AdrenalineX Forums

General => Off-Topic => Topic started by: [2F2F]SNiKeRiS on December 27, 2008, 12:50:59 am

Title: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on December 27, 2008, 12:50:59 am
I don't know is there any topic like this, but i created this :D  So show your funny vids here to us to see ;)

My favorite: Jeff Dunham - Achmed the Dead Terrorist

https://www.youtube.com/watch?v=1uwOL4rB-go

Same achmed : Jeff Dunham Achmed's "Jingle Bombs" :D

https://uk.youtube.com/watch?v=wskT6YfVB6E

Enjoy ! ;)
Title: Re: Funny Videos
Post by: Sonic on December 27, 2008, 01:17:25 am
Like we haven't seen this already...
but good to post anyway :P
Title: Re: Funny Videos
Post by: [MAF]mooman on December 27, 2008, 09:35:24 pm
https://uk.youtube.com/watch?v=6Z55OLcOVQA
https://uk.youtube.com/watch?v=i7dB0LvTxOI
Title: Re: Funny Videos
Post by: [2F2F]SNiKeRiS on December 27, 2008, 11:55:20 pm
Top Gear - The most ridiculous challenge vs Germans!  :D

1st challenge
https://uk.youtube.com/watch?v=gSbC-rsb0yg
2nd challenge
https://uk.youtube.com/watch?v=D7MiVMq7NQg
3rd challenge
https://uk.youtube.com/watch?v=_qxHkkSGIcs
Title: Re: Funny Videos
Post by: [LSR]Jalicno on December 31, 2008, 03:58:50 pm
https://www.youtube.com/watch?v=vIatLyAdtAM
Title: Re: Funny Videos
Post by: [MAF]Aj_Lajk_Bir on December 31, 2008, 04:23:38 pm
https://www.youtube.com/watch?v=ehEXQi3meBM

https://www.youtube.com/watch?v=jT7NQk5N0qY

https://www.youtube.com/watch?v=su25Kz2TyPI

https://www.youtube.com/watch?v=DJ2Cpvv2atQ

https://www.youtube.com/watch?v=26WvlP2HxbY

enjoy ;D
Title: Re: Funny Videos
Post by: [MAF]Cthulhu on December 31, 2008, 05:28:56 pm
https://www.youtube.com/watch?v=7RMLt28n0-M

https://www.youtube.com/watch?v=GoCqvnJFUUA
(5:43 the best)

https://www.youtube.com/watch?v=5wfVDutW2Lw

https://www.youtube.com/watch?v=zxEi3h5vqAY
Title: Re: Funny Videos
Post by: [MAF]mooman on December 31, 2008, 06:13:22 pm
hahahaha ive seen that first video before - never gets old
Title: Re: Funny Videos
Post by: Bucha_Bucha on December 31, 2008, 08:35:57 pm
Isn't it the well known knutico ? rofl xD

http://www.wrzuta.pl/film/y7Coi01Dgx

Snikeris check my avatar ;D
Title: Re: Funny Videos
Post by: SubUrban on January 02, 2009, 01:27:53 pm
Snik,ur video with Achmed is cool lol ;D
Title: Re: Funny Videos
Post by: [2F2F]SNiKeRiS on January 02, 2009, 04:49:49 pm
Isn't it the well known knutico ? rofl xD

http://www.wrzuta.pl/film/y7Coi01Dgx

Snikeris check my avatar ;D


Loooool nice avatar man  ;D ;D

But video is insane !!!  ;D

Ah old times i remember this song when it was  in every mobilephone. It was so popular  :'(  ;D
Title: Re: Funny Videos
Post by: [MAF]Cthulhu on January 14, 2009, 03:26:22 pm
crazy.... :D
https://www.youtube.com/watch?v=EaOMdRm3q4I https://www.youtube.com/watch?v=hYJIAHpDRMs https://www.youtube.com/watch?v=D5DlGcY5ASM https://www.youtube.com/watch?v=8CihCIWgQGA https://www.youtube.com/watch?v=lRefZf3gj74
Title: Re: Funny Videos
Post by: [MAF]mooman on January 14, 2009, 03:46:44 pm
lol at the chicken :L
Title: Re: Funny Videos
Post by: DRIVE_OR_DIE on January 16, 2009, 03:59:01 am
http://www.youtube.com/watch?v=v5MWBKLclgs&feature=related

These fat chineses in elevator are the best
Title: Re: Funny Videos
Post by: [MAF]Cthulhu on January 18, 2009, 12:23:41 am
just put Worst Video Games Ever on youtube and u'll see something like this xDDDDDD
https://www.youtube.com/watch?v=dKwA066rNn0
Title: Re: Funny Videos
Post by: [AK47]M4lysz on January 18, 2009, 02:59:24 am
LOL :O
Title: Re: Funny Videos
Post by: [MAF]Vertigo on January 18, 2009, 03:31:42 am
Speaking of video games...

https://au.youtube.com/watch?v=UoxN8AEgSWc

https://au.youtube.com/watch?v=SYRLTF71Sow
Title: Re: Funny Videos
Post by: [MAF]mooman on January 18, 2009, 03:35:30 am
Code: [Select]
[youtube][/youtube]
Title: Re: Funny Videos
Post by: [MAF]Vertigo on January 18, 2009, 03:45:27 am
lol thx
Title: Re: Funny Videos
Post by: [2F2F]Al3X on January 18, 2009, 10:13:43 am
lol_haha_lol_haha:D:D:D
Title: Re: Funny Videos
Post by: [2F2F]Steven8 on January 20, 2009, 04:35:06 pm
ABUAAHUAHAUAHAUAHUHAUAAHU XDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
rofl xDDD
Title: Re: Funny Videos
Post by: [2F2F]SNiKeRiS on January 20, 2009, 04:38:27 pm
Ah omg ! rofl rofl ! Ups slap and hahaha ! xDDDD  ;D ;D
Title: Re: Funny Videos
Post by: SubUrban on January 20, 2009, 04:53:10 pm
Here are three vid's of mine favourite list xD
https://www.youtube.com/watch?v=l64Wk6KdROQ
https://www.youtube.com/watch?v=8sd_HUZc794
https://www.youtube.com/watch?v=TZFOo--18nw
Title: Re: Funny Videos
Post by: [MAF]Aj_Lajk_Bir on January 20, 2009, 05:01:49 pm
loooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooool_haha
Title: Re: Funny Videos
Post by: [2F2F]Steven8 on January 20, 2009, 05:06:55 pm
http://www.youtube.com/watch?v=ZInaKg47k3w

love that one xD
Title: Re: Funny Videos
Post by: [MAF]Aj_Lajk_Bir on January 20, 2009, 05:24:35 pm
lol this song is cool
Title: Re: Funny Videos
Post by: [AK47]M4lysz on January 20, 2009, 11:43:43 pm
You know its gonna be a bad flight when you look out your window and see this shit… yep, what happened to the engine cover?
(http://files.uploadffs.com/d/06a4d295_planecrash5.jpg)
(http://files.uploadffs.com/3/a27834a7_sistercarcharias.jpg)
(http://files.uploadffs.com/b/0962b97f_1.gif)
(http://files.uploadffs.com/d/dcd4d42c_13.gif)
(http://files.uploadffs.com/8/43568b45_6.gif)
(http://files.uploadffs.com/a/b9a1a9b9_joehitme3.jpg)
xD


Title: Re: Funny Videos
Post by: SubUrban on January 21, 2009, 06:14:08 pm
Lool yep M4! worse with that then Bermuda's triangle xD
Title: Re: Funny Videos
Post by: [MAF]mooman on January 21, 2009, 06:14:42 pm
those aren't videos! :O
Title: Re: Funny Videos
Post by: [AK47]M4lysz on January 24, 2009, 07:55:47 pm
LOL!
http://uk.youtube.com/watch?v=k-eNpvyJNuo
Title: Re: Funny Videos
Post by: [MAF]Aj_Lajk_Bir on January 24, 2009, 08:10:37 pm
omg you record it? loool
Title: Re: Funny Videos
Post by: Thrasher on January 24, 2009, 08:51:18 pm
You know its gonna be a bad flight when you look out your window and see this shit… yep, what happened to the engine cover?
(http://files.uploadffs.com/d/06a4d295_planecrash5.jpg)

 :o
Title: Re: Funny Videos
Post by: [FSR]Ush on January 26, 2009, 11:31:58 am
OMG IS THIS TURKISH AIR AGAIN XD ?
Title: Re: Funny Videos
Post by: [FSR]Michal on January 28, 2009, 11:06:05 pm
http://www.albinoblacksheep.com/flash/witchdoctor (http://www.albinoblacksheep.com/flash/witchdoctor) only for NUTZZZZ

http://youtube.com/watch?v=fJuNgBkloFE - I have no more question xD
Title: Re: Funny Videos
Post by: Skell on January 29, 2009, 05:23:47 am
https://www.youtube.com/watch?v=vIatLyAdtAM

the guy is talking portuguese..
Title: Re: Funny Videos
Post by: [MAF]Cthulhu on January 29, 2009, 01:50:04 pm
http://youtube.com/watch?v=fJuNgBkloFE - I have no more question xD
LMAO!! ''How many sides does a trianlge have?'' - ''Damn,four''; ''There's no sides.....One?'' xDDDDDDDDDDD :D :D :D
Title: Re: Funny Videos
Post by: [MAF]Aj_Lajk_Bir on January 30, 2009, 10:07:53 pm
https://pl.youtube.com/watch?v=N2QXGL8zesk
lool
Title: Re: Funny Videos
Post by: [2F2F]SNiKeRiS on February 01, 2009, 03:15:20 pm
Ali G & the NBA xDDD

https://www.youtube.com/watch?v=ZPQVew0L0Vg
Title: Re: Funny Videos
Post by: [2F2F]SNiKeRiS on February 07, 2009, 04:22:12 pm
The sick one... Maybe all know this :L

boom headshot

https://www.youtube.com/watch?v=olm7xC-gBMY
Title: Re: Funny Videos
Post by: [LSR]Jalicno on February 07, 2009, 10:46:01 pm
https://www.youtube.com/watch?v=AZETcd25-tU
Title: Re: Funny Videos
Post by: [2F2F]SNiKeRiS on February 07, 2009, 10:49:36 pm
It's in Xifre page :)

http://www.xfire.com/video/62726/
Title: Re: Funny Videos
Post by: [MAF]Cthulhu on February 07, 2009, 10:50:42 pm
https://www.youtube.com/watch?v=AZETcd25-tU
ROFLMAO that's classic ! xDDDDD
 ;D ;D ;D ;D :D :D :D :D :D
Title: Re: Funny Videos
Post by: [FSR]Michal on February 10, 2009, 06:18:32 am
https://www.youtube.com/watch?v=riTNLO2rCpo parody of many songs :D
Title: Re: Funny Videos
Post by: [MAF]MrHess on February 10, 2009, 06:05:20 pm
lol awesome
Title: Re: Funny Videos
Post by: [2F2F]SNiKeRiS on February 12, 2009, 07:16:56 pm
Can't stop laughing :L

