.jpg)
-
brazilians going to the beach today
(http://s2.glbimg.com/tYLO_EBlKJTpBC0JuAjwLl5lPwE=/fit-in/1080x1080/s2.glbimg.com/TMVwYBHPZTdXTl0mgdLl71YSuN0=/0x0:1920x1080/1920x1080/s.glbimg.com/jo/g1/f/original/2014/12/31/estrada2.jpg)
-
brazilians going to the beach today
(http://s2.glbimg.com/tYLO_EBlKJTpBC0JuAjwLl5lPwE=/fit-in/1080x1080/s2.glbimg.com/TMVwYBHPZTdXTl0mgdLl71YSuN0=/0x0:1920x1080/1920x1080/s.glbimg.com/jo/g1/f/original/2014/12/31/estrada2.jpg)
Pretty much looks like the North Luzon Expressway in our country
-
:L
[youtube]http://www.youtube.com/watch?v=F1aYMsrvNCU[/youtube]
[youtube]http://www.youtube.com/watch?v=NBR32GMzcYc[/youtube]
-
Fuckin' birdbrain :L
(http://i.imgur.com/WdbLYkF.gif)
-
[spoiler](http://www.chamsko.pl/demot/0_1_60834_Slownik_przez_abando.jpg)
(http://i.imgur.com/ycXnNi6.jpg)[/spoiler]
-
:L :L :L :L
-
[spoiler](http://www.chamsko.pl/demot/0_1_60834_Slownik_przez_abando.jpg)
(http://i.imgur.com/ycXnNi6.jpg)[/spoiler]
kurwa?
-
kurwa?
kurwa
-
[youtube]http://www.youtube.com/watch?v=q8Fc21ldeZU[/youtube]
-
Technical KnockOut :L
[youtube]http://www.youtube.com/watch?v=AiJ-hLWoPQk[/youtube]
[spoiler]Mike Tyson freaked out on Canadian TV Wednesday, but not everything that was said was easy to understand. We're got you covered with this complete transcript of the memorable verbal battle between Tyson and CP24 anchor Nathan Downer.
Downer: "Some of your critics would say, you know, there is a race for mayor, we know you're a convicted rapist, this could hurt his campaign. How would you respond to that?
Tyson: "Hey, um, I don't know who said that, you're the only one I heard say that. You know what I mean? And I don't have no comment to that. You know because it's negative and you're being negative and I met, I met the mayor and nothing they can do about it."
Tyson promoter Alex Choko: "We actually had a really good time, we talked about George Chuvalo, who is a legend in your city, a great man, with whom Mike spent quite a bit of time yesterday talking about his life, highs and lows..."
Tyson: "It's so interesting that you come across as a nice guy but you're really a piece of shit. With that comment"
Downer: "Hey, come on."
Tyson: "Fuck you, that was a piece of shit."
Downer: "You know what, we're doing live TV here."
Tyson: "I don't care. What are you going to do about it?"
Downer: "Alright, you got a show that you're doing tonight."
Choko interrupting: "We are. We are. it's raw and it's the real thing. It's the truth"
Downer: "A lot of people are going to be there to see your show. Just tell us a bit about it."
Tyson: "You know, it speaks for itself. Everyone saw the show."
Choko: "It's a Broadway production. It went to Vegas. It went to actually 28 cities in the United States and we're really, really proud to bring it here. We're actually going to Monaco on October 9th. We're going to be in Monte Carlo."
Downer: "Is it nerve-wracking for you to do something like this, or is it more nervous for you to box? How does it compare?"
Tyson: "I don't know, um, it's more nerve-wracking to be here talking to a rat piece of shit like you."
Downer: "Come on Mike."
Tyson: "You know, because you're a piece of shit.
Downer: "Alright..."
Tyson: "You really (inaudible) piece of shit."
Downer: "We're going to wrap up this interview. Thank you for coming in."
Tyson: "Fuck you."
http://www.huffingtonpost.ca/2014/09/10/mike-tyson-canadian-interview-video_n_5799708.html[/spoiler]
-
http://webmup.com/Yvcbe/vid.webm :L
-
[youtube]http://www.youtube.com/watch?v=R1kqvk7FYFo[/youtube]
Amazing little kido :L
-
(http://i.imgur.com/oM9b2U7.jpg)
-
Austria!
-
Didn't know I was so close to Slovenia!
-
So you actually brought the whole country with you on your trip to Europe?..
-
Arnold Schwarzenegger is Australian.
-
So you actually brought the whole country with you on your trip to Europe?..
Pretty much.
-
Too epic...but so awkward lmao :L :L :L :blank: :blank: :blank:
(http://s3-ec.buzzfed.com/static/2015-01/7/16/imagebuzz/webdr11/anigif_optimized-15198-1420666451-16.gif)
(http://s3-ec.buzzfed.com/static/2015-01/7/17/enhanced/webdr08/anigif_enhanced-1770-1420669426-9.gif)
[youtube]a3MyLt6l5n0[/youtube]
-
Too epic...but so awkward lmao :L :L :L :blank: :blank: :blank:
(http://s3-ec.buzzfed.com/static/2015-01/7/16/imagebuzz/webdr11/anigif_optimized-15198-1420666451-16.gif)
(http://s3-ec.buzzfed.com/static/2015-01/7/17/enhanced/webdr08/anigif_enhanced-1770-1420669426-9.gif)
[youtube]a3MyLt6l5n0[/youtube]
WATAFAK? kkkk
-
heh, it shouldn't be that awkward, it's the most natural thing in our lives :P
-
From my perspective, the only ones making it awkward are the parents themselves, giving evasive answers to honest kids questions.
-
[youtube]O2-zhvSJZoY[/youtube]
-
Damned weddings :L
(http://static.qnm.it/www/fotogallery/625X0/118763/sposi-con-i-mitra.jpg) (http://static.qnm.it/www/fotogallery/625X0/118719/corsa-degli-sposi.jpg) (http://static.qnm.it/www/fotogallery/625X0/118727/foto-di-gruppo-con-armi.jpg) (http://static.qnm.it/www/fotogallery/625X0/118733/il-salto-della-sposa.jpg) (http://static.qnm.it/www/fotogallery/625X0/118751/sposa-dal-trampolino.jpg) (http://static.qnm.it/www/fotogallery/625X0/118753/sposa-doppio-mitra.jpg) (http://static.qnm.it/www/fotogallery/625X0/118765/sposi-con-photobomb.jpg) (http://static.qnm.it/www/fotogallery/625X0/118773/sposi-in-mountain-bike.jpg) (http://static.qnm.it/www/fotogallery/625X0/118775/sposi-incidente-a-catena.jpg) (http://static.qnm.it/www/fotogallery/625X0/118785/sposo-travestito.jpg) (http://static.qnm.it/www/fotogallery/625X0/118757/sposa-in-volo.jpg) (http://static.qnm.it/www/fotogallery/625X0/118749/sposa-con-i-videogiochi.jpg) (http://static.qnm.it/www/fotogallery/625X0/118787/taglio-della-torta-con-sega.jpg) (http://static.qnm.it/immagine_max/qnm_fotogallery/53141/sposi14.jpg)
-
[youtube]http://www.youtube.com/watch?v=q7NxL4II_vI&x-yt-cl=84178208&x-yt-ts=1421459669[/youtube]
-
[youtube]http://www.youtube.com/watch?v=q7NxL4II_vI&x-yt-cl=84178208&x-yt-ts=1421459669[/youtube]
it seems gta hehehe
-
[youtube]http://www.youtube.com/watch?v=oT3mCybbhf0[/youtube]
-
[youtube]http://www.youtube.com/watch?v=oT3mCybbhf0[/youtube]
[youtube]cT5xuhySWAY[/youtube]
-
President of Croatia vs president of Brazil hu3
(http://i.imgur.com/rYVp4fc.jpg)
-
[youtube]http://www.youtube.com/watch?v=-1eKfixa7dA[/youtube]
AHAHAAHHAHH :L :L
-
not YOLO :L :L :L
[youtube]5Z4yI7C_beg[/youtube]
-
(http://s8.postimg.org/fcb9pl5w5/Merkel_Muslim.jpg)
-
A small group of fucktards bringing shame over a whole country... :(
-
[youtube]5kwgjkiwMNA[/youtube]
-
President of Croatia vs president of Brazil hu3
http://i.imgur.com/rYVp4fc.jpg
please.. our czech president is the best..
(https://encrypted-tbn1.gstatic.com/images?q=tbn:ANd9GcSYzVYFzBXQhvZI2ltUqOs9ZCVA7kxn1b8mev1WWdLBf4j7LeQ0)
(http://www.stalo-se.cz/wp-content/uploads/2014/04/Zeman-pod-parou.jpg)
(http://www.pobavime.cz/wp-content/uploads/prasoid.jpg)
-
[youtube]http://www.youtube.com/watch?v=MfIWsXZRaIs[/youtube]
Why do I keep getting invalid youtube link all the time? :(
remove the ''s'' from ''https''
-
[youtube]https://www.youtube.com/watch?v=MfIWsXZRaIs[/youtube]
Why do I keep getting invalid youtube link all the time? :(
put only the id. after "="
-
For example this link:
https://www.youtube.com/watch?v=7EM9DtVQQpg
copy those letters and numbers after = , that is, 7EM9DtVQQpg. u're done :)
PS: This looks like Felipe from brazil LOL ([ISG]Chatrillionaire)
[youtube]7EM9DtVQQpg[/youtube]
-
Watch your mind , you risk your brain off :L
[youtube]http://www.youtube.com/watch?v=EauK7wdiMQc[/youtube]
-
[youtube]http://www.youtube.com/watch?v=5lL5xRKquPQ[/youtube]
You must watch this :L
-
[youtube]http://www.youtube.com/watch?v=5lL5xRKquPQ[/youtube]
You must watch this :L
:L :L :L :L
-
[youtube]http://www.youtube.com/watch?v=5lL5xRKquPQ[/youtube]
You must watch this :L
:L :L :L :L
Do You really think it's funny? :blank:
-
[youtube]http://www.youtube.com/watch?v=5lL5xRKquPQ[/youtube]
You must watch this :L
:L :L :L :L
Do You really think it's funny? :blank:
the belching was
-
My tooth ache went gone because of this :L :L :L :L
[youtube]spZJrsssPA0&x-yt-cl=85114404&x-yt-ts=1422579428[/youtube]
-
My tooth ache went gone because of this :L :L :L :L
[youtube]spZJrsssPA0&x-yt-cl=85114404&x-yt-ts=1422579428[/youtube]
AHAHHAHAHAAHHAAHAHAAHHAAH
the worst thing of GTX 980 and GTX 970 is the amount of processors. this shit was very overclocked.
-
Everything's here:
http://www.buzzfeed.com/hyvesredactie/the-46-most-hilarious-names-ever-7j5s
-
[youtube]http://www.youtube.com/watch?v=nJVbomZOrYA[/youtube]
-
that face.... :L
(http://i1316.photobucket.com/albums/t605/zurriequnited/HOGDSON_zps20df3918.jpg)
-
Ok, I've come this far, I think that means I've had enough internet for today
[youtube]http://www.youtube.com/watch?v=sIL1v0GdkeA[/youtube]
-
Ok, I've come this far, I think that means I've had enough internet for today
[youtube]http://www.youtube.com/watch?v=sIL1v0GdkeA[/youtube]
13 years old + webcan = shit :laugh:
-
[youtube]D9HvS_niU50[/youtube]
-
You are bored.
You have no idea what to do?
You have 3 Smartphones?
Let them talk to each other.
Fun factor: 100%
[youtube]ONEzRsXGFv0[/youtube]
Let's MOO this :L
(http://files1.isnichwahr.de/media/FlWXSO-R6hMqObPNZpyNdw,1424732400/cont/640/inwlive_gifdump_040215/18442618.gif)
-
[youtube]http://www.youtube.com/watch?v=nGnfmjKMMU8[/youtube]
Just cant stop laughing :L :L :L
-
(http://s17.postimg.org/qioqdv3jz/congelada_20120402183214.jpg)
-
[youtube]68aImgTHtaI[/youtube]
-
[G]OLD :L :L
[youtube]crejWfattI8[/youtube]
-
(https://40.media.tumblr.com/5036b8e62fd2a60cad14a03e813f1037/tumblr_n8oeg26ZCy1tew4mqo1_1280.jpg)
-
I cant really tell the difference
-
still rollong on floor.