https://www.youtube.com/watch?v=x0OdYKc5Fuo
Title: Re: Funny Videos
Post by: [MAF]Aj_Lajk_Bir on February 12, 2009, 09:11:47 pm
lool
https://www.youtube.com/watch?v=c2CnEu_KcxU
Title: Re: Funny Videos
Post by: [MAF]Cthulhu on February 12, 2009, 09:27:39 pm
ROFL !! they look like 'monkeyfuckers' ;_; is it marmi and trampek ? :L :L
Title: Re: Funny Videos
Post by: [MAF]Snoopy on February 12, 2009, 09:39:18 pm
tampon and marmite :L
Title: Re: Funny Videos
Post by: [MAF]Aj_Lajk_Bir on February 12, 2009, 09:52:59 pm
red-trampek
black-marmi
;_;
Title: Re: Funny Videos
Post by: [MAF]MrHess on February 13, 2009, 02:42:42 am
that´s why giving drugs to kids is a bad idea
Title: Re: Funny Videos
Post by: [2F2F]Steven8 on February 13, 2009, 09:26:20 pm
check this friends xDDDDDDDDDDDDDDDDDD Disco in Packistan :D:D
http://www.maxior.pl/film/121683/Dyskoteka_w_Pakistanie

click on "Odtwarzaj" xD
Title: Re: Funny Videos
Post by: [MAF]MrHess on February 15, 2009, 05:44:15 am
actually this one is not a funny video, but Im too lazy to make another topic just for a video.

Here u go

http://www.metacafe.com/watch/811500/electric_meter_hack_how_to_cut_your_electricity_bill_in_half/
Title: Re: Funny Videos
Post by: [MAF]mooman on February 22, 2009, 06:41:51 pm
https://www.youtube.com/watch?v=2a1CzNGNdrs
Title: Re: Funny Videos
Post by: [MAF]Cthulhu on February 22, 2009, 06:49:55 pm
loool, a banana :L
Title: Re: Funny Videos
Post by: SubUrban on February 24, 2009, 03:35:46 pm
Hahha yo guys,one day i was bored,rain outside...blah,and i go on youtube try look for to fast to fourios 4 trailers.And i saw this enjoy!(don't cut movies and turn on speakers xD) https://www.youtube.com/watch?v=fp9ZZ3PSwPA
Title: Re: Funny Videos
Post by: SubUrban on February 24, 2009, 03:42:32 pm
looool Steben!! hahha good disco LETS PARTY!! roof on the fire!  ;D
Title: Re: Funny Videos
Post by: [2F2F]Steven8 on February 24, 2009, 03:45:12 pm
looool Steben!! hahha good disco LETS PARTY!! roof on the fire!  ;D
lol what ? XD
Title: Re: Funny Videos
Post by: [AK47]M4lysz on March 01, 2009, 08:44:02 am
hahah to fast to fourios cool video
(http://files.uploadffs.com/1/5b0a18a0/drzewo_cipa.jpg)

Title: Re: Funny Videos
Post by: [MAF]Cthulhu on March 01, 2009, 10:39:13 am
lool :L
Title: Re: Funny Videos
Post by: SwEeT on March 01, 2009, 01:52:38 pm
hahah to fast to fourios cool video
(http://files.uploadffs.com/1/5b0a18a0/drzewo_cipa.jpg)


LoL happy pussy xD it looks like it smiles xD
Title: Re: Funny Videos
Post by: [AK47]M4lysz on March 03, 2009, 11:29:30 am

                              http://www.youtube.com/watch?v=FW4qKwxX6Fo

(http://files.uploadffs.com/b/3528b90d/adrenalinex.bmp)

                              http://www.youtube.com/watch?v=FW4qKwxX6Fo
Title: Re: Funny Videos
Post by: [MAF]Rac3r on March 03, 2009, 11:59:46 am
lol funny vid, love the TMA map, nice custom vehicles M4 ;D
Title: Re: Funny Videos
Post by: [MAF]Cthulhu on March 03, 2009, 02:18:27 pm
haha funny  ;D nice dumper :L
Title: Re: Funny Videos
Post by: [2F2F]SNiKeRiS on March 03, 2009, 02:27:15 pm
Yeah nice videos and that TMA track -.- :L :L
Title: Re: Funny Videos
Post by: SwEeT on March 03, 2009, 03:37:45 pm
haha lol nice vid :D
Title: Re: Funny Videos
Post by: [MAF]MrHess on March 03, 2009, 06:32:22 pm
rofl
Title: Re: Funny Videos
Post by: [MAF]mooman on March 03, 2009, 09:16:53 pm

(http://files.uploadffs.com/8/1fe78e3d/ushhour.PNG)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 03, 2009, 09:21:45 pm
that's perfection :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on March 03, 2009, 09:38:43 pm
lmao ush hour  ;D :L
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on March 03, 2009, 10:09:26 pm
hahahaha xDDD  ;D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 04, 2009, 12:47:33 am
Now I wanna see 28 Ush weeks later :L
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on March 06, 2009, 07:09:18 am
(http://files.uploadffs.com/5/2bca57c2/12345.jpg)
(http://files.uploadffs.com/7/4da67233/funny_sign_04.jpg)
(http://files.uploadffs.com/5/e1c85fd8/poorgasmilage.jpg)
(http://files.uploadffs.com/5/57675e14/StupidSign.jpg)
(http://files.uploadffs.com/7/2803745e/images.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 06, 2009, 07:32:47 am
ahhahah nice pictures m4 :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 06, 2009, 01:37:21 pm
nice pics m4  ;D
(http://i44.tinypic.com/fz7u2q.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 06, 2009, 01:41:32 pm
(http://img264.imageshack.us/img264/2844/1dedykacjadladevil66653.jpg) (http://img264.imageshack.us/my.php?image=1dedykacjadladevil66653.jpg)

(http://img5.imageshack.us/img5/3494/devil666.jpg) (http://img5.imageshack.us/my.php?image=devil666.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on March 06, 2009, 02:27:47 pm
(http://www.wayodd.com/funny-pictures2/funny-pictures-baywatch-nightmare-SoA.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 06, 2009, 04:48:41 pm
LOL
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on March 07, 2009, 11:10:19 pm
(http://icanhascheezburger.files.wordpress.com/2007/12/funny-pictures-lol-squid.jpg)

(http://republika.pl/blog_xc_3794271/4827011/sz/lol-46383.jpg)


(http://icanhascheezburger.files.wordpress.com/2008/02/funny-pictures-black-l-cat-lol.jpg)

(http://icanhascheezburger.files.wordpress.com/2008/06/funny-pictures-kittens-lol-tetris.jpg)

(http://www.popular-pics.com/ppimages/OMG-WFT-BBQ.jpg)

(http://img2.moonbuggy.org/imgstore/omg-it-spins.jpg)
(http://img409.imageshack.us/img409/8258/pwned111za6.jpg)

(http://www.verso.pl/lu/w0_haha.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on March 08, 2009, 02:18:37 am
http://www.youtube.com/watch?v=RgriTO8UHvs
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on March 08, 2009, 06:56:29 pm
http://www.youtube.com/watch?v=PJupNDIKkEk xDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 08, 2009, 08:14:41 pm
rofl, arabians are crazy :L
Title: Re: Funny Videos/Pictures
Post by: BuRnOUT on March 08, 2009, 08:43:42 pm
https://www.youtube.com/watch?v=_Fe17mCBzAk
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on March 08, 2009, 09:46:35 pm
http://www.youtube.com/watch?v=PJupNDIKkEk xDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD

Lol ! And they just having fun with that :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on March 10, 2009, 11:15:16 pm
(http://files.uploadffs.com/1/e6961c9b/DSC01306.JPG)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 10, 2009, 11:28:51 pm
haha emfour :L
Title: Re: Funny Videos/Pictures
Post by: BuRnOUT on March 10, 2009, 11:30:05 pm
(http://files.uploadffs.com/1/e6961c9b/DSC01306.JPG)

:))drugs? xD marijuana ^^, ghost smoke that shit many times with ours friends, i only smoke 2 times xD and it was in partys :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 11, 2009, 10:27:47 am
crazy arabs :L

I like to participate in their games, sliding on sandals, maybe it could be new modification for AdrenalineX, Crazy Arab driving(=sandal sliding near car :L )

hhahaha ;_; :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on March 11, 2009, 01:18:31 pm
lol
ush always have cool idea :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on March 11, 2009, 10:16:17 pm
http://www.youtube.com/watch?v=fMyljwUTgbY

HOLY SHIT :O
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on March 11, 2009, 10:27:52 pm
Just don't know what to say lol. Funny and creapy at the same time :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 12, 2009, 01:36:02 am
omg thats really creepy..
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on March 12, 2009, 01:53:20 pm
omfg!  :o
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on March 12, 2009, 10:27:39 pm
Some dude from Lithuania making drift during lounch brake xDDD

http://www.juokis.com/2008/07/10/filmuok-driftinsiu/
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on March 12, 2009, 10:28:33 pm
only youtube links for work with [youtube] ;_;
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on March 12, 2009, 10:32:07 pm
Russian kids :L :L :L

http://www.juokis.com/2008/07/17/ivairus-video/
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on March 13, 2009, 01:58:57 am
roflmao
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on March 13, 2009, 04:08:08 am
lol  what an bike expirience remebering my 1st time driving a bike xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on March 13, 2009, 07:56:48 am
nice vids snik :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on March 15, 2009, 09:29:59 pm
https://www.youtube.com/watch?v=mhx6RC8omIM
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 15, 2009, 10:12:35 pm
lol crazy
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on March 16, 2009, 08:56:11 pm
Today my one friend sent a link to me where was a video with chipmunks :L

If u wanna hear them just type chimpunks with your song name. :D
Like this: Fort minor - remember the name chimpunks