[youtube]http://www.youtube.com/watch?v=EsBC-vF0ZeU[/youtube]
-
https://www.facebook.com/video.php?v=10152626555902051&set=vb.95579612050&type=2&theater
-
haha i was kind of tired of all the thug life videos but that was great
-
haha, that cat is sooo evil :L
-
lmao
[youtube]http://www.youtube.com/watch?v=afR7py5pLF8#t=189[/youtube]
-
lmao
[youtube]http://www.youtube.com/watch?v=afR7py5pLF8#t=189[/youtube]
:L :L :L
-
[youtube]Os6raCCmAFk[/youtube]
-
https://www.facebook.com/video.php?v=919441188102771
:L :L :L :L
-
(https://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-xpf1/v/t1.0-9/10997485_426240864210162_8446979728469946752_n.jpg?oh=a52b4ee3f1ce2faa07e375726a69ba95&oe=5575AA0D&__gda__=1438417767_0f1638c98c12e7d48a5bfafd427b1000)
-
:L :L :L :L :L :L :L :L :L
(https://fbcdn-sphotos-h-a.akamaihd.net/hphotos-ak-xpf1/v/t34.0-12/11041418_10203816061097821_1665565667_n.jpg?oh=856f8d6ee07889197f5bd6c00f642e7b&oe=54FEB6C4&__gda__=1425982933_e673735e379c42e7b2b07c4faccad6c2)
-
:L :L :L :L :L :L :L :L :L
(https://fbcdn-sphotos-h-a.akamaihd.net/hphotos-ak-xpf1/v/t34.0-12/11041418_10203816061097821_1665565667_n.jpg?oh=856f8d6ee07889197f5bd6c00f642e7b&oe=54FEB6C4&__gda__=1425982933_e673735e379c42e7b2b07c4faccad6c2)
Stop stealing my photos from FB >:(
-
I'm gonna need her name for...uhm... research purposes
-
Can't you reverse image search? lol
Nikita Klæstrup
-
Her name is Nikita Klaestrup, and she is a danish politican. She is 20 years old and lives somewhere in south Denmark. She is mainly known for her half-nude pictures and has been noticed in playboy magazine. For more info contact me via pm.
-
For more info contact me via pm.
:L
-
[youtube]http://www.youtube.com/watch?v=pch0wNRDr-c[/youtube]
-
(http://i1316.photobucket.com/albums/t605/zurriequnited/Mobile%20Uploads/FB_IMG_1426077460174_zpseepyaj6k.jpg)
:L
-
lmao
-
lmao
-
(http://i1316.photobucket.com/albums/t605/zurriequnited/Mobile%20Uploads/FB_IMG_1426077460174_zpseepyaj6k.jpg)
:L
:L :L :L :L :L :L :L :L
-
I like apple produts (not every single) but this one killed me :L :L :L
[youtube]KHZ8ek-6ccc[/youtube]
-
haha how was he still breathing :L
-
(http://i.imgur.com/Y9sHcUh.jpg)
-
:L :L :L :L :L
-
[youtube]KG2Nl2D-i8c[/youtube]
-
(https://41.media.tumblr.com/bfbb26e083b3bf67981301b34770abd4/tumblr_mvu8h11Qjv1qzo3c9o1_1280.jpg)
[youtube]PUBnqS1qcvk[/youtube]
:L :L :L
-
:L :L
[youtube]http://www.youtube.com/watch?v=aXV4OnA8rgw[/youtube]
-
OMFG why is it yellow :L :L :L :L :L :L
-
cartmen never wipes his ass after taking a public shit lol
-
Diarrhea strikes!! :L :L :L
-
really wtf xD how can you poop that far
-
He must have been eating a shitload of curry
-
(http://i1316.photobucket.com/albums/t605/zurriequnited/Mobile%20Uploads/FB_IMG_1426834401121_zpsdujgsmnu.jpg)
-
(http://i1316.photobucket.com/albums/t605/zurriequnited/Mobile%20Uploads/FB_IMG_1426834401121_zpsdujgsmnu.jpg)
:L :L :L :L :L
-
(http://img-9gag-ftw.9cache.com/photo/aP4ZP0V_700b.jpg)
-
(http://i.imgur.com/ug1E5SS.png)
-
[youtube]http://www.youtube.com/watch?v=nkG6P2FKXtE[/youtube]
Rob_Zamora , is that you starting at 0:32 ??
-
[youtube]http://www.youtube.com/watch?v=nkG6P2FKXtE[/youtube]
Rob_Zamora , is that you starting at 0:32 ??
His long last brother :L
-
[youtube]http://www.youtube.com/watch?v=nkG6P2FKXtE[/youtube]
Rob_Zamora , is that you starting at 0:32 ??
lol true
-
[youtube]http://www.youtube.com/watch?v=nkG6P2FKXtE[/youtube]
Rob_Zamora , is that you starting at 0:32 ??
His long last brother :L
If Ouzo were to see this, He will call me Rob's brother.
-
[youtube]http://www.youtube.com/watch?v=6HHKV8LPZIw[/youtube]
:L :L :L
-
people are really unbelievably stupid lol
[youtube]http://www.youtube.com/watch?v=38JFjrnWm54[/youtube]
-
lmao
[youtube]http://www.youtube.com/watch?v=A-u7p_OECjU[/youtube]
-
You gotta see this :L :L
[youtube]http://www.youtube.com/watch?v=qWZRGZInJkw[/youtube]
-
You gotta see this :L :L
[youtube]http://www.youtube.com/watch?v=qWZRGZInJkw[/youtube]
:L :L
this could be even better if the music started to play from that bass part , not beginning.
Also what else made me laugh is my bunny avatar chewing to every single rhyth
-
[youtube]JCqiT_Oqb4k[/youtube]
-
:'( :'( :'( :'( :'( :'( :'( :'(
[youtube]ZDhK4Lrh7OA[/youtube]
-
b...b-but h...how??!?!?
(http://img.myepicwall.com/2015/03/70f9f956478608a3a5e24c07664248e8.png)
-
[youtube]http://www.youtube.com/watch?v=F78hZXcmqfc[/youtube]
Best DJ Ever
-
[youtube]http://www.youtube.com/watch?v=F78hZXcmqfc[/youtube]
Best DJ Ever
:L :L :L :L :L
-
haha, that video description :L
This is probably one of the most emotional and heartfelt performances I have ever heard. Gaslamp killer enchants his (completely sober) listeners with magical harmonies and melodies coming from his simple mac laptop. It saddens me that I have not had the privilege to witnessed this major leap forward for music. Sadly, all I can do is upload this magical film to YouTube for the enjoyment of others like me.
-
^
[youtube]http://www.youtube.com/watch?v=Oe2NgaoDnBU&feature=youtu.be[/youtube]
LMAO please listen to/watch this and read the comments, some are hilarious
-
hahaha that's fucking brilliant :L
-
:L :L :L :L
-
^
[youtube]http://www.youtube.com/watch?v=Oe2NgaoDnBU&feature=youtu.be[/youtube]
LMAO please listen to/watch this and read the comments, some are hilarious
Play that video for background and look at this:
(http://oi58.tinypic.com/2wlx380.jpg)
-
:L :L
-
[youtube]qQWfHv4k-50[/youtube]
-
2 most well-known songs on YouTube in 1
[youtube]http://www.youtube.com/watch?v=SQoA_wjmE9w[/youtube]
-
who wanna milk?
(http://i.imgur.com/Z9rCTEp.jpg)
-
who wanna milk?
(http://i.imgur.com/Z9rCTEp.jpg)
:L :L :L :L :L
-
b...b-but h...how??!?!?
(http://img.myepicwall.com/2015/03/70f9f956478608a3a5e24c07664248e8.png)
(http://img.myepicwall.com/2015/04/17b1eb021c763584569d7cdb83e6bd10.png)
-
lol :D
-
(http://i.imgur.com/99svULL.png)
-
arent all brazilian gays? kkkkkkkkkk
-
(http://i.imgur.com/w6HAVEH.gif)
-
[youtube]http://www.youtube.com/watch?v=-YZr2XX9kSA[/youtube]
what
-
lol "ma baby is a boy chigo chigole!"
-
(http://3.bp.blogspot.com/-0-w0pRwZUYo/TvRjj1zjuPI/AAAAAAAAYvg/L1IsPF6EOnU/s1600/9479.jpg)
-
lol
[youtube]http://www.youtube.com/watch?v=nOO63_VAgzY[/youtube]
-
A genius!! (https://smileys.surlatoile.org/repository/Rires/haha-rire-395.gif)
-
water driving cheat
[youtube]http://www.youtube.com/watch?v=sAubG28uODM#t=130[youtube][/youtube][/youtube]
-
It's kinda NSFW so I'll put it in here.
[spoiler]https://www.youtube.com/watch?v=dQw4w9WgXcQ[/spoiler]
-
XcQ ending... seems legit.
-
should have masked it at least XD
-
[youtube]r5of-eFCBBY[/youtube]
-
It's really embarrassing, when i see my first trys of getting Race-Skillz :blank: :L :L :L
[youtube]mhARRMGxulM[/youtube]
-
my noob time :L
[youtube]qLRNt4TgcOI[/youtube]
-
lol resolution :L
-
HD :L
-
4K
-
woman chased by rabbits in Japan
[youtube]pYCrKeMZ-y0[/youtube]
-
HD :L
This is from 2010 - also HD :L :L
Best part is the finish - Autorepair exactly parallel to music :L
[youtube]TIq5_cfG0uM[/youtube]
edit:// The guy, who can tell me, where the music is from (titel ), gets $100.000 on Server :L
-
is this racist?
(http://i.imgur.com/7UGhdTf.jpg)
-
Playing on CD Player :L
-
Nice video game :L
-
odd and unusual vehicles lapping nurburgring - including DHL van, 3 wheeler and a big bus
[youtube]http://www.youtube.com/watch?v=43FZqZEUKK4#t=239[/youtube]
-
Probably all trying to recreate this :L:
[youtube]5KiC03_wVjc[/youtube]
-
Mi 26 vs JetRanger
(http://img.joemonster.org/i/2015/04/kolekcja_lix05.jpg)
-
of course it shall endure a bunch of fat cows :L
-
https://www.youtube.com/watch?v=eODDe5rZI-U
-
russian satellite uncontrolled :L
https://www.youtube.com/watch?v=7r9zq6pMP00
-
Ahahahahahaha :L :L :L
[youtube]http://www.youtube.com/watch?v=jvijM4Vr7oA[/youtube]
-
:L :L :L :L
[youtube]Uainf3UV1-Q[/youtube]
-
I'd like to see "a world without male drivers"
-
I'd like to see "a world without male drivers"
(http://i.imgur.com/rq2bxon.jpg)
-
I'd like to see "a world without male drivers"
(http://i.imgur.com/rq2bxon.jpg)
:L :L
-
I'd like to see "a world without male drivers"
(http://i.imgur.com/rq2bxon.jpg)
:L :L
100% truth.
-
[youtube]http://www.youtube.com/watch?v=J7B3C5AHRvs[/youtube]
-
lol
-
hahaha
[youtube]http://www.youtube.com/watch?v=_AkgJZGspCM[/youtube]
-
(http://img-9gag-fun.9cache.com/photo/aMrDqnX_700b.jpg)
-
Close enough :L
(http://i1316.photobucket.com/albums/t605/zurriequnited/Mobile%20Uploads/FB_IMG_1430732560564_zpsehuiktjt.jpg)
-
[youtube]Aq33Evr92Jc[/youtube]
-
nice!