Here this for some lough:

https://www.youtube.com/watch?v=k9mAwA3Nk1s
Title: Re: Funny Videos/Pictures
Post by: SwEeT on March 17, 2009, 05:25:42 am
LoL haha
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Al3X on March 19, 2009, 03:16:44 pm
(http://img6.imageshack.us/img6/6994/fdgdfgd.th.jpg) (http://img6.imageshack.us/my.php?image=fdgdfgd.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on March 20, 2009, 07:06:20 pm
I'm almost sure u all will enjoy background instead of foreground lol XD
(http://i44.tinypic.com/3339vtw.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSD]Young on March 20, 2009, 11:26:02 pm
hahah jali XD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 21, 2009, 01:30:54 am
(http://img23.imageshack.us/img23/1426/vsx127tmp.jpg) (http://img23.imageshack.us/my.php?image=vsx127tmp.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 21, 2009, 01:31:28 am
hahah and the dude at the pic is McPoo... i mean McPott ;_;
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 21, 2009, 01:31:47 am
:L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on March 21, 2009, 06:49:03 am
"Me and my homie" lol xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on March 21, 2009, 12:00:06 pm
http://www.youtube.com/watch?v=mXFm_gzLoSM
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on March 21, 2009, 12:17:30 pm
Kurwa Alba, has no talent in actress :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 22, 2009, 02:02:08 am
(http://www.bonappetit.com/images/tips_tools_ingredients/ingredients/ttar_egg_03_v_launch.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on March 22, 2009, 06:30:51 am
https://www.youtube.com/watch?v=c7RQNQGPusk lol so funny when u compare to polish language ;)
Title: Re: Funny Videos/Pictures
Post by: Peeps-101 on March 22, 2009, 06:50:39 am
translate into english pls  8)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on March 22, 2009, 07:12:44 am
^
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 22, 2009, 10:07:14 am
https://www.youtube.com/watch?v=c7RQNQGPusk lol so funny when u compare to polish language ;)
who the fuck translated those words lol, almost none of them are right :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on March 23, 2009, 07:17:36 am
 ??? ??? ???
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 23, 2009, 10:18:45 am
??? ??? ???

same
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on March 23, 2009, 05:34:49 pm
https://www.youtube.com/watch?v=Y-6krPDviDA
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 23, 2009, 05:47:14 pm
hahahahahhaahahaha you had to didnt you :L :L :L :L :L :L :L :L :L :L :L :L :L
Title: Re: Funny Videos/Pictures
Post by: D4nielleq on March 23, 2009, 06:04:29 pm
http://www.fotosik.pl/pokaz_obrazek/7506a7316af79a09.html
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on March 23, 2009, 06:05:09 pm
you have right you are n00b
Title: Re: Funny Videos/Pictures
Post by: D4nielleq on March 23, 2009, 06:06:55 pm
[FSR]michalFake jest mniejszym noobem niz [FSR]michal hih
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on March 23, 2009, 06:15:00 pm
[FSR]michalFake jest mniejszym noobem niz [FSR]michal hih
chcia?by? lol

he said Michal is bigger noob than MichalFake xD
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on March 23, 2009, 07:24:02 pm
While i was looking for cars xDDDD

(http://i42.tinypic.com/eqci9v.jpg)
Title: Re: Funny Videos/Pictures
Post by: Wait in the fire on March 24, 2009, 06:08:49 pm
Looool, I love Remi Gaillard's video xD
Title: PEOPLE WHO ANNOY YOU :L
Post by: [FSR]Ush on March 24, 2009, 07:38:57 pm
(http://i13.tinypic.com/61v2uev.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on March 24, 2009, 07:58:37 pm
NIGGERS?
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on March 26, 2009, 02:52:11 pm
https://www.youtube.com/watch?v=ADY8UMeleWc xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on March 26, 2009, 02:54:39 pm
https://www.youtube.com/watch?v=qOGNDoDPCnU
 ;D :D ;) :)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 26, 2009, 02:57:17 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on March 26, 2009, 02:57:36 pm
Haddaway ftw

EDIT!!!

Especially for FireFox xDDD
http://www.joemonster.org/filmy/7879/What-is-Love-w-18-wersjach
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Al3X on March 26, 2009, 03:25:48 pm
roflmao :D :D :D :D :D :D :D :D :D :D :D :D :D :D

http://www.youtube.com/watch?v=l6NJqGPVd-A&feature=channel
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on March 26, 2009, 03:55:04 pm
LOOL! HAHA
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on March 26, 2009, 08:43:17 pm
(http://images48.fotosik.pl/92/c249ae9e3a2729c4m.jpg) (http://www.fotosik.pl/showFullSize.php?id=c249ae9e3a2729c4) that's was a Hitler "Wunderwaffe"
(http://images45.fotosik.pl/92/9c0b1b036f747480m.jpg) (http://www.fotosik.pl/showFullSize.php?id=9c0b1b036f747480) Wicked sick
(http://images36.fotosik.pl/88/4832a1d618a45b2am.jpg) (http://www.fotosik.pl/showFullSize.php?id=4832a1d618a45b2a) Spiderman duck Hero
(http://images45.fotosik.pl/92/342765b226ea5d3cm.jpg) (http://www.fotosik.pl/showFullSize.php?id=342765b226ea5d3c) Mr. Ericsson and Mrs. Nokia
(http://images45.fotosik.pl/92/6342be873c2e9a19m.jpg) (http://www.fotosik.pl/showFullSize.php?id=6342be873c2e9a19) Brainiac
(http://images41.fotosik.pl/88/2398e6be3ea3bb9fm.jpg) (http://www.fotosik.pl/showFullSize.php?id=2398e6be3ea3bb9f) Devil666 MTB racing xD
(http://images39.fotosik.pl/88/1111750a889c8e42m.jpg) (http://www.fotosik.pl/showFullSize.php?id=1111750a889c8e42) Batman and Dumbo
(http://images36.fotosik.pl/88/a695077f7c9680b7m.jpg) (http://www.fotosik.pl/showFullSize.php?id=a695077f7c9680b7) Last Unicorn xD
(http://images43.fotosik.pl/92/c2246e13835673e5m.jpg) (http://www.fotosik.pl/showFullSize.php?id=c2246e13835673e5) NRG 125
(http://images45.fotosik.pl/92/40f15beb5fc1e7f7m.jpg) (http://www.fotosik.pl/showFullSize.php?id=40f15beb5fc1e7f7) Africa Party
(http://images49.fotosik.pl/92/d930e2a8c0f00555m.jpg) (http://www.fotosik.pl/showFullSize.php?id=d930e2a8c0f00555) Day the Earth Stood Still
(http://images37.fotosik.pl/88/b9cfefaa2f79a5e8m.jpg) (http://www.fotosik.pl/showFullSize.php?id=b9cfefaa2f79a5e8) IN-Vitro in Japan
(http://images45.fotosik.pl/92/94370303d0294c48m.jpg) (http://www.fotosik.pl/showFullSize.php?id=94370303d0294c48) Deathmach
(http://images43.fotosik.pl/92/0425798d1c199c11m.jpg) (http://www.fotosik.pl/showFullSize.php?id=0425798d1c199c11) WTF Emo/Joker ? xD
(http://images50.fotosik.pl/92/b5ba0f6b0e2dd7b0m.jpg) (http://www.fotosik.pl/showFullSize.php?id=b5ba0f6b0e2dd7b0) Granny and alcohol..
(http://images41.fotosik.pl/88/00833d1bf17b22eem.jpg) (http://www.fotosik.pl/showFullSize.php?id=00833d1bf17b22ee) He isn't sick
(http://images46.fotosik.pl/92/3c4b771bf12c7dabm.jpg) (http://www.fotosik.pl/showFullSize.php?id=3c4b771bf12c7dab) Rambo Bambo cookies
(http://images50.fotosik.pl/92/0cdaa8e4674f6d9bm.jpg) (http://www.fotosik.pl/showFullSize.php?id=0cdaa8e4674f6d9b) "Dad .... am I rly Ugly?"
(http://images43.fotosik.pl/92/ec1eaab04c5ab4b4m.jpg) (http://www.fotosik.pl/showFullSize.php?id=ec1eaab04c5ab4b4) WTF stay there? :D
(http://images36.fotosik.pl/88/ec8204e4f1e15f6am.jpg) (http://www.fotosik.pl/showFullSize.php?id=ec8204e4f1e15f6a) Stunt vs wires
(http://images37.fotosik.pl/88/59de077388e2e528m.jpg) (http://www.fotosik.pl/showFullSize.php?id=59de077388e2e528) Doritos ... food for Aliens ?:D
(http://images43.fotosik.pl/92/113f264d2f8cad9em.jpg) (http://www.fotosik.pl/showFullSize.php?id=113f264d2f8cad9e) "Overhaulin'"
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 26, 2009, 09:28:16 pm
lmao!
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 26, 2009, 09:37:41 pm
nhahah nice michal =D
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on March 26, 2009, 09:43:04 pm
hahahahaha  8)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on March 27, 2009, 01:54:24 pm
michal more pic like this!  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on March 28, 2009, 07:13:08 pm
https://www.youtube.com/watch?v=Fubs7wE4vTk
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on March 30, 2009, 06:13:03 am
https://www.youtube.com/watch?v=UZLYBGPU_c0
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 30, 2009, 10:07:16 am
haha my 1st vid  :D (i made it quickly so didn't do anything for better music =D

https://www.youtube.com/watch?v=-oa6Tguf8cQ
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 30, 2009, 02:33:21 pm
hahaha nice one :L
btw that piss command is /a piss xD
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on April 01, 2009, 07:35:05 am
pwnt lol when i saw this :L :L :L :L :L

here is the link :L

 http://www.youtube.com/watch?v=pwdC2Ge4a5Q&feature=rec-HM-r2&flip=1

(http://i41.tinypic.com/35d9r2t.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 01, 2009, 08:27:04 am
lol new language :O
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on April 01, 2009, 12:01:20 pm
CSI: NY speaks lithuanian. I only understand half of what he said :L

https://www.youtube.com/watch?v=hG6IIW7lEKQ
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on April 01, 2009, 12:35:17 pm
Snik, this is disgusting xD

https://www.youtube.com/watch?v=bNF_P281Uu4

what a lucker  :-\
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 01, 2009, 01:53:45 pm
lol that's crazy :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on April 01, 2009, 04:56:09 pm
what a lucker  :-\
Lol Steven I told you about this movie and project over 4 moths ago :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on April 01, 2009, 06:51:16 pm
what a lucker  :-\
Lol Steven I told you about this movie and project over 4 moths ago :D
It was u ? xDDDDDDDDDDDDDDDDDD
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on April 01, 2009, 08:35:26 pm
yes that was me :D (http://alejahandlowa.pl/obr/fabryka/431_d.jpg) <-- Stev u need that if u have problem with
memories XD

end off topic : (http://failblog.files.wordpress.com/2009/03/fail-owned-drunk-drown-fail.jpg?w=500&h=374), (http://failblog.files.wordpress.com/2008/12/fail-owned-announcement-fail.jpg),(http://failblog.files.wordpress.com/2009/03/fail-owned-surrender-fail.jpg?w=392&h=500),(http://failblog.files.wordpress.com/2009/03/fail-owned-car-window-fail.jpg?w=500&h=375)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 01, 2009, 09:19:06 pm
lol "judgment" :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 02, 2009, 12:21:46 am
Ush playing Far Cry 2 SP  :D
I killed a goat xD xD

(http://img9.imageshack.us/img9/6217/farcry22009040201292881.jpg)

Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 02, 2009, 12:43:19 am
poor goat :(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 02, 2009, 05:10:32 am
RIP goat  :'(
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 03, 2009, 11:20:47 am
How to get the man wash his hands  ???

(http://94.100.114.33/534250001-534300000/534251101-534251200/534251180_5_Oqyu.jpeg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 03, 2009, 12:34:49 pm
lol where it is?
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 03, 2009, 01:25:09 pm
somewhere... I dunno :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on April 05, 2009, 10:02:11 am
Look what i found today xD on "car exhange" (http://images45.fotosik.pl/98/0959626b489a658am.jpg) (http://www.fotosik.pl/showFullSize.php?id=0959626b489a658a)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 05, 2009, 01:52:55 pm
hello george :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 05, 2009, 02:15:50 pm
:L O :L ETE
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on April 06, 2009, 05:09:05 pm
Look what i found today xD on "car exhange" (http://images45.fotosik.pl/98/0959626b489a658am.jpg) (http://www.fotosik.pl/showFullSize.php?id=0959626b489a658a)
sup green freak xD
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 06, 2009, 06:03:45 pm
zielone prózni
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on April 06, 2009, 06:05:10 pm
CLICK ON ME -->(http://images40.fotosik.pl/95/7077f9dbaf3f64acm.jpg) (http://www.fotosik.pl/showFullSize.php?id=7077f9dbaf3f64ac)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 06, 2009, 06:06:49 pm
hahah its me bitches  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 06, 2009, 08:01:47 pm
https://www.youtube.com/watch?v=t-zxi_Y4Xu8
https://www.youtube.com/watch?v=4qf1w2e2ju8
https://www.youtube.com/watch?v=4bekQU9l8hk
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 06, 2009, 08:27:56 pm
Poland have it too but in polish version :L but not funny like this
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 07, 2009, 11:18:27 am
(http://www.casafree.com/modules/xcgal/albums/userpics/21848/normal_mr%20nike%20-%20extremely%20funny%20pictures.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 07, 2009, 07:47:16 pm
and?
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 10, 2009, 11:50:55 am
(http://img9.imageshack.us/img9/7637/getsomenuts.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on April 10, 2009, 02:30:08 pm
snickers xD
Title: Re: Funny Videos/Pictures
Post by: ivanduk on April 11, 2009, 12:37:27 pm
(http://i42.tinypic.com/34p10ep.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 11, 2009, 01:13:46 pm
 ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 11, 2009, 01:20:39 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 12, 2009, 12:18:22 pm
wow I would love to get a sportsmotor one day...  :D

(http://allsupersport.com/afbeeldingen/fotos/sportmotor10.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 12, 2009, 01:04:49 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on April 13, 2009, 11:06:16 am
https://www.youtube.com/watch?v=jgU_4M7xr1U
:L
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on April 13, 2009, 11:06:41 am
https://www.youtube.com/watch?v=9DzS7squiSw
Also check part 8
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on April 13, 2009, 11:14:04 am
^i always enjoyed movies with this actor :D :D

https://www.youtube.com/watch?v=E3y6OmTVa4w
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 13, 2009, 11:25:23 am
lol funny man  :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 13, 2009, 12:32:35 pm
I would give him another euro for another beer for that performance  :D :D



(http://www.filestreamer.net/elephant_s.jpg)
Title: Re: Funny Videos/Pictures
Post by: Ray Carter on April 14, 2009, 12:21:20 am
con las motos no se corre   :D     http://img4.imageshack.us/img4/841/ktmnehoda3k.jpg
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 14, 2009, 02:14:54 am
Slide phail  :D

https://www.youtube.com/watch?v=bOXnxmlEkY0
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on April 14, 2009, 02:25:26 am
:L ^ andy's favourite video
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 14, 2009, 02:27:10 am
https://www.youtube.com/watch?v=dnNTjnfw3fM
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 14, 2009, 02:04:34 pm
lol @ the dog :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 15, 2009, 01:16:06 pm
(http://i391.photobucket.com/albums/oo357/foylyndstrom/stormtroopersiggy.jpg)

lol @ the dog :L :L :L

:L
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on April 16, 2009, 08:11:33 am
(http://files.uploadffs.com/7/15147a0d/thor.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 16, 2009, 11:04:07 am
looool :L :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 16, 2009, 12:43:36 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 16, 2009, 02:24:29 pm
nice :) you got a weed grinder, still gotta buy one :L im grinding the weed with my hands everytime :P
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on April 16, 2009, 05:31:33 pm
MadMax check 1,52 xD

(http://i41.tinypic.com/2v9x0ti.jpg)
 :D

btw its here
http://www.youtube.com/watch?v=sOyBiyjdB1g
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 16, 2009, 08:03:34 pm
(http://img27.imageshack.us/img27/6333/126667originalx2z6v.th.jpg) (http://img27.imageshack.us/my.php?image=126667originalx2z6v.jpg) (http://img201.imageshack.us/img201/8712/126666originalz5efq.th.jpg) (http://img201.imageshack.us/my.php?image=126666originalz5efq.jpg) (http://img201.imageshack.us/img201/6281/126664original0ld96.th.jpg) (http://img201.imageshack.us/my.php?image=126664original0ld96.jpg) (http://img201.imageshack.us/img201/5025/126271originale4m5f.th.jpg) (http://img201.imageshack.us/my.php?image=126271originale4m5f.jpg) (http://img201.imageshack.us/img201/6480/126266originalln0hr.th.jpg) (http://img201.imageshack.us/my.php?image=126266originalln0hr.jpg) (http://img201.imageshack.us/img201/7140/126259originalghnzi.th.jpg) (http://img201.imageshack.us/my.php?image=126259originalghnzi.jpg) (http://img201.imageshack.us/img201/967/126258original1pte3.th.jpg) (http://img201.imageshack.us/my.php?image=126258original1pte3.jpg) (http://img201.imageshack.us/img201/7641/126253original3e2r0.th.jpg) (http://img201.imageshack.us/my.php?image=126253original3e2r0.jpg) (http://img201.imageshack.us/img201/3729/127197originaliecbh.th.jpg) (http://img201.imageshack.us/my.php?image=127197originaliecbh.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on April 16, 2009, 08:50:30 pm
nice stev, i arleady know that car, i don't like that tribal paint on doors, it looks like fuckin japan tuning (nissan, honda, toyota, mazda, or more of that 'Electric Shit' with tons os bass and neons :

i DON'T like this:
(http://www.wrzuta.pl/img/middle/g0OTaOe8o2/nissan_350z_modified_tuning_auto_carros_cars_800_x_559)

i LIKE this:
(http://anythingonwheels.files.wordpress.com/2009/04/1970-dodge-charger-rt.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on April 16, 2009, 09:07:15 pm
Ah Max you are wrong also Americans could make "fuckin tuning" with cars.Anyway Japanese making very good cars at this moment.Nissan and Mazda are very popular brands in Europe.Also Americans were first who liked that "electric shits"  ;)
Title: Re: Funny Videos/Pictures
Post by: MadMax on April 16, 2009, 09:27:30 pm
i like some japan cas, i don't like that 'tehno-style' of some of them, i mean body kit, neons , bass etc...
i like easy construction without electric gadgets,
i like 'Rat Rods':
(http://www.enginebuildermag.com/Content/Site302/Basics/hcrat1jpg_00000005975.jpg)

and of course this... Ford Falcon 'The Last V8' Intreceptor from classical australian post-apocaliptic movie 'Mad Max'
(http://farm4.static.flickr.com/3007/2934143473_9e7df7b59c.jpg?v=0)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 16, 2009, 10:18:04 pm
fuck off with that signature man...
Title: Re: Funny Videos/Pictures
Post by: MadMax on April 16, 2009, 10:20:03 pm
ok...it seems to be 2 BIG
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 16, 2009, 10:21:04 pm
and not a little to big  :o :o
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 17, 2009, 02:41:20 am
muscle cars ftw
Title: Re: Funny Videos/Pictures
Post by: MadMax on April 17, 2009, 12:02:01 pm
i know knu  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Rac3r on April 17, 2009, 02:42:43 pm
[UK] AdrenalineX Racing - Forums > General > Off-Topic > Post reply ( Re: Funny Videos/Pictures )
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on April 22, 2009, 03:03:47 pm
(http://damien.webmedia.ee/lol.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 22, 2009, 03:05:31 pm
lol :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 22, 2009, 04:32:22 pm
rofl mankini ftw
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 22, 2009, 05:22:16 pm
(http://img23.imageshack.us/img23/6268/4005539.jpg)
(http://img26.imageshack.us/img26/9272/3489379.jpg)
(http://img142.imageshack.us/img142/8373/116866229.jpg)
(http://img26.imageshack.us/img26/8757/7012927.jpg)
(http://img26.imageshack.us/img26/6008/111126195.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 22, 2009, 05:28:27 pm
lol best grandma ever :P

http://video.google.com/googleplayer.swf?docid=3009268562868196073&hl=en&fs=true
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on April 24, 2009, 06:30:03 pm
https://www.youtube.com/watch?v=nllyMCF3Jyo Metal Idol :D he has qualified
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Al3X on April 25, 2009, 06:28:35 am
lol...in Romanian the show it's called MegaStar...and participants are more stupid then this

http://www.youtube.com/watch?v=SyITt55_aaM&feature=related

Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 25, 2009, 11:08:56 am
https://www.youtube.com/watch?v=0hNXPvm5-YM

:L

Worms Armageddon ftw!
https://www.youtube.com/watch?v=2KaiXeteNtQ
:L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on April 26, 2009, 08:12:33 am
(http://files.uploadffs.com/5/81e659cd/jesus20lol203ru0.jpg)  (http://i43.tinypic.com/dp7qqg.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 26, 2009, 08:37:38 am
(http://i43.tinypic.com/dp7qqg.jpg)

LOL :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on April 27, 2009, 06:17:12 pm
Remi Gilliard (awesome French comedian ) watch his other movies

https://www.youtube.com/watch?v=pIrvpn3k9A4

https://www.youtube.com/watch?v=MytfhzcSF-Y

https://www.youtube.com/watch?v=hYJIAHpDRMs My Fav ;) so many emotions R.I.P

https://www.youtube.com/watch?v=gHCxdlZ7G18

http://www.youtube.com/watch?v=S4ZO2FD4pNA <---Decathlon on the streets :D

https://www.youtube.com/watch?v=hqOBR_Xbw2I

https://www.youtube.com/watch?v=81szj1vpEu8

https://www.youtube.com/watch?v=RGy6txj8FQ0

https://www.youtube.com/watch?v=eUUoWuC61yc

https://www.youtube.com/watch?v=lRefZf3gj74

https://www.youtube.com/watch?v=ScpArF2H3wM

https://www.youtube.com/watch?v=Nc9yr4urskA

https://www.youtube.com/watch?v=4LZ0ZXBQABo

https://www.youtube.com/watch?v=EaOMdRm3q4I

https://www.youtube.com/watch?v=dM-5jEAfonc

https://www.youtube.com/watch?v=V6JU-v2nqRI

https://www.youtube.com/watch?v=7SDec1UCzJ4





Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on April 27, 2009, 06:31:25 pm
(http://i43.tinypic.com/dp7qqg.jpg)