-
I DARE YOU TO TRY THIS! :L :L :L
https://www.facebook.com/280041298831747/videos/398943206941555/
(hope you can see it)
-
hey MadMax, look that
(http://www.desicomments.com/wp-content/uploads/Big-Bike.jpg)
-
[youtube]http://www.youtube.com/watch?v=0-JCmprYh6E[/youtube]
-
(http://33.media.tumblr.com/6204e2a3e75edbb21b6cbecf33f1e408/tumblr_nnu9xx6COY1r41unfo1_400.gif)
-
HOLY SHIT
-
(http://33.media.tumblr.com/6204e2a3e75edbb21b6cbecf33f1e408/tumblr_nnu9xx6COY1r41unfo1_400.gif)
legs for speed underground 2
-
NOPE NOPE NOPE
(http://i.imgur.com/Kw3kT2p.gif)
-
NOPE NOPE NOPE
(http://i.imgur.com/Kw3kT2p.gif)
:L :L :L :L :L
-
(http://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-xtp1/v/t1.0-9/11063647_851684608238055_7675193122861013347_n.jpg?oh=9d778202819dad9012418eabcb7398de&oe=560A486D&__gda__=1442634075_7123da843963a2f41baf3f026dc55a51)
-
lmao
-
lmao
-
>>>> https://www.youtube.com/watch?v=u9VwVeCgcRs <<<<
-
lol
-
(http://fbcdn-sphotos-g-a.akamaihd.net/hphotos-ak-xtp1/v/t1.0-9/11063647_851684608238055_7675193122861013347_n.jpg?oh=9d778202819dad9012418eabcb7398de&oe=560A486D&__gda__=1442634075_7123da843963a2f41baf3f026dc55a51)
that explains why west europe is so gender-friendly and promoting homosexual behavious (eurovision, shitloads of parades etc, intense promoting in various media) :o
-
"promoting homosexual behaviour"
dude...
-
Go on and tell me it's not like that.
They put all that in every fucking possible ocasion. You know what I once seen on some forum?
In registration, question 'Sex' and had 3 options: Male/Female/Undecided
To be politically correct, ya?
I got nothing to homosexuals, and really don't care. BUT FUCKING HATE how they try to put it and promote in every fucking aspect and area of life. Best example is on that freak-show Eurovision shit.
probably soon they gonna change Union flag to something like this
(http://www.crwflags.com/fotw/images/e/eu_gay.gif)
-
Nobody is doing a campaign here promoting it, you are exaggerating it. Who would even benefit about promoting a specific sexual preference?!
It is just a major fact that in our society everybody can basically live the life he wants to, and this fact distinguishes the western part of the EU from a lot of other countries. And yes, we like to point out that everybody here can live a free life.
I might just turn this discussion around, for example in Russia there are actual campaigns against homosexuals, so I might just ask: Why are they promoting heterosexual behaviour? Just because 90 percent of mankind likes strawberries, there should be a law forcing all citizens to daily eat strawberries?
-
lololoolol i started new world war
-
dam u pryda xDD
-
uh3u3hu3hu3hu3h3uh3uh3
-
They put all that in every fucking possible ocasion. You know what I once seen on some forum?
In registration, question 'Sex' and had 3 options: Male/Female/Undecided
To be politically correct, ya?
As far as I know, that's not there for political correctness, it is just allowing you not to declare your sex.
I know it is difficult for females, especially on gaming forums, not to be nagged by horny 10 year olds just because they are a girl.
In fact, on GTA:Online I changed my main character from female to male when upgrading to PC because of all the idiots who would harass me, whether sexually harassing via messaging or just chasing me down saying "omg kill the gurl"
-
[youtube]http://www.youtube.com/watch?v=WHkNKE9XMxM[/youtube]
-
(https://thechive.files.wordpress.com/2014/01/price-tag-4.jpg?w=500&h=300)
(https://thechive.files.wordpress.com/2014/01/price-tag-5.jpg?w=500&h=375)
(https://thechive.files.wordpress.com/2014/01/price-tag-6.jpg?w=500&h=637)
(https://thechive.files.wordpress.com/2014/01/price-tag-19.jpg?w=500&h=311)
(https://thechive.files.wordpress.com/2014/01/price-tag-10.jpg?w=500&h=500)
(https://thechive.files.wordpress.com/2014/01/price-tag-14.jpg?w=500&h=439)
(https://thechive.files.wordpress.com/2014/01/price-tag-17.jpg?w=500&h=548)
(https://thechive.files.wordpress.com/2014/01/price-tag-18.jpg?w=500&h=538)
(https://thechive.files.wordpress.com/2014/01/price-tag-20.jpg?w=500&h=551)
-
moo maradise
-
lol wtf
[youtube]YnaZtMaiWW0[/youtube]
-
https://www.youtube.com/watch?v=dE-nfzcUiPk
-
https://www.facebook.com/miqueline.ma/videos/vb.787359861337805/893816380692152/?type=2&theater
-
lol
-
(http://img-9gag-fun.9cache.com/photo/aQ4LN9w_700b.jpg)
-
[youtube]http://www.youtube.com/watch?v=WikDVpFLnsw[/youtube]
HAHAHAHAHAHA :L :L :L
-
LMAO :L :L :L :L :L
-
[youtube]4eZ0dn1wuXY[/youtube]
-
Looool :L :L :L
-
(http://scontent-fra3-1.xx.fbcdn.net/hphotos-xat1/v/t1.0-9/11390298_472764686214440_807352789568333475_n.jpg?oh=7fd302305ea81756c7b008fe850e2efc&oe=55F5F84B)
-
She was born in '83 .
Like me... :blank:
-
perfectionists hell (look at asymetric front landing gear)
(http://www.airteamimages.com/pics/49/49648_800.jpg)
(http://2.bp.blogspot.com/-y4g1q8k1WQ0/UJ4u-4Pv4OI/AAAAAAAAKsI/UoKuaeqqijc/s640/1.JPG)
-
maybe they did it because the place where it lands always have wind in the same direction.
-
(http://p.fod4.com/p/media/66bac9683f/OD7ULytMQfufRnNPV8jQ_Soccer%20Head%20Fail.gif)
-
(http://p.fod4.com/p/media/66bac9683f/OD7ULytMQfufRnNPV8jQ_Soccer%20Head%20Fail.gif)
Phil Jones <3 he saved our day :3
-
MadMex
(http://i.imgur.com/3Seh4cc.png)
-
hhahha he speaks funny
-
(http://i1316.photobucket.com/albums/t605/zurriequnited/FB_IMG_1433265876764_zpsomxhn1qn.jpg)
-
(https://scontent-mxp1-1.xx.fbcdn.net/hphotos-xta1/v/t1.0-9/11393098_1416539865337360_6499824738692203545_n.jpg?oh=a30e70351d594879e25e26bc8986896d&oe=55EDFF67)
:police:
-
[youtube]yxHa7nhaJOg[/youtube]
-
(https://pbs.twimg.com/media/CGpLAlaU8AEomQM.jpg:large)
-
Maldonado fans, eat your heart out!
[youtube]http://www.youtube.com/watch?v=V9GtxYrMQcI[/youtube]
-
jesus christ, I knew he really sucked but in my head I forgot exactly how much he crashed, can't believe this guy is still in F1
actually i do $$$$$$$
-
jesus christ, I knew he really sucked but in my head I forgot exactly how much he crashed, can't believe this guy is still in F1
actually i do $$$$$$$
For those people who have eye problems (A)
-
:L :L
-
half a gran
(http://40.media.tumblr.com/50d1a9a32df236ccb7e2fd88af94d11b/tumblr_npfkdgHTsn1tkdq4co1_500.jpg)
-
[youtube]http://www.youtube.com/watch?v=S8IpG5Drelc[/youtube]
-
hello! who's there?
(http://img.myepicwall.com/2015/06/398ad44953795e767da4ca4286c445b0.gif)
(http://i1.kwejk.pl/k/obrazki/2015/06/451289dff63dd9af74e4a04c300ddc58.PNG)
-
haha epic gif
-
[youtube]http://www.youtube.com/watch?v=X-VeY8dwT2k[/youtube]
-
[youtube]http://www.youtube.com/watch?v=BiA-DxpGWkI[/youtube]
brazil goes crazy listening to serbian music :D
-
[youtube]http://www.youtube.com/watch?v=BiA-DxpGWkI[/youtube]
brazil goes crazy listening to serbian music :D
thats why most of artists loves brazilian crowd! we like everything, we love everyone =D
btw this song is fun as fuck
-
(http://40.media.tumblr.com/c88d37ce83587bc4b785cf100a85e696/tumblr_npjmmnYoSp1rtiumwo1_1280.jpg)
-
(http://scontent-fra3-1.xx.fbcdn.net/hphotos-xat1/v/t1.0-9/s480x480/11402752_1631216520424147_5712225522577636517_n.png?oh=14e333cdb39077632ffda49951c4411b&oe=55EDE6A1)
(http://img.pr0gramm.com/2015/06/09/360b61b3731989ea.jpg)
-
[youtube]XpgPvXhP0Zg[/youtube]
-
(http://img.pr0gramm.com/2015/06/09/360b61b3731989ea.jpg)
This is probably one of the most disgusting things I have ever read in Internet.
-
(http://img.pr0gramm.com/2015/06/09/360b61b3731989ea.jpg)
This is probably one of the most disgusting things I have ever read in Internet.
I don't know why I am laughing so hard :L
-
(http://img.pr0gramm.com/2015/06/09/360b61b3731989ea.jpg)
This is probably one of the most disgusting things I have ever read in Internet.
I don't know why I am laughing so hard :L
LMAOOOOOOO hahahahahaha. ofc the ants are happy of eat the its sugar
-
This is probably one of the most disgusting things I have ever read in Internet.
then you will like story about cumbox : http://www.reddit.com/r/AskReddit/comments/t0ynr/throwaway_time_whats_your_secret_that_could/c4ilkt2
(read lynfect's posts)
-
http://www.reddit.com/r/AskReddit/comments/t0ynr/throwaway_time_whats_your_secret_that_could/c4ilkt2
EWWWWWWWWWWWWWWWWWWWWWWWWWWWWW, THAT must be the most disgusting thing ever lol
-
(http://i1316.photobucket.com/albums/t605/zurriequnited/2uccuAqwQzKhKDlOGXRH_Exploding%20Tire_zpsamvnfq9o.gif)
(http://i1316.photobucket.com/albums/t605/zurriequnited/Cosby%20Cat_zpswepfppfl.gif)
(http://i1316.photobucket.com/albums/t605/zurriequnited/Bite%20the%20Balloon_zpsoeu8xaw8.gif)
-
nice school..
[youtube]http://www.youtube.com/watch?v=1Dy-QLpJ8v0[/youtube]
-
(http://i1.kwejk.pl/k/obrazki/2015/06/c682d33339ab109110b4240320e5efd7.jpg)
-
sry doublepost but, cookie for one who can explain this WTFness!
[youtube]http://www.youtube.com/watch?v=BY5lvog-akE[/youtube]
-
sry doublepost but, cookie for one who can explain this WTFness!
[youtube]http://www.youtube.com/watch?v=BY5lvog-akE[/youtube]
What the fuck?! :D
-
And the children were having fun... :blank: so so awkward
-
https://www.facebook.com/ValveBRA/videos/vb.284618964992746/789303424524295/?type=2&theater
HERE IS GABEN!
-
@Max's video: Jesus Christ wtf I don't even.
Seriously...wtf.
-
sry doublepost but, cookie for one who can explain this WTFness!
http://www.youtube.com/watch?v=BY5lvog-akE
lol i bet those poor children couldn't sleep for several nights
-
[youtube]http://www.youtube.com/watch?v=qZVQpAX4L8M[/youtube]
watch this more accurate ty O0 O0 O0
-
[youtube]O-_6iqTxwYc[/youtube]
-
(http://i1316.photobucket.com/albums/t605/zurriequnited/dam%20son_zpsogy1uuqw.jpg)
-
where'd you find this
-
where'd you find this
Found it from fb lol
-
/facepalm
[youtube]http://www.youtube.com/watch?v=s_x_4UElTDI[/youtube]
-
LMFAO I literally fell of ma chair
[youtube]http://www.youtube.com/watch?v=wYAOXpkZJiM[/youtube]
-
[youtube]w81g199L8YA[/youtube]
-
pls zurrieq
[youtube]gw-EXGqNlJ0[/youtube]
-
[youtube]http://www.youtube.com/watch?t=29&v=G3gTBpLHzLY[/youtube]
-
(http://scontent-fra3-1.xx.fbcdn.net/hphotos-xaf1/v/t1.0-9/1472960_10153387336907171_7562161629220735368_n.jpg?oh=c2f54988a535b1300d827598ed7d6795&oe=55F562CE)
-
My own video on YouTube :D Watch in HD
https://www.youtube.com/watch?v=_utmUYMYZqs
-
http://9gag.com/tv/p/a96No1/always-remember-to-remove-cat-before-flight?