LOL :L

Sick lol. :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on April 27, 2009, 08:21:03 pm
This with Jesus is hard lol :|

REMI Owns :L :L :L
youtube.com/nqtv ! :D
Title: Re: Funny Videos/Pictures
Post by: peddy on April 28, 2009, 01:22:10 pm
https://www.youtube.com/watch?v=mlJWwuV9eBw

:D xD
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 28, 2009, 01:50:02 pm
fuck hamilton  >:(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 28, 2009, 01:50:58 pm
fuck hamilton  >:(
:L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on April 28, 2009, 04:20:06 pm
Alonso FTW
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 28, 2009, 04:34:59 pm
new heineken commercial, the walking fridge :L

https://www.youtube.com/watch?v=K0d8sdGVVQc
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 28, 2009, 04:36:21 pm
looool, i think everyone would love it at home :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 28, 2009, 04:37:32 pm
yes i wanna order one :L
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 28, 2009, 04:43:12 pm
https://www.youtube.com/watch?v=ed4CHkN-Dkw
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 28, 2009, 04:48:05 pm
wow magnificent
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 28, 2009, 04:55:49 pm
https://www.youtube.com/watch?v=x_z1Icyu5gI
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 28, 2009, 04:57:01 pm
chinese girls look like man and have no tits :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 28, 2009, 04:58:14 pm
wtf :L :L :L :L :L :L :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 28, 2009, 05:04:33 pm
that was disturbing
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 28, 2009, 05:10:49 pm
https://www.youtube.com/watch?v=L8CWPPRPhIw

I LIKE POLSKI GIRLS!! :D :D :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 28, 2009, 07:47:29 pm
ugly shoes
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 28, 2009, 07:54:30 pm
I LIKE POLSKI GIRLS!! :D :D :D

*Polish
Title: Re: Funny Videos/Pictures
Post by: MadMax on April 28, 2009, 09:24:41 pm
lol only czech song i know
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 28, 2009, 10:17:43 pm
why can't girls act normal ffs, it's such a turn off when they act silly, just suck my cock and stfu!
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 28, 2009, 10:37:45 pm
girls havin fun ftw :P
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 28, 2009, 10:38:25 pm
there's normal then there's stupid ;_;
Title: Re: Funny Videos/Pictures
Post by: MadMax on April 28, 2009, 11:34:51 pm
https://www.youtube.com/watch?v=EXwpsaHueUk
lol finnish on foot, not in car
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 29, 2009, 01:51:44 pm
why can't girls act normal ffs, it's such a turn off when they act silly, just suck my cock and stfu!

^ init :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on April 30, 2009, 09:39:40 am
fuck hamilton  >:(

http://www.youtube.com/watch?v=RpUQY-zoFnE

lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 30, 2009, 01:14:15 pm
hamilton is such a dick
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 30, 2009, 05:19:23 pm
(http://i44.tinypic.com/a9sd3k.jpg)
:L

(http://i40.tinypic.com/106aezm.jpg)
:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 30, 2009, 05:25:29 pm
:L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 30, 2009, 05:58:58 pm
:L :L :L
:L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 01, 2009, 04:32:36 pm
(http://i39.tinypic.com/65dg85.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 01, 2009, 06:01:51 pm
rofl nice cycling path
Title: Re: Funny Videos/Pictures
Post by: [MAF]Rac3r on May 01, 2009, 06:08:27 pm
I fucking love Killerbunnies sig lol
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 01, 2009, 06:14:49 pm
Init, but girl could be with strings  ;D
Title: Re: Funny Videos/Pictures
Post by: some_punk on May 01, 2009, 06:19:17 pm
LOL @ racer XD
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 02, 2009, 02:25:37 am
who dont xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Rac3r on May 02, 2009, 04:50:09 am
Disturbed xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on May 02, 2009, 04:57:47 am
I like her too, love her tattoo near the ass
Title: Re: Funny Videos/Pictures
Post by: [MAF]Rac3r on May 02, 2009, 05:02:19 am
Nice observation Disturbed, I didn't even notice her tattoo.
I just love her boucing boobs lol
Title: Re: Funny Videos/Pictures
Post by: some_punk on May 02, 2009, 06:34:21 am
Disturbed xD
ROFLMAO!!! XD

_________________________

https://www.youtube.com/watch?v=VWORQkiFXuE

Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 02, 2009, 09:40:39 am
Nice commercial :L :L

https://www.youtube.com/watch?v=Ij2Xbu-XhCI
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 02, 2009, 09:49:04 am
orginal version is in french language :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 02, 2009, 11:04:35 am
LMAO :L :L :L
Title: Re: Funny Videos/Pictures
Post by: peddy on May 02, 2009, 05:30:48 pm
https://www.youtube.com/watch?v=5blbv4WFriM


https://www.youtube.com/watch?v=3eZBevXohCI


https://www.youtube.com/watch?v=UQqx5EsbSfY
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 02, 2009, 06:43:25 pm
lol
Title: Re: Funny Videos/Pictures
Post by: some_punk on May 02, 2009, 07:01:38 pm
https://www.youtube.com/watch?v=4dvxEXOCV7I
https://www.youtube.com/watch?v=c0186hRd-tY
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 02, 2009, 10:31:58 pm
this is from czech O2 advertisement
(http://img217.imageshack.us/img217/2205/35200901559.png)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 03, 2009, 12:21:55 am
m4lysz :o
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 03, 2009, 01:18:29 am
thats a fat cock  ;D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on May 05, 2009, 01:24:57 pm
(http://images43.fotosik.pl/118/39454c53df5c6a98m.jpg) (http://www.fotosik.pl/showFullSize.php?id=39454c53df5c6a98) Devil can you explain Us what this plate mean ?:D. It hangs over WC on my job lmao
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 05, 2009, 01:27:11 pm
ROFLMAO!!
in english : ''Love means helping each other.''
:L :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on May 05, 2009, 01:34:41 pm
Laska - mean "love"? nice but it in polish mean-" nice ,pretty, sexy, girl or woman", or walkingstick for old peoples xD :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 05, 2009, 01:42:30 pm
Laska - mean "love"? nice but it in polish mean-" nice ,pretty, sexy, girl or woman", or walkingstick for old peoples xD :D
lol :L
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 05, 2009, 03:57:32 pm
(http://listverse.com/wp-content/uploads/2009/01/marijuana-tm.jpg)
Title: Re: Funny Videos/Pictures
Post by: peddy on May 05, 2009, 04:08:29 pm
^  ;D


(http://images5.cafepress.com/product/264467515v11_350x350_Front_Color-Red.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 05, 2009, 04:21:41 pm
lool :L
Title: Re: Funny Videos/Pictures
Post by: some_punk on May 05, 2009, 06:39:38 pm
(http://i254.photobucket.com/albums/hh106/oi_vean/Mota.jpg?t=1241548745)
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 05, 2009, 07:09:21 pm
haha  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on May 05, 2009, 09:34:54 pm
(http://www.mundohamster.info/funnylol.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on May 06, 2009, 06:13:59 pm
(http://images50.fotosik.pl/119/b5c08f571fc3816bm.jpg) (http://www.fotosik.pl/showFullSize.php?id=b5c08f571fc3816b) my result :D in GRID. 10 laps on racing track in Nissan Silvia
Title: Re: Funny Videos/Pictures
Post by: peddy on May 06, 2009, 06:54:49 pm
michals avatar is great :D
Title: Re: Funny Videos/Pictures
Post by: some_punk on May 06, 2009, 10:59:09 pm
(http://i129.photobucket.com/albums/p238/one_me21/Mickey_Mouse_On_Pot.jpg?t=1241650250)
(http://www.authorstream.com/Content/Octavio-11464-Funny-images-music-Entertainment-ppt-powerpoint-118_88.jpg)
(http://i713.photobucket.com/albums/ww140/vavral2/funny/450-lavickaprohubene.jpg?t=1241650717)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 06, 2009, 11:19:26 pm
LOOL at that bench, i didn't read what was written beneath it and was thinking "haha against fat people" and then i read it and LOL it is against fat people xD
Title: Re: Funny Videos/Pictures
Post by: some_punk on May 07, 2009, 03:37:51 am
https://www.youtube.com/watch?v=fkFOVjFmZo0
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 07, 2009, 04:03:02 am
(http://img503.imageshack.us/img503/7192/666g.jpg) (http://img503.imageshack.us/my.php?image=666g.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on May 07, 2009, 06:23:10 am
5 AM LOL

:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 07, 2009, 09:16:31 am
nice number ;_;
Title: Re: Funny Videos/Pictures
Post by: D4nielleq on May 07, 2009, 09:17:26 am
http://www.youtube.com/user/D4nielleq (http://www.youtube.com/user/D4nielleq)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 07, 2009, 03:10:50 pm
(http://4.bp.blogspot.com/_Nd_IfLPxU0E/SRz5xrm75XI/AAAAAAAAAAg/k-34vSL6XfM/S1600-R/shutupandy_logo.JPG)

It even has its own website: www.shutupandy.com (http://www.shutupandy.com) :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 07, 2009, 06:39:55 pm
lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 07, 2009, 09:19:00 pm
you will need to feed andy to make him happy again ;_;
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 08, 2009, 05:41:29 am
https://www.youtube.com/watch?v=1b7DKQx5SCw
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on May 08, 2009, 05:52:17 am
roflmao
Title: Re: Funny Videos/Pictures
Post by: some_punk on May 08, 2009, 06:23:35 am
https://www.youtube.com/watch?v=HT9_O3X9Llc
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 08, 2009, 06:33:24 am
Quote from: YouTube
Embedding disabled by request

haha k bunnies got pwned
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 08, 2009, 08:41:01 am
Quote from: YouTube
Embedding disabled by request

haha k bunnies got pwned
yeah  :-[ :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 08, 2009, 09:15:23 am
argh fucking youtube  >:(
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 08, 2009, 09:17:29 am
i want the youtube from back in the days again :(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 08, 2009, 09:53:01 am
https://www.youtube.com/watch?v=FJ5iQKLIr3g
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 08, 2009, 11:27:03 am
https://www.youtube.com/watch?v=Lrk6vsb77xk

https://www.youtube.com/watch?v=0Uc4Ksz3nHM

https://www.youtube.com/watch?v=YfZDtC9kjVk
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 09, 2009, 02:03:15 pm
(http://i43.tinypic.com/2mg5beq.jpg)