-
My own video on YouTube :D Watch in HD
https://www.youtube.com/watch?v=_utmUYMYZqs
Error 404: Funny not found. :L
-
[youtube]http://www.youtube.com/watch?v=qbZqH56Iedo[/youtube]
poor coala
-
(http://img.myepicwall.com/2015/06/f41e06dc558f544da5411f26fd9e7ad7.jpg)
-
https://www.youtube.com/watch?v=oab1mdPy33Q
-
(http://s2.quickmeme.com/img/2b/2b1c46f14f1d4690127b495ee169ea767fd59db953af1fc7c314b712beebd2db.jpg)(https://encrypted-tbn3.gstatic.com/images?q=tbn:ANd9GcQsWtOjhwg565GMPddG4_PVxoEY0zwUyu8tKhR0xZ0DwlX0Yuegog)
(https://encrypted-tbn0.gstatic.com/images?q=tbn:ANd9GcTOIofn2DxCHS-y6Uftt9z-ad5Qn69fxd49YxzQ96EE1YdxCc7BMg)
:L :L :L :L
-
[youtube]http://www.youtube.com/watch?v=940rzFtFNbs[/youtube]
When you work at the local news, and your boss makes a corny joke. Then you remember you need a promotion. :L
-
[youtube]http://www.youtube.com/watch?v=p68JOF9G2PI[/youtube]
-
(http://s2.quickmeme.com/img/2b/2b1c46f14f1d4690127b495ee169ea767fd59db953af1fc7c314b712beebd2db.jpg)(https://encrypted-tbn3.gstatic.com/images?q=tbn:ANd9GcQsWtOjhwg565GMPddG4_PVxoEY0zwUyu8tKhR0xZ0DwlX0Yuegog)
(https://encrypted-tbn0.gstatic.com/images?q=tbn:ANd9GcTOIofn2DxCHS-y6Uftt9z-ad5Qn69fxd49YxzQ96EE1YdxCc7BMg)
:L :L :L :L
:L :L :L :L :L :L
-
GET OFF FROM THE QUEEN'S GUARD !!! :L :L :L
[youtube]dQCSWPFnjbU[/youtube]
-
isn't funny
-
k
-
[spoiler=huge cock... don't look](http://img.myepicwall.com/2015/06/4143c31aa9b784f7549d8518f3a92328.jpg)[/spoiler]
-
:L :L
-
[youtube]http://www.youtube.com/watch?v=btE8hP1iYkE[/youtube]
the crowd saved this from total disaster...
shortly after this disaster, new response fan-video came too
https://www.youtube.com/watch?v=nwN6dPNXklg&feature=player_embedded
-
https://www.youtube.com/watch?v=KsA6grFDamo
-
https://www.youtube.com/watch?v=nwN6dPNXklg&feature=player_embedded
haha!
-
(http://i1.kwejk.pl/k/obrazki/2015/07/d2e2c81c8bc8e15b44e927bbd3057b78.jpg)
-
https://www.youtube.com/watch?v=KsA6grFDamo
Curling is actually hard as fuck. Tried it once, I didnt get any of those fancy pants tho..
-
Did anyone see the new Manor car? :L
(http://i.imgur.com/syRMqYd.jpg)
-
Did anyone see the new Manor car? :L
(http://i.imgur.com/syRMqYd.jpg)
:L :L :L
-
photo shop bitch :L
-
Meanwhile in India
(https://lh6.googleusercontent.com/proxy/pQAGQpiOeVpTMmKbgoy4xfoDgSAKOj2lY3ktHISBEVr4hg-P76iB5h3x4b8yB1y3SHLkpyQpgMTf8P3GUuT4wlM=w405-h363-nc)
-
Meanwhile in India
(https://lh6.googleusercontent.com/proxy/pQAGQpiOeVpTMmKbgoy4xfoDgSAKOj2lY3ktHISBEVr4hg-P76iB5h3x4b8yB1y3SHLkpyQpgMTf8P3GUuT4wlM=w405-h363-nc)
it makes sense cuz every children has tiny tits :L
-
hahaha
[youtube]http://www.youtube.com/watch?v=B2DJclfMnHM[/youtube]
-
[youtube]http://www.youtube.com/watch?v=TYHTr2Z82Ao[/youtube]
-
(https://lh4.googleusercontent.com/proxy/usoix1f6DqKqJX0L3qw0JyjVYYUXBZYcVDNfg2nG2N_NHyYLl-9ifFKflu8va31FzEE_KrvJm8NKY2XkRP7Kf5Lv0-M48stSP10ZHQCliKe6GTLXnP0WGsWGSLBZIppy3UHJANHiAzDchR6-LlKt=w236-h321-nc)
-
[youtube]http://www.youtube.com/watch?v=TYHTr2Z82Ao[/youtube]
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
-
[youtube]http://www.youtube.com/watch?v=p0RX5Nvd62k[/youtube]
-
[youtube]9VS3C183G8g[/youtube]
:L :L
-
[youtube]http://www.youtube.com/watch?v=p0RX5Nvd62k[/youtube]
:L :L :L :L
-
(https://scontent-fra3-1.xx.fbcdn.net/hphotos-xat1/v/l/t1.0-9/11219623_474493496057946_4105905987433582793_n.jpg?oh=bd924afbab7e68227a7ffa7df5f367fe&oe=561F4AC0)
-
[youtube]http://www.youtube.com/watch?v=_swivbEsD50[/youtube]
I found some funny music from Ushland!
-
(https://lh5.googleusercontent.com/proxy/T2Uuh886GrSNLuCRwrLlvsZv49Oy-CIXUpsbm3kQjWXfbCXT8RbEzYrwj_jirBBO2w7MwgLClVUF9Rm0EfdJ81W7O1NNFIX_AkdFWEz9fjuMqUvcA1w5MTNcdIw=w468-h314-nc)
(https://lh5.googleusercontent.com/proxy/SN52JRMq1U1ZLigaxvXsPmDYHZqVyGW3cNtM-JM2M0QF8a9_DTaUwrlC8x7do05JL3ga30AC5KWaVddPbCW_HOO0F5Y6qsOVLC6swBu4HJCB7x8XI8Rl20qXAhMf8TQTpeIxFrBG3oOQLylLzVk4drx7=w313-h470-nc)
-
(https://lh5.googleusercontent.com/proxy/SN52JRMq1U1ZLigaxvXsPmDYHZqVyGW3cNtM-JM2M0QF8a9_DTaUwrlC8x7do05JL3ga30AC5KWaVddPbCW_HOO0F5Y6qsOVLC6swBu4HJCB7x8XI8Rl20qXAhMf8TQTpeIxFrBG3oOQLylLzVk4drx7=w313-h470-nc)
[AutoAdmin] Spy has been kicked (Reason: High Ping 1 year/500ms)
-
:L
-
what they are made of, reinforced concreate or what?
[youtube]http://www.youtube.com/watch?v=6prtCtxk1ho[/youtube]
-
what they are made of, reinforced concreate or what?
[youtube]http://www.youtube.com/watch?v=6prtCtxk1ho[/youtube]
this car is perfect for pursuit :L
-
for those who don't know who is that guy, it is gaybieber. :L :L :L
(http://i1316.photobucket.com/albums/t605/zurriequnited/bieber_zpscyaz1lv1.jpg)
-
for those who don't know who is that guy, it is gaybieber. :L :L :L
(http://i1316.photobucket.com/albums/t605/zurriequnited/bieber_zpscyaz1lv1.jpg)
:L :L :L :L :L
-
(http://38.media.tumblr.com/tumblr_m19f5mrD6u1qh0vhjo1_250.gif)
-
(http://38.media.tumblr.com/tumblr_m19f5mrD6u1qh0vhjo1_250.gif)
the most useful gadget :L
-
(http://www.chamsko.pl/demot/0_1_66454_Szufelka_przez_abando.jpeg)
top gear after a year in russia
(http://img.myepicwall.com/2015/07/3aaa0d6f76b06cce46cbe2c948a0481d.jpg)
'i guess you read it wrong'
(http://img.myepicwall.com/2015/07/b3b30bcc6131bc726b5811c5ae248a20.jpg)
(http://img.myepicwall.com/2015/07/47262580a14751fa04c38c117fca958f.jpg)
-
[youtube]http://www.youtube.com/watch?v=dP9Wp6QVbsk[/youtube]
-
Guys , you must watch this :L :L :L
[youtube]http://www.youtube.com/watch?v=P_MJbgO7SF0[/youtube]
-
:L
-
Guys , you must watch this :L :L :L
[youtube]http://www.youtube.com/watch?v=P_MJbgO7SF0[/youtube]
:L :L :L :D
-
https://www.youtube.com/watch?v=_5atRuFVCjA :D :D :D
-
Guys , you must watch this :L :L :L
http://www.youtube.com/watch?v=P_MJbgO7SF0
what the fuck? lol
-
Guys , you must watch this :L :L :L
[youtube]http://www.youtube.com/watch?v=P_MJbgO7SF0[/youtube]
what the actual fuck did i just see
-
Now that we all agree on the "what the fuck"-level of this, take a second and let the fact sink in, that somebody spend at least some hours to get this idea and actually make this.
-
don't tell me you only now found out about this "shrek is love" thing
[youtube]MvlslAZRjNY[/youtube]
[youtube]fb2fcinGvLc[/youtube]
-
lmao
-
another shrek video
[youtube]RigDTGij04M[/youtube]
-
real live DJ... not just mixing other's music... hes making own!
[youtube]http://www.youtube.com/watch?v=amoewMRz7LU[/youtube]
-
Russian dog honking :L
https://www.youtube.com/watch?v=-O0sv-GA7No
-
[youtube]http://www.youtube.com/watch?v=NhkUougVXOo[/youtube]
-
(http://i.imgur.com/taQPexK.jpg)
-
https://www.youtube.com/watch?v=fRjhf-ie0GI
-
:L
[youtube]XjwO9InuFJk[/youtube]
-
:L
[youtube]XjwO9InuFJk[/youtube]
:L :L :L :L
-
[youtube]VfCYZ3pks48[/youtube]
-
I've never cringed that hard by a video in my entire lifetime.
-
Hahahaha that video haha
-
[youtube]http://www.youtube.com/watch?v=JqD_1TFhJdw[/youtube]
-
[youtube]http://www.youtube.com/watch?v=JqD_1TFhJdw[/youtube]
awesome :L
-
Something strictly for movie fanatics 8)
http://i.imgur.com/QWSi22R.jpg
-
don't you have a bigger picture lol, this is too small
-
I have divided them, so here you go now, enjoy (sorry if it stretches too long)
[spoiler]
(http://i.imgur.com/R6pT3BH.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/IrgGu21.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/mXChJyI.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/Jmc4dym.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/D24Yhhz.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/NNcIm1r.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/WfzZ2q1.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/LP7IwUO.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/4owwp25.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/aKa5USO.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/gDS2oN0.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/nTWJqVV.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/gm0ZIos.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/rtLlC4y.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/M3TArHt.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/wJ8AaOi.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/ZMlgbYu.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/xf6mBKw.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/0Anzj93.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/znglLwB.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/qA9inx7.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/xYP6Uzi.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/RfRcW2N.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/qyopD3f.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/T2BIr3Q.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/IdkoqyC.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/tWwGulP.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/RZ8DzDn.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/av0cm0l.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/AS4jzmu.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/Y0KkWcQ.jpg) (http://www.igreklik.com/slike/)
(http://i.imgur.com/Xz1KKkd.jpg) (http://www.igreklik.com/slike/)[/spoiler]
I put them inside the spoiler because they take up a lot of space
-
some crashes I had in GTA V compiled, not sure if fun or not but hell, here they are
[youtube]http://www.youtube.com/watch?v=a_Hu-t2mnHM[/youtube]
-
Allah Akbar cat:
[youtube]http://www.youtube.com/watch?v=F0ydaeblsOo[/youtube]
-
:L :L :L
-
No parking on bicycle track!
[youtube]http://www.youtube.com/watch?v=luNGjffDjCs[/youtube]
-
No parking on bicycle track!