(http://i44.tinypic.com/14c5lb6.jpg)

(http://i41.tinypic.com/308a5wy.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 09, 2009, 02:10:09 pm
looooooooool :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 09, 2009, 02:11:33 pm
rofl at the emo lemon
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 09, 2009, 03:30:28 pm
hollywood lol  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 11, 2009, 01:55:57 am
https://www.youtube.com/watch?v=1b7DKQx5SCw
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on May 11, 2009, 04:43:58 am
Snoopy where did u find it :D ( too many free time ?:D) It's crazy man " la laa la laaaa" :D
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 11, 2009, 04:47:31 am
(http://files.uploadffs.com/b/99dbb997/sprzet.JPG)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 11, 2009, 07:35:26 am
nice :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 11, 2009, 08:41:29 am
Snoopy where did u find it :D ( too many free time ?:D) It's crazy man " la laa la laaaa" :D
he found it at http://forum.adrenalinex.co.uk/index.php/topic,362.msg12636.html#msg12636 ;_;
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 11, 2009, 11:50:57 am
https://www.youtube.com/watch?v=1b7DKQx5SCw

cool man  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 11, 2009, 01:56:32 pm
Snoopy where did u find it :D ( too many free time ?:D) It's crazy man " la laa la laaaa" :D
he found it at http://forum.adrenalinex.co.uk/index.php/topic,362.msg12636.html#msg12636 ;_;

well it was so nice, it had to be posted twice ;_;





https://www.youtube.com/watch?v=UwjplOzC4d8
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 11, 2009, 02:40:48 pm
crazy cat!!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 11, 2009, 02:43:35 pm
LOL @ the cat !
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 11, 2009, 02:58:45 pm
He's sais: What are you looking at ? Huh ? Wanna get a punch ? :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 11, 2009, 03:23:20 pm
nice cat :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on May 11, 2009, 04:43:20 pm
(http://files.uploadffs.com/b/99dbb997/sprzet.JPG)

(http://i34.tinypic.com/9xnb.gif)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 11, 2009, 07:17:36 pm
Lol, check this out http://www.take40.com/artists/photo-galleries/16224/rihanna-nude-photo-scandal!--/
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 11, 2009, 07:53:44 pm
ohhh shit i'd like to stick my dick into here  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 11, 2009, 08:25:53 pm
what dick  ???  ???  ???  ???  ???
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 11, 2009, 08:59:55 pm
lol  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 11, 2009, 09:06:34 pm
what dick  ???  ???  ???  ???  ???
(http://www.barringtonstoke.co.uk/images/partnumber/enlarged/%7B7C3542B9-F37A-4BD6-ADEE-7CEC67A78D50%7D_Dick%20Turpin.JPG)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 11, 2009, 11:06:26 pm
legends and lies haha :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 12, 2009, 01:37:55 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 12, 2009, 01:38:44 pm
(http://i42.tinypic.com/2cxjllw.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 12, 2009, 01:41:12 pm
lool
btw Hledá se pes means Looking for the dog
:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 12, 2009, 01:47:45 pm
(http://i43.tinypic.com/24wh89s.jpg)
:L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 12, 2009, 02:06:46 pm
Haha i can see same thing everyday :L :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 12, 2009, 02:35:22 pm
ahaha drunk sleeping ftw
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 12, 2009, 03:07:40 pm
special for ush xD
(http://i41.tinypic.com/2mpamns.jpg)
(http://i42.tinypic.com/29ogxa1.jpg)
(http://i44.tinypic.com/nbr7o0.jpg)
:L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on May 12, 2009, 03:15:05 pm
yeah me2, ordinary view in Poland :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 12, 2009, 03:16:04 pm
check this http://piv.pivpiv.dk/ (http://piv.pivpiv.dk/)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 12, 2009, 03:21:03 pm
https://www.youtube.com/watch?v=N0uddWzK61c

hahah this looks like failed mafia liquidation:
https://www.youtube.com/watch?v=N150KoCr2pM
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 12, 2009, 03:26:59 pm
haha, that guy in the first video speaks czech :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 12, 2009, 03:31:36 pm
it was devil on the road practising for SAMP but he lag rammed dumper :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 12, 2009, 03:36:56 pm
lol that car is very similiar to my old teacher's one, she was stupid cow so this is probably her lag :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 12, 2009, 04:00:19 pm
last for today :L
(http://i44.tinypic.com/2woxich.jpg)
(http://i44.tinypic.com/2ro58ue.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 12, 2009, 05:08:13 pm
LOLETE  :D

ok link doesnt wanna work so click it: http://www.dumpert.nl/mediabase/497951/14a269ec/kodak_momentje.html
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 12, 2009, 05:15:23 pm
hahaha :L :L :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 12, 2009, 05:20:16 pm
devil see this: http://www.dumpert.nl/mediabase/497761/1ab4b458/pfff._even_bijkomen.html
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 12, 2009, 05:25:17 pm
lol
(http://i40.tinypic.com/34hxgfq.jpg)
Title: Re: Funny Videos/Pictures
Post by: Lewis on May 12, 2009, 05:34:33 pm
LoL Ush i know place in video with drunk (or something) guy  :D
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on May 12, 2009, 05:43:25 pm
devil see this: http://www.dumpert.nl/mediabase/497761/1ab4b458/pfff._even_bijkomen.html
Is that you Ush on video?  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 12, 2009, 05:52:12 pm
(http://i41.tinypic.com/352hpja.jpg)

lool
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 12, 2009, 05:55:13 pm
devil see this: http://www.dumpert.nl/mediabase/497761/1ab4b458/pfff._even_bijkomen.html
Is that you Ush on video?  ;D

ahaha noo luckely not  :D
Title: Re: Funny Videos/Pictures
Post by: peddy on May 12, 2009, 07:13:42 pm
https://www.youtube.com/watch?v=nQmm6IGN8ds

lol funny bug xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 12, 2009, 08:19:08 pm
(http://i39.tinypic.com/2v98560.jpg)
(http://i44.tinypic.com/2vi347k.jpg)
(http://i42.tinypic.com/23wmzao.jpg)
Title: Re: Funny Videos/Pictures
Post by: Lewis on May 12, 2009, 08:29:05 pm
(http://failblog.files.wordpress.com/2009/02/fail-owned-my-first-fail.jpg?w=500&h=375)
(http://failblog.files.wordpress.com/2009/04/fail-owned-playground-area-fail.jpg?w=500&h=423)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 12, 2009, 08:30:51 pm
nice playground :L




(http://tinypic.com/view.php?pic=2wfjupc&s=5)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 12, 2009, 08:40:12 pm
it's so popular. i heard people are dying to get in ;_;
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 12, 2009, 08:41:32 pm
nice playground :L

emo playground
Title: Re: Funny Videos/Pictures
Post by: Thrasher on May 13, 2009, 01:39:52 am
(http://i2.photobucket.com/albums/y3/MetalThrashingMad/l_0903b629be24cecf35fb1675a451b37c.jpg)

(http://i2.photobucket.com/albums/y3/MetalThrashingMad/toomanyhappymealsthumbki3.jpg)

(http://i2.photobucket.com/albums/y3/MetalThrashingMad/sandiskxdhr.jpg)

(http://i2.photobucket.com/albums/y3/MetalThrashingMad/l_f6531edf34a74cf9204a168266194297.jpg)

(http://i2.photobucket.com/albums/y3/MetalThrashingMad/CarRedundancy.jpg)

(http://i2.photobucket.com/albums/y3/MetalThrashingMad/image024.jpg)

(http://i2.photobucket.com/albums/y3/MetalThrashingMad/loool.jpg)

Knutico  :D

(http://i2.photobucket.com/albums/y3/MetalThrashingMad/fatkid.jpg)

(http://i2.photobucket.com/albums/y3/MetalThrashingMad/LOL-1.jpg)

(http://i2.photobucket.com/albums/y3/MetalThrashingMad/some-old-guy.jpg)

Only metal heads would get this one:

(http://i2.photobucket.com/albums/y3/MetalThrashingMad/kvlt1.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 13, 2009, 02:08:12 am


Knutico  :D

(http://i2.photobucket.com/albums/y3/MetalThrashingMad/fatkid.jpg)


HAHAHAHHAHAHAHAHHAHAHAHHAHAHAHAHHA :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 13, 2009, 08:43:29 am
loooooool
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 13, 2009, 10:41:35 am
(http://i39.tinypic.com/32ztglc.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 13, 2009, 10:48:55 am
thx cysio i really gotta poo, but why 3 hours of walking for it :(
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 13, 2009, 11:31:26 am
(http://files.uploadffs.com/b/1750b4e4/funny_images_318.gif)
(http://files.uploadffs.com/9/cab59ba6/stupid_pictures120.gif)
(http://files.uploadffs.com/3/189232d9/stupid_pictures124.jpg)
(http://files.uploadffs.com/d/fac3dc75/stupid_pictures145.jpg)
(http://files.uploadffs.com/6/c5de6715/stupid_pictures207.jpg)
(http://files.uploadffs.com/a/53a2a081/stupid_pictures225.jpg)
(http://files.uploadffs.com/e/c884e643/stupid_pictures235.gif)
(http://files.uploadffs.com/6/bca464db/stupid_pictures237.jpg)
(http://files.uploadffs.com/d/342ddfc8/stupid_pictures239.jpg)
(http://files.uploadffs.com/d/0e3dd82c/stupid_pictures242.jpg)
(http://files.uploadffs.com/8/dfce8674/stupid_pictures313.gif)
(http://files.uploadffs.com/5/6ddd5e3b/stupid_pictures321.gif)
(http://files.uploadffs.com/0/33de0317/stupid_pictures322.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 13, 2009, 02:14:07 pm
lol @ the giant bra :L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on May 13, 2009, 07:25:11 pm
Mmmmm hot (bull)dogs :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 14, 2009, 11:33:37 am
(http://www.demotivateus.com/posters/myspace-next-time-you-try-to-look-hot-flush-the-toilet-demotivational-poster.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 14, 2009, 11:36:33 am
looool that is a big fail xD and very disgusting :o
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 14, 2009, 12:56:25 pm
omg shes so fu...in  ugly xD
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 14, 2009, 01:34:40 pm
A shit  :o :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 14, 2009, 01:37:47 pm
omg blah (http://smilies.vidahost.com/otn/blobs/grn_md_wht.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 14, 2009, 01:39:50 pm
;_; (http://smilies.vidahost.com/otn/blobs/grn_md_wht.gif) ;_;
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 14, 2009, 01:44:05 pm
(http://smilies.vidahost.com/otn/blobs/orng_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/peach_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/gry_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/gld_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/trq_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/blu_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/grn_md_wht.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 14, 2009, 01:46:59 pm
;_; (http://smilies.vidahost.com/otn/blobs/orng_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/peach_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/gry_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/gld_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/trq_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/blu_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/grn_md_wht.gif) ;_;
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 14, 2009, 01:49:47 pm
(http://i40.tinypic.com/282j8za.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 14, 2009, 01:55:07 pm
haha  ;D
:L ;_; (http://smilies.vidahost.com/otn/blobs/orng_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/peach_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/gry_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/gld_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/trq_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/blu_md_wht.gif)(http://smilies.vidahost.com/otn/blobs/grn_md_wht.gif) ;_; :L
Title: Re: Funny Videos/Pictures
Post by: Thrasher on May 14, 2009, 06:14:48 pm
(http://i40.tinypic.com/282j8za.jpg)
lol those things are huge, she probably wishes they stuck straight out  :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 14, 2009, 06:50:59 pm
hahah penis-tree :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 14, 2009, 06:57:07 pm
:L
Title: Re: Funny Videos/Pictures
Post by: Thrasher on May 14, 2009, 07:00:03 pm
(http://www.angelfire.com/ca6/tomswebpage/penisrock.jpg)