[youtube]http://www.youtube.com/watch?v=luNGjffDjCs[/youtube]
Respect! :L
-
[youtube]x6ZdiKLai_g[/youtube]
-
[youtube]PBEFAST5DGY[/youtube]
-
(http://img.myepicwall.com/2015/08/c616656382eec14e7ccc564f49fdd676.jpg)
-
(http://i.imgur.com/rxCBgkS.jpg)
-
(http://i1316.photobucket.com/albums/t605/zurriequnited/FB_IMG_1438581131676-1_zpsdy4hkvi1.jpg)
-
found this blog lol
(http://36.media.tumblr.com/c021f204db72ec7e83ad0c47d1371267/tumblr_nstp03a8ZU1rtiumwo1_500.jpg)
(http://41.media.tumblr.com/fc790219dd760ecb30dc730588185ef8/tumblr_nsqozaJSgh1s243b3o1_1280.jpg)
-
moomanstylejoke
(http://i.imgur.com/Dj8BcfW.jpg)
-
[youtube]5Wt6X4LEVTQ[/youtube]
-
[youtube]https://www.youtube.com/watch?v=vYlutH15yD8[/youtube]
-
(http://img.myepicwall.com/2015/08/513281d5c877ab05ed2dc0b44df7ab7f.jpg)
-
[youtube]2-8I293qKrQ[/youtube]
-
(http://i1.kwejk.pl/k/obrazki/2015/08/90fab59e7fddb3f615091836fd6a15e9.png)
-
Plot twist: kitchikishangout is Paul Walker.
-
Ripperino in pepperoni Paul Walker. :'(
-
Alpha Fire >:D
-
Plot twist: kitchikishangout is Paul Walker.
LAST letter of LAST name
must be something like
P***** ******w
meanwhile AMAZING special effects made up there, so goresome and dark humor
[youtube]http://www.youtube.com/watch?v=icN6rblqYRg[/youtube]
-
saw this, so fucking awesome
-
Vladimir Putin plays GTAV irl :L
(http://i2.cdn.turner.com/cnnnext/dam/assets/150818165144-01-vladimir-putin-0818-exlarge-169.jpg)
-
rude reporter
[youtube]Fd0nDH993UY[/youtube]
-
probably NSFW lol
[youtube]http://www.youtube.com/watch?v=ACwNEaiLKHU[/youtube]
-
[youtube]https://www.youtube.com/watch?v=OznZbJ-pofY[/youtube]
-
(http://img.myepicwall.com/2015/08/007dbd5c8f19a30a4db43c1d035e9196.jpg)
(http://img.myepicwall.com/2015/08/1a52569e79e4484b47883025b8ed2688.png)
(http://img.myepicwall.com/2015/08/0fcfc1cdc312c3b6c5a82969a6bc3944.jpg)
(http://img.myepicwall.com/2015/08/47a23a6f59147ac6bf11ff55eeaf59e2.jpg)
(http://img.myepicwall.com/2015/08/4e71c98860f3e2825800df62dd81ed9b.png)
[spoiler=funny if you take it as contrast between pretty porcelain dolls and...?]
(http://img.myepicwall.com/2015/08/4cd9c35b6cba4e41bf26f6421538a9ed.jpg)[/spoiler]
-
(http://s2.glbimg.com/rpXNsek7ON-vvX5YFnRKjIaacws=/s.glbimg.com/jo/g1/f/original/2015/08/30/tigre.jpg)
(http://s2.glbimg.com/_4ywFIpfb9c3MhGwdmJ07meM1I4=/s.glbimg.com/jo/g1/f/original/2015/08/30/tigre2.jpg)
-
[youtube]http://www.youtube.com/watch?t=260&v=w3c67AYl0rM[/youtube]
-
(http://s2.glbimg.com/rpXNsek7ON-vvX5YFnRKjIaacws=/s.glbimg.com/jo/g1/f/original/2015/08/30/tigre.jpg)
(http://s2.glbimg.com/_4ywFIpfb9c3MhGwdmJ07meM1I4=/s.glbimg.com/jo/g1/f/original/2015/08/30/tigre2.jpg)
welcome to czech republic
-
[youtube]2OG6beqic6Q[/youtube]
-
[youtube]https://www.youtube.com/watch?v=TJihKu_nMco[/youtube]
-
(http://i58.tinypic.com/12546mq.jpg)
-
(http://i.imgur.com/3BlBxcZ.jpg)
-
I don't think this is the right place for propaganda (no matter which direction)...
-
I don't think this is the right place for propaganda (no matter which direction)...
I agree.
-
not funny at all, he's deadly serious, but had to post it there
[youtube]https://www.youtube.com/watch?t=19&v=fHxO0UdpoxM[/youtube]
-
Funnier when you turn the subtitles on lol
-
Funnier when you turn the subtitles on lol
critical english mechanical problems like to see a go go go :L
-
[youtube]http://www.youtube.com/watch?v=3L2-LXG_5Iw[/youtube]
-
[youtube]http://www.youtube.com/watch?v=3L2-LXG_5Iw[/youtube]
it's a bit dangerous :L
-
[youtube]UPXUG8q4jKU[/youtube]
-
See? I knew Teenage Mutant Ninja Turtle were real! Look how Splinter is trying to bring them pizza in video above!
(http://vignette1.wikia.nocookie.net/tmnt/images/2/24/Pizza-eating.jpg/revision/latest?cb=20131202172933)
-
HAHAHA you have to watch this! it's hilarious :L
[youtube]http://www.youtube.com/watch?v=NuTPK1veaQA[/youtube]
-
(http://farm3.static.flickr.com/2532/3700776571_70f1bfc0e9_o.jpg)
-
[youtube]http://www.youtube.com/watch?v=lfEdGPFsO6w[/youtube]
(http://i.imgur.com/zQK0rh7.gif)
(http://i.imgur.com/AZsHcRk.gif)
(http://i.imgur.com/ounbaDb.gif)
-
Is it NSFW ?
I'm dead
[spoiler][youtube]http://www.youtube.com/watch?v=ZCZlEYskyvY[/youtube][/spoiler]
-
[youtube]KNsjvZk8nT0[/youtube]
-
wtf :L
[youtube]h4dyChWMUpI[/youtube]
-
No Ghost Mode lol
[youtube]https://www.youtube.com/watch?v=wZKqhvch3mU[/youtube]
-
(http://www.xhp.com.br/wordpress/wp-content/uploads/2010/02/moto_empinando_com_a_gordona.jpg)
-
Dilma trying speak english lol kkkkk
[youtube]https://www.youtube.com/watch?v=P-xasLCRaeU[/youtube]
-
Kevin Hart's height: 1.63m and me 1.61m :L :blank:
(http://i1316.photobucket.com/albums/t605/zurriequnited/FB_IMG_1444636510539_zpsxlzuawf2.jpg)
-
(http://img.myepicwall.com/2015/10/cb2b9af21e77cb78f66fe8ea3caa7b30.png)
(http://img.myepicwall.com/2015/10/185cd615ecba97b5aef0f9377c66534b.jpeg)
(http://komixxy.pl/uimages/201510/1444678436_by_dekara_500.jpg)
-
The way Agus kicks asses.
[youtube]https://www.youtube.com/watch?v=lpLvrxTa6aQ[/youtube]
-
The way Agus kicks asses.
[youtube]https://www.youtube.com/watch?v=lpLvrxTa6aQ[/youtube]
:L :L :L :L
-
Fake and Gays like ouzo O0
-
The way Agus kicks asses.
[youtube]https://www.youtube.com/watch?v=lpLvrxTa6aQ[/youtube]
(spin)
-
wtf? someone translate this shit to me
-
(http://i.imgur.com/pjzKj95.jpg)
^Hacker trying to break server. :L
-
[youtube]http://www.youtube.com/watch?v=tufnWwV2J5I[/youtube]
-
[youtube]http://www.youtube.com/watch?v=mtSUn_clNDU[/youtube]
the laugh :L :L :L :L :L :L :L
-
lisAAAAAaaa :L
[youtube]https://www.youtube.com/watch?v=IRzMuo98JrI[/youtube]
-
lisAAAAAaaa :L
[youtube]https://www.youtube.com/watch?v=IRzMuo98JrI[/youtube]
rent me :L :L :L :L :L
-
(http://cdn01.dailycaller.com/wp-content/uploads/2013/06/Robert-Downey-Jr.-and-kid.jpg)
-
(https://projetocts2013bddghj.files.wordpress.com/2013/03/net-caiu.jpg)
The internet shut down
I'm gonna see outside for a while
-
[youtube]http://www.youtube.com/watch?v=ON-3I315hcE[/youtube]
-
(http://img.myepicwall.com/2015/10/a7bb471d41b079de85f251e159a41a7a.jpg)
(http://img.myepicwall.com/2015/10/750d76e700c80cfedccffdac8ffc9d65.jpg)
(http://img.myepicwall.com/2015/10/21279191503235f06059c2893aee40ef.gif)
brilliant idea for halloween
(http://img.myepicwall.com/2015/10/86837c04b241fb0b05c5876e43a21f85.jpg)
-
(http://img.myepicwall.com/2015/10/a7bb471d41b079de85f251e159a41a7a.jpg)
haha max, that is brilliant :L
anyway..
(https://38.media.tumblr.com/0baa0085260ca5f717028567bbe65140/tumblr_n3t1f8UQwS1spaqpio1_250.gif)
-
I feel very offended Max
And whats the name of that girl Phobos, she looks very cute.. :-*
-
no idea lol
-
[youtube]Nh8pSPmKupc[/youtube]
-
[youtube]Nh8pSPmKupc[/youtube]
:L :L :L :L :L :L
-
.
-
ignore red text, it's just polish translation of that sign
(http://img.myepicwall.com/2015/11/8d8f807ec0ee330b9904e71dc35aa4ae.jpg)
keeping with orginal label on it:
Ho-Ho-Holocaust?
(http://img.myepicwall.com/2015/11/88a826cc3b572a9724e6645d8e913700.jpg)
looks legit, totally
(http://img.myepicwall.com/2015/11/7e2c34de115866639888282ccd0594d9.jpg)
(http://i1.kwejk.pl/k/obrazki/2015/10/2f855609c9e9098d882444354f0138b2.png)
-
I love pepes.
-
This reminded me of AX :L
[youtube]http://www.youtube.com/watch?v=A4DDqFyYDbY[/youtube]
-
This reminded me of AX :L
[youtube]http://www.youtube.com/watch?v=A4DDqFyYDbY[/youtube]
pro driver :L :L :L :L
-
[spoiler](http://i.imgur.com/r69fqWu.png)
(http://i.imgur.com/YDHoUr2.png)[/spoiler]
-
[spoiler](http://i.imgur.com/r69fqWu.png)
(http://i.imgur.com/YDHoUr2.png)[/spoiler]
Lol some people still don't get that simple joke :L, and those screenshots should be in comedy chatbox (another topic) :)
-
[youtube]http://www.youtube.com/watch?v=MYuZnr6lKAc[/youtube]
-
[youtube]http://www.youtube.com/watch?v=S8IpG5Drelc[/youtube]
-
http://www.youtube.com/watch?v=eEdaLHC0yA4&t=1m20s (http://www.youtube.com/watch?v=eEdaLHC0yA4&t=1m17s)
-
[youtube]https://www.youtube.com/watch?v=sLCvxIks5I8[/youtube]
(For those who don't know, R*/T2 sent investigators to the houses of GTA:MP and FiveM to shut third party multiplayer progress down (http://arstechnica.com/gaming/2015/11/gta-5-modders-claim-take-two-sent-private-investigators-to-their-home/))
-
Yeah, fuck the argentina hu3hu3hu3hu3u3
(http://i.imgur.com/EKVo3k0.jpg)
-
[youtube]https://www.youtube.com/watch?v=bK1ZJJMonGo[/youtube]
-
polish got other words than 'kurwa'
(http://i1.kwejk.pl/k/obrazki/2015/11/3a7675c301446123afb71a19e6774d9a.png)
-
I think you posted that a few years ago already. But good reminder :).
-
[youtube]https://www.youtube.com/watch?v=UiR9wqxYvDo[/youtube]
-
[youtube]https://www.youtube.com/watch?v=UiR9wqxYvDo[/youtube]
:L :L :L :L :L :L
-
[youtube]lzmWzXLPa6I[/youtube]
-
[youtube]lzmWzXLPa6I[/youtube]
haha, this is even more hilarious :L
[youtube]N_Bg-I2aBOc[/youtube]
-
(http://img.myepicwall.com/2015/11/b6868e3c9a1f776964b497a585da8c49.jpg)
-
(http://img.myepicwall.com/2015/11/b6868e3c9a1f776964b497a585da8c49.jpg)
arriba
-
Usando el force, caminante del cielo.
-
[youtube]http://www.youtube.com/watch?v=u_zi6D0V9TI[/youtube]
-
[youtube]lzmWzXLPa6I[/youtube]
haha, this is even more hilarious :L
[youtube]N_Bg-I2aBOc[/youtube]
LMAO I m screaming
-
[youtube]http://www.youtube.com/watch?v=d7FIpqPvL7E[/youtube]
lol
-
WTF LOL
[youtube]http://www.youtube.com/watch?v=q2-Lo-mUte0[/youtube]
-
Marv getting spawnkilled.
[youtube]http://www.youtube.com/watch?v=8WKgNyvsNDM[/youtube]
-
[youtube]http://www.youtube.com/watch?v=Il3oXH8IP3w[/youtube]
BTTF was real, knew it, just look
1st burst of fire and then he's gone... wondering where... or maybe WHEN is he now?
-
[youtube]http://www.youtube.com/watch?v=Il3oXH8IP3w[/youtube]
BTTF was real, knew it, just look
1st burst of fire and then he's gone... wondering where... or maybe WHEN is he now?
his car really need some repairs :L
-
not a funny video but damn, this is awesome as f*ck! :D
never thought a saxophone could be that cool
[youtube]http://www.youtube.com/watch?v=u0AN9QFp8ss[/youtube]
-
not a funny video but damn, this is awesome as f*ck! :D
never thought a saxophone could be that cool
[youtube]http://www.youtube.com/watch?v=u0AN9QFp8ss[/youtube]
:L :L :L :L
-
[youtube]Y_KKZYYOjsE[/youtube] lmao
-
yet another japanese wtf video
though this is more like WTF??
[youtube]http://www.youtube.com/watch?v=UatXhBALWgQ[/youtube]
-
[youtube]https://www.youtube.com/watch?v=ufO0-qQGNaw[/youtube]
-
What did I just watch :L
[youtube]IjynbUNlvWU[/youtube]
-
:L :L :L :L :L :L :L :L :L :L :L :L :L
(http://img-9gag-fun.9cache.com/photo/a577jAq_700b.jpg)
-
I understand nothing of russian, but i liked... so cute that scene *-*
[youtube]https://www.youtube.com/watch?v=PMuKiCJKAQc[/youtube]
-
I understand nothing of russian, but i liked... so cute that scene *-*
[youtube]https://www.youtube.com/watch?v=PMuKiCJKAQc[/youtube]
nice
-
lol this guy has to have so much patience
[youtube]http://www.youtube.com/watch?v=V6KvekkS7so[/youtube]
-
Hallo all! Whats'up? It 's been a long time since the last login because I worked a lot. I was looking for an economical way to make my back-cover phone more grippy... and i found this :L
[youtube]https://www.youtube.com/watch?v=3IB7wTKvGmw[/youtube]
-
watch only if you like grim humour... otherwise give up, coz may not like it
[youtube]http://www.youtube.com/watch?v=oaGNKJdrJY4[/youtube]
-
(http://upload.emefka.sk/posts/77/42/47742.png?1)
-
haha this is awesome :L
[youtube]http://www.youtube.com/watch?v=mxr83Vkrh00[/youtube]
[youtube]http://www.youtube.com/watch?v=iWfKj187-4A[/youtube]
-
(http://img.myepicwall.com/2016/01/eb780b1352cbcf0cd4bd332d09e3ad96.jpg)
(http://img.myepicwall.com/2016/01/47cfd645fddf711f015810018686397f.jpg)
(http://img.myepicwall.com/2016/01/a7f0d0088e1ab92932527918769d49c4.png)
(http://img.myepicwall.com/2016/01/b9624b089ee9ae0f26afaa3f81b27fec.jpg)
(http://img.myepicwall.com/2016/01/ca8b75b79b0ac156c9df3d078ea7e328.jpg)
(http://img.myepicwall.com/2016/01/4e84170eb6ac809f4e4dc5bf17d28a5b.gif)
(http://img.myepicwall.com/2016/01/00ac5a28763d33a71b4e4d27e6a19c37.jpg)
(http://img.myepicwall.com/2016/01/1b714fd6dc9e4d94b142bccab07b72d8.jpg)
(http://i1.kwejk.pl/k/obrazki/2016/01/674d72671cf7052fb70a9ff76408f881.jpg)
-
:L
[youtube]mrJennwvjDc[/youtube]
-
[spoiler=I WANT TO BELIVE](http://img.myepicwall.com/2015/12/343b579b0bef731d643ab4bf7f31dd31.jpg)
http://www.myinstants.com/instant/x-files/
[/spoiler]
-
[spoiler=I WANT TO BELIVE](http://img.myepicwall.com/2015/12/343b579b0bef731d643ab4bf7f31dd31.jpg)
http://www.myinstants.com/instant/x-files/
[/spoiler]
You just got an idea for a new episode of
[youtube]http://www.youtube.com/watch?v=rbBX6aEzEz8[/youtube]
-
Yeah beach
(http://i.imgur.com/rX4jTNL.png)
-
lol
[youtube]http://www.youtube.com/watch?v=5h_TPtgIdVg[/youtube]
-
(http://www.riccardoperini.com/wp-content/uploads/lol.jpg)
-
(http://i.imgur.com/i6DYBd6.gif)
[youtube]http://www.youtube.com/watch?v=JZ3gs1K3rVQ[/youtube]
[youtube]https://www.youtube.com/watch?v=xXceIEb1S00[/youtube]
-
Just damn :D
[youtube]http://www.youtube.com/watch?v=7xdxIBNj2sw[/youtube]
-
life changing
[youtube]https://www.youtube.com/watch?v=rwsAIPt3BLM[/youtube]
-
[youtube]http://www.youtube.com/watch?v=KqRLDr03XQ4[/youtube]
-
[youtube]http://www.youtube.com/watch?v=5lL5xRKquPQ[/youtube]
-
(http://i.imgur.com/KNYxfkn.jpg)
-
What i understand... "fuck fuck fuck nigguh, fuck it, fuck right, fuck lol"
[youtube]https://www.youtube.com/watch?v=XM8aBESf8EI[/youtube]
-
:L
-
Probably has been sitting next to him while he is playing on XBOX Live.
-
You'll Lovin' it
(http://i.imgur.com/Sjy6mjN.jpg)
-
Ken Block real driving, when can't take 10 tries for his videos.
[youtube]http://www.youtube.com/watch?v=E-PGCmizGgw[/youtube]
-
Yeh, he may be good stunt driver, but not the best when it comes to rallying. And in all those gymkhana videos, he doesn't do all those slides in whole one attempt. Multiple tries are made and montaged together after. Just like all our gta sa drift videos :L. And imo he actually doesn't technically drift, its more like power sliding. So i disagree with those who say Ken Block is better "drifter" than Drift King Keiichi Tsuchiya, who has been driving since the 70s.
but still Ken Block drives better than all of us. He is just bit overrated.
-
My system sound car '-'
[youtube]https://www.youtube.com/watch?v=L4Y-8tVgRts[/youtube]
-
Ears bleeding but interior remain dustproof even in Nevada :L
-
Lol Jaclino, i was in "highway", far from home
-
[youtube]http://www.youtube.com/watch?v=16k-yhcRNk8[/youtube]
-
[youtube]http://www.youtube.com/watch?v=16k-yhcRNk8[/youtube]
1:53 ( ͡° ͜ʖ ͡°)( ͡° ͜ʖ ͡°)
[youtube]https://www.youtube.com/watch?v=yfUflij74P4[/youtube]
-
Chandon_SK
[youtube]O3bDd2qD8oE[/youtube]
-
LOL great video! :L
-
:D :L
[youtube]aXV4OnA8rgw[/youtube]
-
My friend
[youtube]https://www.youtube.com/watch?v=QIa8UZ1S7yM[/youtube]
-
[youtube]https://www.youtube.com/watch?v=DXu92d307KU[/youtube]
[youtube]https://www.youtube.com/watch?v=bBcsQcOyuIo[/youtube]
-
[youtube]wOur8qXvpnk[/youtube]
-
pornhub today :L
(http://i.imgur.com/WJoWrYG.jpg)
-
HAHAHAHHAA LOL Cthulhu POPCORN is best :D
-
wtf
-
algum BR?
[youtube]https://www.youtube.com/watch?v=2GITXHbT8W8[/youtube]
-
this farmer doesn't give a fuck haha
[youtube]http://www.youtube.com/watch?v=5bGb9hHW8jE[/youtube]
-
those refugees be like
[youtube]https://www.youtube.com/watch?v=_X6VoFBCE9k[/youtube]
-
(http://45.media.tumblr.com/75e857950202719e56ab6ae2b3f2f4ad/tumblr_o589l9jWN81s2md07o1_400.gif)
-
:L
[youtube]ieJUP9O9RG8[/youtube]
-
(http://img-9gag-fun.9cache.com/photo/anNxEyq_700b_v2.jpg)
(http://img-9gag-fun.9cache.com/photo/avPxbGW_700b.jpg)
-
(http://4.bp.blogspot.com/-Vh7jYMjAvIg/Vbh9yddBhaI/AAAAAAAAcRA/sVG8-hJ-NlQ/s640/1+(13).gif)
-
When we go to hell, then like this :L :L :L
[youtube]Q5lUFolpmpE[/youtube]
-
http://imgur.com/gallery/hjfv6
-
(http://cdn.acidcow.com/gifs/20160413/gifs_25.gif)
-
[youtube]https://www.youtube.com/watch?v=X06DqYSHsRI[/youtube]
:L :L :L :L
-
[youtube]https://www.youtube.com/watch?v=TrBPDEtKZHo[/youtube]
-
.
Welcome to Norway 8)
Great vodka too, Vikingfjord.
-
10/10 would never visit Australia
(https://s-media-cache-ak0.pinimg.com/736x/23/16/1a/23161a5815dbc4817bb139e30266186a.jpg)
-
what if i tell You this spider is most common one ever?
I m sure there are like 10 in Your or my home... it is called:
Tegenaria domestica (domestic house spider) and appear literally everywhere, not just Australia
(http://sonnen-bogen.de/images/Spinne_12.10.03.jpg)
-
I can't fucking take a shit right now...That exact same specie is fucking waiting for me to get on the toilet :-\
-
mostly like ye, i got kind of arachnophobia too, but trying to fight it. Best way is to get to know a lot about them and try face them, live with it. Of course some are dangerous. Don't ignore them
back to funny topic, lets turn it into joke:
(http://www.quotestags.com/qitem.php?id=280693)
(http://img.memecdn.com/free-heartattack-for-arachnophobia-people_o_5916297.jpg)
(http://memesvault.com/wp-content/uploads/Funny-Spider-Meme-01.jpg)
(http://www.dailyhaha.com/_pics/spiders.jpg)
(http://www.humoar.com/wp-content/uploads/2014/11/cocaine-spider.gif)
-
Fucking spiders... kill it before it lays eggs!
-
HAHAHA
[youtube]http://www.youtube.com/watch?v=nWZMPxFdc1A[/youtube]
-
[youtube]https://www.youtube.com/watch?v=jgxS3DqlWD4[/youtube]
-
[youtube]http://www.youtube.com/watch?v=iy22mBhUQCw[/youtube]
-
HAHAHA
[youtube]http://www.youtube.com/watch?v=nWZMPxFdc1A[/youtube]
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
-
:E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E :E
-
lol this is hilarious
[youtube]http://www.youtube.com/watch?v=aM3ElTvF52I[/youtube]
-
.
Damn, thats intense!
[youtube]https://www.youtube.com/watch?v=CgQsPvhzW2E[/youtube]
:L :L :L Its norwegian but still funny :L
-
Today is Flag Day in Poland. I was going to do human flag on road sing but... :L :police: :police: :police:
(http://i.imgur.com/psB4bDK.jpg?1)
(http://i.imgur.com/d4gao3s.jpg?1)
AND BONUS :L
(http://i.imgur.com/WwOSLqW.jpg?1)
-
.
>:D
-
[youtube]G0QQjTPs1QU[/youtube]
-
[youtube]http://www.youtube.com/watch?v=8-UAgzRpoDY[/youtube]
ROFL ! :L
-
WTF is this?!! lol
[youtube]http://www.youtube.com/watch?v=v7kkDOQPqps[/youtube]
-
(https://media.giphy.com/media/3o7qE6TYKWNjTQp4ti/giphy-downsized-large.gif)
-
hahahahahaha fail
-
damn :'(
-
(https://images-2.discordapp.net/eyJ1cmwiOiJodHRwOi8vaS5pbWd1ci5jb20vYkltTWdHMi5wbmcifQ.GPs3oKSDiZo1ldLR6Zxjx8cGDsg.png)
http://gtavmp.org/ <----- ? ? ?