(http://www.angelfire.com/ca6/tomswebpage/cactus.jpg)

(http://www.marydiamond.com/photogallery/PenisTree2.jpg)

WTF is this thing  :D

(http://www.myconfinedspace.com/wp-content/uploads/2007/06/tree.jpg)
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 14, 2009, 07:01:00 pm
hahaha  ;D
(http://files.uploadffs.com/1/5b0a18a0/drzewo_cipa.jpg)
(http://sopcloud.com/sopclan/images/photoalbum/funny_tree_penis8022.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 14, 2009, 07:28:27 pm
hahaha  ;D
(http://sopcloud.com/sopclan/images/photoalbum/funny_tree_penis8022.jpg)

lmao  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 14, 2009, 08:57:43 pm
(http://sweisthal.com/db3/00265/sweisthal.com/_uimages/PussyTreeN.Y..jpg)
Title: Re: Funny Videos/Pictures
Post by: Lewis on May 14, 2009, 09:23:53 pm
trees can be ugly  :o
Title: Re: Funny Videos/Pictures
Post by: ivanduk on May 14, 2009, 09:41:40 pm
(http://s54.photobucket.com/albums/g115/hootie39/gotcomments/userpics/funny/penis-tree.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 14, 2009, 10:04:20 pm
trees can be ugly  :o
yea ugly trees :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 15, 2009, 09:18:21 am
(http://i40.tinypic.com/2ut47ip.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 15, 2009, 10:01:22 am
lol :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 15, 2009, 10:04:40 am
https://www.youtube.com/watch?v=XjQo8bW94Gs
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 15, 2009, 10:54:01 am
haha nice :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 16, 2009, 11:42:47 am
(http://img31.imageshack.us/img31/9233/129027original8v0lc.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 16, 2009, 11:57:01 am
I suppose to laugh ? :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 16, 2009, 12:33:16 pm
I suppose to laugh ? :L
u just did it ^^
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 16, 2009, 12:44:13 pm
(http://i39.tinypic.com/jqns03.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 16, 2009, 01:56:50 pm
(http://i40.tinypic.com/2czadt0.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 16, 2009, 02:02:55 pm
haha nice :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 16, 2009, 02:06:55 pm
:L
(http://i40.tinypic.com/2ymhxm0.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 16, 2009, 02:13:00 pm
(http://i39.tinypic.com/6rilon.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 16, 2009, 03:19:48 pm
knutico drawing mike with tits while banned :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on May 16, 2009, 03:38:01 pm
OWNED XDDDDDDDDDDDDD
https://www.youtube.com/watch?v=kMZu7lpJr6M
Title: Re: Funny Videos/Pictures
Post by: MadMax on May 16, 2009, 04:09:23 pm
lol fajny pies
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 16, 2009, 05:04:31 pm
hahaha poor dog :P

We all have that once in a period when we dream while getting awake xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 16, 2009, 09:56:28 pm
(http://i43.tinypic.com/2edbaqp.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 16, 2009, 09:57:42 pm
lol poor people in that bus ^^

(http://i40.tinypic.com/a9vcdx.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 16, 2009, 10:04:23 pm
fresh morning :L

(http://i41.tinypic.com/4h9ibl.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 16, 2009, 10:10:45 pm
:L
(http://i43.tinypic.com/fypoqt.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 16, 2009, 10:19:41 pm
lol
i dont want know what is normal toilet in that country :L
Title: Re: Funny Videos/Pictures
Post by: some_punk on May 17, 2009, 04:32:19 am
https://www.youtube.com/watch?v=PlvtI0WBrHY
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 17, 2009, 05:37:42 am
nice video :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 17, 2009, 08:46:16 am
lol
i dont want know what is normal toilet in that country :L

a hole in the ground lol ;_;
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 17, 2009, 09:34:03 am
lol
i dont want know what is normal toilet in that country :L

a hole in the ground lol ;_;
maybe something like this
(http://i42.tinypic.com/xp4sh5.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 17, 2009, 01:10:23 pm
(http://i43.tinypic.com/2edbaqp.jpg)
super gt bus :L
Title: Re: Funny Videos/Pictures
Post by: Thrasher on May 17, 2009, 02:08:28 pm
super gt bus :L
YES! LOOOL!!!

btw who is this girl in your avatar? I like the way her left tittie bounces when she picks up her shirt  :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 17, 2009, 03:29:48 pm
(http://i43.tinypic.com/2edbaqp.jpg)
super gt bus :L

Good one, moo !! :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 17, 2009, 03:51:40 pm
super gt bus :L
YES! LOOOL!!!

btw who is this girl in your avatar? I like the way her left tittie bounces when she picks up her shirt  :D
dunno :L i call her adrenalinex girl :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 18, 2009, 12:16:59 am
mooman's sister :(
Title: Re: Funny Videos/Pictures
Post by: some_punk on May 18, 2009, 04:25:51 am
(http://newmedia.funnyjunk.com/pictures/sexy_man.jpg)

GAY CARTER

(http://newmedia.funnyjunk.com/pictures/womandriver.jpg)

CAR FOR WOMEN

(http://newmedia.funnyjunk.com/pictures/0546.jpg)

DOCTOR ON RACE

(http://newmedia.funnyjunk.com/pictures/baddesign.jpg)

LOL

(http://newmedia.funnyjunk.com/pictures/water_owned.jpg)

(http://newmedia.funnyjunk.com/pictures/dildo_dog.jpg)

Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 18, 2009, 07:13:31 am
(http://img41.imageshack.us/img41/4023/newbitmapimagev.jpg) (http://img41.imageshack.us/my.php?image=newbitmapimagev.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 18, 2009, 07:19:59 am
lol

Kid playing guitar hero

https://www.youtube.com/watch?v=kezrztP9Vg8
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 19, 2009, 12:42:19 pm
:L :L :L
Quote
(http://forum.adrenalinex.co.uk/index.php?action=dlattach;attach=509;type=avatar)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 19, 2009, 12:43:46 pm
cheese grater slide :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 19, 2009, 12:44:21 pm
cheese grater slide :L
ouch :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 19, 2009, 12:51:37 pm
(http://img2.imageshack.us/img2/714/chinesecheesegraterslid.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 19, 2009, 01:13:51 pm
poor boy  :'(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 19, 2009, 01:15:05 pm
he got sliced into little pieces :(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 19, 2009, 01:15:21 pm
(http://i40.tinypic.com/28chbnc.jpg)
(http://i39.tinypic.com/2aetto0.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 19, 2009, 01:17:34 pm
(http://i40.tinypic.com/28chbnc.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 19, 2009, 01:29:36 pm
(http://img2.imageshack.us/img2/714/chinesecheesegraterslid.jpg)

Haha, he won't be as he was before sliding here :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on May 19, 2009, 06:11:39 pm
Yestarday I saw this situation on my street :D "woman in the car"(http://images38.fotosik.pl/123/63b5a4a9cca27e8bm.jpg) (http://www.fotosik.pl/showFullSize.php?id=63b5a4a9cca27e8b)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 19, 2009, 07:53:10 pm
Haha chinese quality :L

https://www.youtube.com/watch?v=g5SRyG6UR2A
Title: Re: Funny Videos/Pictures
Post by: MadMax on May 19, 2009, 08:00:09 pm
American quality 8)
https://www.youtube.com/watch?v=lG7Yx9hmJ1g
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 20, 2009, 12:20:43 am
Arabian quality ;_;

https://www.youtube.com/watch?v=bWax-G1AlvA
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on May 20, 2009, 05:33:39 am
Haha chinese quality :L
This car is "Chery Amulet" :D based on Seat Toledo 1st generation 1991-99, but chinese used cheap and worst material on the world :D

Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 20, 2009, 12:55:07 pm
Arabian quality ;_;

http://www.youtube.com/watch?v=bWax-G1AlvA
omg thats insane  lol :o
:L
Title: Re: Funny Videos/Pictures
Post by: MadMax on May 20, 2009, 03:24:10 pm
sick, videoclip in excel LOL
https://www.youtube.com/watch?v=h9_YkXHCkgA
lol
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Phil_Ivey on May 20, 2009, 06:42:24 pm
https://www.youtube.com/watch?v=kwfeHb6UdjM
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 20, 2009, 07:55:24 pm
https://www.youtube.com/watch?v=kwfeHb6UdjM
hahahahahahaha nice video :L :L :L
3:53 WTF xDDDDD
Title: Re: Funny Videos/Pictures
Post by: ivanduk on May 20, 2009, 08:43:59 pm
https://www.youtube.com/watch?v=YPQ_N4imYVE
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 21, 2009, 01:28:24 pm
https://www.youtube.com/watch?v=sfkDxF2kn1I
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 21, 2009, 01:47:08 pm
:L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on May 21, 2009, 01:48:09 pm
https://www.youtube.com/watch?v=T5nwfPKFGio
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 21, 2009, 01:56:01 pm
https://www.youtube.com/watch?v=sfkDxF2kn1I

Im left only with... my shitty N64 :L :L :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on May 22, 2009, 12:36:16 pm
devil, what this mean ?
(http://obczaj.net/obrazki/58485.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 22, 2009, 12:37:52 pm
loool it says debil :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 22, 2009, 12:50:15 pm
devil, what this mean ?
I DRIVE LIKE A DEBIL SINCE 1/7/2006
It's not me who drives, but a person near me that got out of the car and ran away.
Title: Re: Funny Videos/Pictures
Post by: ivanduk on May 22, 2009, 01:54:47 pm
(http://www.popgadget.net/images/Duck%20Fadar%20leuchtend%20k_tb.jpg)

Duck Vader
Title: Re: Funny Videos/Pictures
Post by: MadMax on May 22, 2009, 03:24:59 pm
now we can know how is computer mouse made of ;D
(http://obczaj.net/obrazki/58518.jpg)