-
I don't think V-MP being down has anything to do with Take-Two. The way they have been handling things lately is quite disorganised.
-
[youtube]http://www.youtube.com/watch?v=6zThaaIfufQ[/youtube]
-
[youtube]http://www.youtube.com/watch?v=ohXEOpgAh-Y[/youtube]
-
Its for you, Max :D
(http://img-9gag-fun.9cache.com/photo/aA18Vmg_700b_v1.jpg)
-
[youtube]https://www.youtube.com/watch?v=H0IlJc_vkZ0[/youtube]
Noot Noot :L :L :L
-
lmao that show :L
-
AHAHAHAHAHAHA :L :L :L
[youtube]http://www.youtube.com/watch?v=Z5_YfyY3zDw[/youtube]
-
http://www.independencedaymystreet.com
-
[youtube]http://www.youtube.com/watch?v=SGnekMeoX0Y[/youtube]
[youtube]http://www.youtube.com/watch?v=2w8wqU9TrkA[/youtube]
-
[youtube]https://www.youtube.com/watch?v=iKSFMRrfwYQ[/youtube]
-
[youtube]https://www.youtube.com/watch?v=JOtcQxZnF4o[/youtube]
-
a little older but damn, it's hilarious :L
[youtube]http://www.youtube.com/watch?v=LH4nyIRE1aw[/youtube]
-
lol
[youtube]http://www.youtube.com/watch?v=ehIWGdt7GOo[/youtube]
-
[youtube]2YpksZwyZo0[/youtube]
-
Heh
[youtube]https://www.youtube.com/watch?v=Zwn09x3HA-M[/youtube]
-
.
:L lol :L
-
nvidiot, buy yourself a microscope
(http://i239.photobucket.com/albums/ff19/ChrisInVT/nvidiot2.png)
-
[youtube]http://www.youtube.com/watch?v=rrnyffcg9jc[/youtube]
-
jokez :D
[youtube]https://www.youtube.com/watch?v=JGNwEvhNsjk[/youtube]
-
(https://lh3.googleusercontent.com/QfKftvgOcLPV2HLsKNThVuHs4xL_xBiohGuFp2YAfhgyqnjMX_F1NXydBuKz1K6ei94L6mgIBlplDuuYua772vly-CYR5fs2q21BYqiYB533U1brEEAmfN3xOIiWyfdZ0TqRVM6Jcpu2VqNRY2FFPewGqcxa0NBW51New9p9rAFtXK4mazCktprhcelzWvdo-WIt7vN4HYch2GMAxqNwWBnh-A7Qz0zuweXYClqkSlejq2i-GhmBz1gY20cStm8emiIgthW_djl8DfycillTuXHidLsOB0uHy1l1loviOC5d17jwBrLuLaUJYRPnmOFWxpLG7SBKo2a-IESrGv5A19S-R5dbXDGcxJfG12DZeTFI_jAL-DQAiw-Fsf3-AKiY6cAW8IakEAfshb_3U3Os7JasnIz_nncxx9gU6xfYVh4Vz1f6_PlURGU06BaBsjK3CUKc04WEzT4uo9Ud_2fzbDKuOS8piJAZn83m8DMr4fY1DrlIuHHjLHyHG1mF2lX6PL01rRLMSInnfxpAnArr-8DzEaprlkWTN4rcTRq8tnxshF5B1_n_BLnNSLuJ0Uzez4agOGCptWLR9YYIoqzwAebbWRUnebUV=w548-h504-no)
-
Impressive:
[youtube]https://www.youtube.com/watch?v=5EgUpnI7kzA[/youtube]
Electricy... the future.
-
Funny parodies of national anthems xD These are my favs, check out his channel 4 other parodies of anthems.
[youtube]https://www.youtube.com/watch?v=Q0uvAnHOa18[/youtube]
[youtube]https://www.youtube.com/watch?v=x5mQF8AJKsQ[/youtube]
[youtube]https://www.youtube.com/watch?v=00Wjr_rrA8I[/youtube]
[youtube]https://www.youtube.com/watch?v=yNXt2C8qgz8[/youtube]
-
I feel ashamed of how true it is...
[youtube]https://www.youtube.com/watch?v=XPl4Ak60mo8[/youtube]
-
(http://www.zerohedge.com/sites/default/files/images/user3303/imageroot/20151017_eu2050.jpg)
-
Danish language :p
[spoiler][youtube]https://www.youtube.com/watch?v=s-mOy8VUEBk[/youtube][/spoiler]
-
:L
[youtube]http://www.youtube.com/watch?v=L35l_XcY-eY[/youtube]
-
[youtube]http://www.youtube.com/watch?v=yMqPDfRy8qs[/youtube]
>:D
-
(http://image1.spreadshirtmedia.com/image-server/v1/compositions/1003340578/views/1,width=235,height=235,appearanceId=2,backgroundColor=f9f9f9,version=1440417743/This-Is-A-Very-Old-Picture-Of-Me.jpg)
-
(http://image1.spreadshirtmedia.com/image-server/v1/compositions/1003340578/views/1,width=235,height=235,appearanceId=2,backgroundColor=f9f9f9,version=1440417743/This-Is-A-Very-Old-Picture-Of-Me.jpg)
The only race you won in your entire life :L. Luv <3
-
Heres the reason why everyone in the North thinks swedes are retarded, HAHAHA :D
Try to notice how well educated the danes discuss compared to the sweden feminists. The sweden feminists who wants rights for kindergarten to grow up girls and boys as non-gender persons... wtf.
Just look at how the swede got rekt at 4:30 xD
Look at the youtube comments tooo hahahah , every1 hates swedeb gagagg xD
[youtube]https://www.youtube.com/watch?v=L5ETiMA8OQw[/youtube]
-
lol. " Det var ikke min skuld" hahhaha
But seriously even though I like idea of equality I don't think there is more or less hindering one gender from the other. Pppl have to think for themselves and stop relying so much on making things as fair as possible. Sometimes you have to take the shit
-
The "Ginger do have soul" is now a woman?! :O
[youtube]https://www.youtube.com/watch?v=Lu7bldQixnA[/youtube]
-
(http://www.skyscrapercity.com/images/smilies/troll.gif)
(https://scontent-vie1-1.xx.fbcdn.net/v/t1.0-9/13882300_10157247445835483_865916803841605785_n.jpg?oh=9077aeb18aee29d6384a17ed0e06b93c&oe=5820CD5F)
-
(https://scontent-waw1-1.xx.fbcdn.net/v/t1.0-9/13726562_1065139593533626_5740570469961936067_n.jpg?oh=d1b0f9b8511a5d0ce8874906a08fc077&oe=581A0984)
lmao cute night ride with 5 cars involved in one crash :L one retard in front decided to brake instantly
-
lmao cute night ride with 5 cars involved in one crash :L one retard in front decided to brake instantly
haha nub
(https://media.giphy.com/media/3o7TKSr0DXfadCM4zS/giphy.gif)
-
(https://scontent.ftxl1-1.fna.fbcdn.net/v/t1.0-9/13938580_596750240504400_4846904442470307285_n.jpg?oh=464235d61f4918baaff95b4937e4d071&oe=5812B3FC)
-
Hu3hu3hu3hu3 BRBR
(http://i.imgur.com/gcsAocE.jpg)
-
.
lol
Whenever there is a crash on AX:
[youtube]https://www.youtube.com/watch?v=PfRVctse_KQ[/youtube]
-
Lol so true "stupid rammer fuck you" "wtf idiot you rammed me fuck you"
-
You're right. It's more like this: :L
[youtube]https://www.youtube.com/watch?v=IP1NFSrfilk[/youtube]
[youtube]https://www.youtube.com/watch?v=92bRBQv6WYI[/youtube]
-
HAHAHHAHAH XD I feel bad 4 these kids. The hosts make it cringy tbh
[youtube]https://www.youtube.com/watch?v=ZUFV1YK6gsY[/youtube]
Direct link: https://www.youtube.com/watch?v=ZUFV1YK6gsY
-
https://www.facebook.com/dupsmili/videos/1181456901912390/
sorry i can't direct link it but lmao
-
[youtube]cwH3WuMxol8[/youtube]
-
Pino!
(http://i.imgur.com/HOpiwoz.jpg?1.jpg)
-
[youtube]http://www.youtube.com/watch?v=-N_RZJUAQY4[/youtube]
-
hahaha
[youtube]https://www.youtube.com/watch?v=xlJe56tnIxs[/youtube]
-
[youtube]http://www.youtube.com/watch?v=nUqrafe46B8[/youtube]
Just your average Jihad rave party
-
haha i'm dying :L
[youtube]https://www.youtube.com/watch?v=qeFKO3Fsdzw[/youtube]
-
[youtube]http://www.youtube.com/watch?v=qyc5DUciL1c[/youtube]
-
Sweden 2016
[youtube]https://www.youtube.com/watch?v=WoQFUBgAMyo[/youtube]
-
[youtube]https://www.youtube.com/watch?v=hsaLDnl_fEs[/youtube]
-
Ivan in a bus ride with his pet.
(http://img-9gag-fun.9cache.com/photo/ae6LmBB_700b.jpg)
-
Just bringing dinner home man, its hard times in the Balkans
-
(https://scontent-vie1-1.xx.fbcdn.net/v/t1.0-9/14708257_1444626372231637_2961183812092064752_n.jpg?oh=a3252cc98442d54704b5effd14db14cc&oe=58994987)
-
lol
-
(https://media.giphy.com/media/JPKV3MTU6d5WE/giphy.gif)
-
(http://img.jbzd.pl/2016/10/7b2401fb1ac62b92fba7d5a2325a6639.jpg)
(http://img.jbzd.pl/2016/10/fa189a2cc274f5831b3f83001343b431.jpg)
(http://img.jbzd.pl/2016/10/a8ad14b07058d55286a762736ffea0ff.jpg)
(http://img-9gag-fun.9cache.com/photo/aB1pVqP_700b_v1.jpg)
webm, can't link
http://9gag.com/gag/ae6qKQp
-
Kids in Denmark are still vikings! They climb trees and do crazy stuff xD my childhood <3
[youtube]https://www.youtube.com/watch?v=Jkiij9dJfcw[/youtube]
-
(https://media.giphy.com/media/JPKV3MTU6d5WE/giphy.gif)
CS:GO in a nutshell
-
Kids in Denmark are still vikings! They climb trees and do crazy stuff xD my childhood <3
https://www.youtube.com/watch?v=Jkiij9dJfcw
apparently you still hunt trolls too :L
[youtube]https://www.youtube.com/watch?v=K6P_adEkt2E[/youtube]
-
Hahahah xD
This is the official song from a christmas series :p just as troll, we grow up as trolls
[youtube]https://www.youtube.com/watch?v=IVJCgjyLJqE[/youtube]
-
hu3 Brazil 3 x 0 Hermanas
(http://i.imgur.com/4tlpxTN.jpg)
-
[youtube]https://www.youtube.com/watch?v=L4QMQY7iY1I[/youtube]
-
Funniest video ever! xD Swedes eat some wierd disgusting stuff.
[youtube]https://www.youtube.com/watch?v=3T78p3WRfXU[/youtube]
-
[youtube]kwp7hIPQea8[/youtube]
-
Funniest video ever! xD Swedes eat some wierd disgusting stuff.
[youtube]https://www.youtube.com/watch?v=3T78p3WRfXU[/youtube]
wtf??????????????????? KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK [1000x infinity] kkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkk
-
He wanted to vormit but he couldent :((
-
[youtube]https://www.youtube.com/watch?v=d6Pn1nt6v1Y[/youtube]
-
"Swedes" are raised to be whiny beaches. Read this lol.
https://www.theguardian.com/teacher-network/2016/feb/02/swedish-schools-gender-alien-concept
-
[youtube]https://media.giphy.com/media/l2JhO1Kf3HU8APE52/giphy.gif[/youtube]
-
[youtube]https://media.giphy.com/media/l2JhO1Kf3HU8APE52/giphy.gif[/youtube]
thats nice
-
[youtube]https://media.giphy.com/media/l2JhO1Kf3HU8APE52/giphy.gif[/youtube]
thats nice
link fixed
enjoy
(https://media.giphy.com/media/l2JhO1Kf3HU8APE52/giphy.gif)
-
lol
who has the facebook-link to that video/gif to share with friendz? xP
-
:D
[youtube]http://www.youtube.com/watch?v=sN1MkVfXeao[/youtube]
-
[youtube]https://www.youtube.com/watch?v=VUYjxamJ3bs[/youtube]
-
G[old]
[youtube]P9ifVx9yZbY[/youtube]
-
HahahahahhaHHAhahahahha
[youtube]https://www.youtube.com/watch?v=C4ziICGQzgs[/youtube]
-
this is eye-opening, but a little immature/cringy video...
[youtube]https://www.youtube.com/watch?v=grD_IINiH9c[/youtube]
-
[youtube]https://www.youtube.com/watch?v=c0fCq7B8Bs4[/youtube]
-
https://www.youtube.com/watch?v=PFsTpdXLiZg (https://www.youtube.com/watch?v=PFsTpdXLiZg)
:L
-
https://www.youtube.com/watch?v=PFsTpdXLiZg (https://www.youtube.com/watch?v=PFsTpdXLiZg)
:L
Fixed
[youtube]PFsTpdXLiZg[/youtube]
-
Only in Russia
[youtube]aNEYwYqJ7Fc[/youtube]
-
Ty Odala, u made me break my keyboard
(http://i.imgur.com/HAXnlZ3.jpg)
-
I bet that Enter still works though :L
-
Yes, this peace of sheet skipped the Long5_SK, when i finished to pass that fcking long tunnel in first time !
-
#odala4demote2017 #neverskeeplongSKs #porreta4admin2017
-
http://www.howtocontrolgamingrage.com
-
[youtube]http://www.youtube.com/watch?v=SV86tHbr6ts[/youtube]
-
[youtube]http://www.youtube.com/watch?v=IcQo93KULd4[/youtube]
-
[youtube]https://www.youtube.com/watch?v=DOB6UDC-67w[/youtube]
-
[youtube]http://www.youtube.com/watch?v=IcQo93KULd4[/youtube]
:L :L
-
:p
[youtube]https://www.youtube.com/watch?v=DUSojCb193U[/youtube]
-
(http://cdn.purseblog.com/images/new_year_2007.jpg)
-
(http://i.imgur.com/z5611sY.png)
-
[youtube]https://www.youtube.com/watch?v=ozdXIdkWn_4[/youtube]
-
(http://www.lamebook.com/wp-content/uploads/2017/01/Nut-Cracker.png)
-
lmao
[youtube]https://www.youtube.com/watch?v=F-fluUQApO8[/youtube]
-
[2F2F]S playing AdrenalineX several years ago before domination
[youtube]http://www.youtube.com/watch?v=miOWJ4rKb_g[/youtube]
-
The funniest table tennis match you will see. :L :L :L
Chuang Chih-Yuan vs Jean-Michel Saive (2014)
[youtube]ZS3O0OOn0a0[/youtube]
-
impressive ping pong skills lol
-
still not funny
-
couple of weeks ago
(http://i.imgur.com/v3KkDIb.jpg)
??? :L
-
whats so funny annoying dumbass?
-
whats so funny annoying dumbass?
Which team youre playing for?
-
:L
[youtube]10SqS3AtNbc[/youtube]
-
This
[youtube]https://www.youtube.com/watch?v=ELD2AwFN9Nc[/youtube]
-
[youtube]http://www.youtube.com/watch?v=zd7c5tQCs1I
I'm in tears :L :L :L
-
Great!
[youtube]http://www.youtube.com/watch?v=reuJ8yVCgSM[/youtube]
-
bitch plz
[youtube]https://www.youtube.com/watch?v=ryppmnDbqJY[/youtube]
-
[youtube]http://www.youtube.com/watch?v=Ql3pwSO9cLY[/youtube]
-
How much correct is this?
(https://scontent-frt3-1.xx.fbcdn.net/v/t1.0-9/16730679_10212182186449288_5906953252366084658_n.jpg?oh=1647a89554da934b691b4be440c30bcb&oe=590A9A7C)
-
DANG
(https://media.giphy.com/media/l0MYRodLqWkTCVWi4/giphy.gif)
-
GET REKT
[youtube]http://www.youtube.com/watch?v=XcKkKKUviEg[/youtube]
-
You will lose your hip and your knee with this as well
[youtube]6-T0z4VlJMo[/youtube]
-
.
:o
[youtube]https://www.youtube.com/watch?v=w5mZE4_1tIM[/youtube]
-
Not really funny cuz the man could have died but didn't know where else to post it.
[youtube]http://www.youtube.com/watch?v=08OVwVH-opI[/youtube]
-
It's so-called "black comedy". Not everyone got that sense of Gallows humor, but it is somehow considered as it too.
https://en.wikipedia.org/wiki/Black_comedy
https://en.wikipedia.org/wiki/Gallows_humor
Reminds me of Final Destination 4 intro scene, that one with a girl and tyre.
[Spoiler=Spoiler for ppl who ale offened by gore scenes](https://img-s3.onedio.com/id-575157e00d8f0cc855999ac0/rev-0/w-635/f-jpg-gif-webp-webm-mp4/s-75e7bebf222be0ab1be02ad4fcc1b62b8c59380c.gif)[/spoiler]
-
Some people would get butthurt if you put it as a humor, that's why.
It reminded me of Final Destination too for some reason, now you confirmed it.
-
Nice :D
[youtube]http://www.youtube.com/watch?v=ikOTW3f3xng[/youtube]
-
czech thief stealing beer crates being eaten by the machine
[youtube]https://www.youtube.com/watch?v=Wv5PsDh8_Js[/youtube]
-
[youtube]https://www.youtube.com/watch?v=wHf2ejIZ44g[/youtube]
-
(https://i1.jbzdy.pl/contents/2017/02/9491afec16d53f89cc2e1c64ea79baff.jpg)
-
when the only real football league, PREMIER LEAGUE, was not full of unloyal diving southamericans but actually real men not crying. Imagine Neymar after this tackle xD He would have needed an ambulance helicopter, jokez :PPPPPPPPppp
[youtube]https://www.youtube.com/watch?v=9P3LiOyt0Ew[/youtube]
-
[youtube]https://www.youtube.com/watch?v=ySjAW_-v_Pc[/youtube]
-
Vinnie Fucking Jones
[youtube]http://www.youtube.com/watch?v=EDkKduNT684[/youtube]
-
(http://i.dailymail.co.uk/i/pix/2014/07/07/article-2683753-1F6989ED00000578-5_634x433.jpg)
these are real footballers and not kids:
[youtube]https://www.youtube.com/watch?v=tsRSt5hI2sQ[/youtube]
-
:L :L :L :L :L :L :L
[youtube]9B1M3IPVcXs[/youtube]
-
i was just joking, lol'ed so much when this happened
_______________
[23:54:53] [CAD]Renz0 [20]:{ffffff} i hate sabre
[23:54:55] ciiko finished 5th in 2:07.295 (Score:+2.66)
[23:54:57] [CAD]Renz0 [20]:{ffffff} dont vote sabre
[23:55:00] [NR]IroN_ [24]:{ffffff} i hate you
[23:55:04] [2F2F]Painkiller [32]:{ffffff} something you like?
[23:55:05] [CAD]Renz0 [20]:{ffffff} fu
[23:55:06] [NR]IroN_ [24]:{ffffff} bitcho
[23:55:06] xSilva finished 6th in 2:18.088 (Score:+1.80)
[23:55:13] [CAD]Renz0 [20]:{ffffff} i like ur mom
[23:55:15] ciiko [33]:{ffffff} ee
[23:55:16] Voting Over! {00B4FF}2F2F_Sabre{0AFF0A} wins with {00B4FF}3{0AFF0A} votes
[23:55:20] ciiko [33]:{ffffff} balkan?
[23:55:22] [Server] [2F2F]Painkiller has muted [CAD]Renz0
[23:55:23] [NFS]InhOMello_ is now back in /RACE
[23:55:25] 2F2F_Sabre {00B4FF}by{00FF93} [2F2F]DodgeR {00B4FF}4.1 Miles [11/5/2013]
[23:55:25] {FFFF00}2:47.666 by [2F2F]SHELL{00FF93} {00B4FF}Time Trial None
[23:55:25] [Personal Best] Record time for 2F2F_Sabre: --:--:---
[23:55:25] {FFFF00}You haven't rated this race yet. {00FF00}Likes: 22 (61.1%) {FF0000}Dislikes: 14 (38.8%)
[23:55:32] [2F2F]Painkiller [32]:{ffffff} i said before, don't mention my mother
(https://i0.wp.com/www.takethis.org/wp-content/uploads/2016/04/triggered-meme.jpg?fit=850%2C297)
-
when you got no space left in the car but need to transfer the granny
(http://i.imgur.com/VoVRQy6.png)
what the fuck lmao
-
[youtube]http://www.youtube.com/watch?v=vhCypQDusYI[/youtube]
-
:L
[youtube]https://www.youtube.com/watch?v=jupQoghJJBw[/youtube]
-
that was actually hilarious
-
[youtube]http://www.youtube.com/watch?v=HcGYElbP5BQ[/youtube]
-
lmaolmao
[youtube]http://www.youtube.com/watch?v=xmlgdFBGsDY[/youtube]
-
:L :L :L :L :L :L :L :L :L :L :L :L :L :L
-
lmaolmao
[youtube]http://www.youtube.com/watch?v=xmlgdFBGsDY[/youtube]
Loool. This reminds me of my friend Sarah.
-
f00kin brilliant, lol
[youtube]https://www.youtube.com/watch?time_continue=140&v=dkwmSvWMwYI[/youtube]
-
Legend
[youtube]https://www.youtube.com/watch?v=t8nz3knvhts[/youtube]
-
(http://media.wallgif.com/gifs/1c9ea6e612909de11d568b5aa172648b08282ace.gif)
-
[youtube]http://www.youtube.com/watch?v=EhoqiNXdFNs[/youtube]
-
4chan never fails to show extreme autism
(https://i.imgur.com/Ar2S6dx.png)
just curious, checked this and indeed, there is mistake: skip to 0:29
https://youtu.be/3lyiZMeTKIo?t=29s
-
:L
[youtube]https://www.youtube.com/watch?v=9vOv8Fy1BKg[/youtube]
-
.
lol!!
-
:L :L :L :L :L
-
[youtube]http://www.youtube.com/watch?v=Li76jhtzlXw[/youtube]
-
LOL its perfect
-
this is pretty hilarious :laugh:
[youtube]https://www.youtube.com/watch?v=tyO56k1MI-s&t=4s[/youtube]
and not really funny but great to watch, this insane video..
[youtube]https://www.youtube.com/watch?v=GcKkiRl9_qE[/youtube]
-
lol my spray was licked by someone
(https://steamuserimages-a.akamaihd.net/ugc/939433995329415330/83F1051687121D14BCE49B8BFDF2112352AEB176/)
NOT SAFE FOR WORK
(https://steamuserimages-a.akamaihd.net/ugc/939433995329427403/466F6C6555247C0C1933685528F8515ECDF50B53/)
-
(https://i.imgur.com/mVb5dCb.jpg)
-
in my town..
(https://i.imgur.com/7xHJXeR.jpg)
-
Phobos, haha :L
I have video from my town. Date 12 jul 2013. woman with a mop :D
[youtube]https://www.youtube.com/watch?v=JchLWh50jsM[/youtube]
-
:D :D :D
(https://image.ibb.co/dyvUsy/1.jpg)
-
[youtube]http://www.youtube.com/watch?v=IwSqm5CTvOg[/youtube]
-
[youtube]http://www.youtube.com/watch?v=3PI04bZe4Oc&feature=youtu.be[/youtube]
sorry for doublepost, but just happened to me today in a race :L
-
[youtube]https://www.youtube.com/watch?time_continue=1&v=E-cIEFnn-Zw[/youtube]
-
COVID-19 in GTA SA [youtube]https://www.youtube.com/watch?v=1enqGd8sf0o[/youtube] :L :L
-
(spin)
-
When we tried beat MadMax in score! That's will legendary fight! :D :D
(https://i.imgur.com/qYcicHq.jpg)