Elegant - Buick Roadmasterkiller
(http://obczaj.net/obrazki/58523.jpg)

russia tuning  ;D
(http://obczaj.net/obrazki/58528.jpg)

cheap GPS (almost) ;D
(http://obczaj.net/obrazki/58509.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 22, 2009, 03:56:03 pm
Oh deer :(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 22, 2009, 08:29:22 pm
that car doesnt look like elegant
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 22, 2009, 08:34:07 pm
that car doesnt look like elegant

What happend max, got owned ? Haha  >:(
Title: Re: Funny Videos/Pictures
Post by: ivanduk on May 22, 2009, 08:36:09 pm
That's not a real deed..
Title: Re: Funny Videos/Pictures
Post by: MadMax on May 23, 2009, 10:10:42 am
that car doesnt look like elegant
it is dev, look

Buick Roadmaster
(http://www.autocarparts.com/images/products/buick/roadmaster.jpg)
(http://ruckerautosales.com/auto/images/1/471878.jpg)
(http://www.carcollectorclassifieds.com/ccselect/uploads/internetpics/Fas0907107001-1-005.jpg)
(http://cokupic.pl/i/om_big6906927.jpg)
(http://www.analogstereo.com/images/om/buick_roadmaster.jpg)

Elegant
(http://www.gtagaming.com/images/sanandreas/cars/Elegant%20copy.jpg)
(http://www.gtagaming.com/images/sanandreas/cars/Elegant%20(rear)%20copy.jpg)

Yeah, I'm cars freak...

have i right (left, top, bottom, middle, side,etc... :D) ?
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 23, 2009, 11:30:07 am
Quote
Funny Videos/Pictures
;_;
Title: Re: Funny Videos/Pictures
Post by: MadMax on May 23, 2009, 02:47:07 pm
yea It is funny, /me is car freak...
^this is funny^
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 23, 2009, 03:02:15 pm
Ruick Roadmaster


ruick? rick? isnt it supposed to be buick? :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 23, 2009, 03:03:50 pm
Rick Roadmaster :(
Title: Re: Funny Videos/Pictures
Post by: MadMax on May 23, 2009, 03:21:38 pm
now is correct, thanks for 'catch' this mistake
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 23, 2009, 06:59:27 pm
https://www.youtube.com/watch?v=_CQ152n3MIs
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 23, 2009, 07:01:59 pm
Not funny  :o
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 23, 2009, 07:10:18 pm
i heard that guy got really injured. mustve really hurt :(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 23, 2009, 07:11:10 pm
excuse me while i laugh :L :L :L  :-X
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 23, 2009, 07:19:44 pm
excuse me while i laugh :L :L :L  :-X
lol

https://www.youtube.com/watch?v=KXN9Z4Whksk
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 23, 2009, 07:33:25 pm
I bet everyone have already seen it, but never mind :L

120,108,429 views !

https://www.youtube.com/watch?v=dMH0bHeiRNg
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on May 24, 2009, 01:38:46 am
awesome XD
Title: Re: Funny Videos/Pictures
Post by: Thrasher on May 25, 2009, 12:21:12 am
(http://img22.imageshack.us/img22/5854/pic11hl.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 25, 2009, 01:00:30 am
(http://img37.imageshack.us/img37/5091/n81563694012720047783.jpg)

(http://img37.imageshack.us/img37/1926/fbxbxfbcfb.jpg)

(http://img37.imageshack.us/img37/7518/hahahahahah.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on May 25, 2009, 02:21:52 am
(http://img35.imageshack.us/img35/3590/71522581.jpg) (http://img35.imageshack.us/my.php?image=71522581.jpg)

(http://img196.imageshack.us/img196/2294/1021534.jpg) (http://img196.imageshack.us/my.php?image=1021534.jpg)
Title: Re: Funny Videos/Pictures
Post by: Thrasher on May 25, 2009, 02:42:59 am
hahaha!! Where is this bathroom? I like the girl with the tape measure  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 25, 2009, 02:45:29 am
chris price - stop the bus

(http://img29.imageshack.us/img29/540/stopthatbusiwantsomebee.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 25, 2009, 01:36:14 pm
(http://img22.imageshack.us/img22/5854/pic11hl.jpg)

Guy sucking to other guy ? :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 25, 2009, 04:04:41 pm
(http://files.uploadffs.com/9/f33792fe/1241379902821.gif)
(http://files.uploadffs.com/6/b98b60a5/todaywasagoodday.jpg) (http://files.uploadffs.com/6/b98b60a5/todaywasagoodday.jpg)
(http://files.uploadffs.com/0/7ea00cc5/mindcontrol.gif)
(http://files.uploadffs.com/a/3fd7a5ee/toiletseat.jpg)
(http://files.uploadffs.com/1/ceed1705/1237851795461.jpg)
(http://files.uploadffs.com/a/5c1aa0a4/1237750420495.jpg)
(http://files.uploadffs.com/3/60b93d5c/1237749301864.gif)
(http://files.uploadffs.com/c/b661c434/1237631647521.jpg)
(http://files.uploadffs.com/3/912f3802/1237521206156.jpg)
(http://files.uploadffs.com/0/3b550d5e/1235709313525.jpg) (http://files.uploadffs.com/0/3b550d5e/1235709313525.jpg)
(http://files.uploadffs.com/6/39a069e6/sittingbear.jpg)
(http://files.uploadffs.com/2/940c2d92/featherbottom.gif)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 25, 2009, 08:11:12 pm
Ouch !!  ;D

https://www.youtube.com/watch?v=LbOTffTBQPk
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 25, 2009, 08:25:39 pm
your pictures are the best moo  ;D ;D
''The story of Oedipus'' HAHAHAHA :L :L
Title: Re: Funny Videos/Pictures
Post by: PonyBoy on May 25, 2009, 10:28:59 pm
??? Yoooo,How do you post the video right on here? Thanks.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 25, 2009, 10:43:11 pm
ctrl v
Title: Re: Funny Videos/Pictures...Elvis forgets the words
Post by: PonyBoy on May 25, 2009, 11:28:37 pm
Stone and drunk :D Please watch the whole video http://www.youtube.com/watch?v=hr8VEcbSw48 I forgot to add this video too. Too Live Or Not To Live: That Is The Question. http://www.youtube.com/watch?v=g26cIojkwug  :-\
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 25, 2009, 11:39:51 pm
poor elvis, he was actually crying  :(
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 26, 2009, 12:16:05 am
The Ice Cube chart was nice moo :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 26, 2009, 02:26:48 am
it's not very funny but oh well :L gta2 ftw

(http://img35.imageshack.us/img35/1222/lolkfk.jpg)
Title: Re: Funny Videos/Pictures
Post by: PonyBoy on May 26, 2009, 07:10:28 am
it's not very funny but oh well :L gta2 ftw
                               Haha very cool  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 26, 2009, 09:10:47 am
That's cool :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 26, 2009, 10:26:03 am
I love this :L :L :L

https://www.youtube.com/watch?v=R4l8epXHneI
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Phil_Ivey on May 26, 2009, 01:07:03 pm
https://www.youtube.com/watch?v=_AJ0SkbPxAk

https://www.youtube.com/watch?v=EuAVgWJ28Hw
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 26, 2009, 01:21:59 pm
Haha great ones :L :L

-Mornin
-Good day to you ser.
-Hey, wait a minute, what a hell ! :L
Title: Re: Check this Bike out...
Post by: PonyBoy on May 26, 2009, 05:45:59 pm
KTM Biggest motorcycle :o  (http://img11.imageshack.us/img11/7274/biggestmotorcyclex.jpg) (http://img11.imageshack.us/my.php?image=biggestmotorcyclex.jpg) and this-2009 AERO EV 1,000 HP FASTEST ELECTRIC EVER (http://img527.imageshack.us/img527/1859/2009ultimateaero.jpg) (http://img527.imageshack.us/my.php?image=2009ultimateaero.jpg)
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on May 26, 2009, 07:40:34 pm
I went to the annual Gloucester Cheese Rolling thing yesterday and it was top fun. The video's i got were shit, but there are loads on youtube:

http://www.youtube.com/results?search_type=&search_query=cheese+rolling&aq=f

It is even more mental in real life, the hill is stupidly steep!!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 26, 2009, 07:46:29 pm
crazy :L :L
Title: Re: Funny Videos/Pictures
Post by: some_punk on May 27, 2009, 12:44:30 am
(http://www.shuandjoe.com/blogpics/Dave_tuzki.jpg)

https://www.youtube.com/watch?v=Pi_tH7bMBzs
Title: Re: Funny Videos/Pictures
Post by: KTM_Racing on May 27, 2009, 04:20:45 pm
its my KTM pony !!! xDDD

(http://www.uncrate.com/men/images/2007/05/ktm-x-bow.jpg)
(http://allworldcars.com/wordpress/wp-content/uploads/2007/05/ktm-x-bow.jpg)
(http://www.automotivetraveler.com/images/stories/easygallery/resized/131/1228497804_KTM_Orange-Black_Car.jpg)
its mini car :D
but my motobike is this ------->
(http://www.jdk.com.au/Photos/Ebay07/KTM125SX98.jpg)
xDDD
Title: Re: Funny Videos/Pictures
Post by: PonyBoy on May 27, 2009, 05:24:28 pm


but my motobike is this ------->
(http://www.jdk.com.au/Photos/Ebay07/KTM125SX98.jpg)
(http://www.freesmileys.org/smileys/big/big-smiley-003.gif) (http://www.freesmileys.org)
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 27, 2009, 08:21:35 pm
(http://files.uploadffs.com/6/27d36fda/LSD.bmp)
Title: Re: Funny Videos/Pictures
Post by: MadMax on May 27, 2009, 08:42:42 pm
lol where you get it ?
from gta3.IMG ?
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 27, 2009, 11:17:56 pm
ye
Title: Re: Funny Videos/Pictures
Post by: KTM_Racing on May 28, 2009, 08:03:04 am


but my motobike is this ------->
(http://www.jdk.com.au/Photos/Ebay07/KTM125SX98.jpg)
(http://www.freesmileys.org/smileys/big/big-smiley-003.gif) (http://www.freesmileys.org)
what ? :DDD
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 28, 2009, 08:32:06 pm
(http://fsb.zedge.net/content/7/7/2/6/1-1229972-7726-t.jpg)

:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 29, 2009, 07:15:09 am
lol :L
cool pic
Title: Re: Funny Videos/Pictures
Post by: MadMax on May 29, 2009, 03:11:40 pm
LOL LMAO ROFL OMG WTF
https://www.youtube.com/watch?v=OO6H8NFdYQ8
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 29, 2009, 03:18:43 pm
I wouldn't use caps and bold text for my comment on that video, it ain't that funny. Just a kid who fails :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 29, 2009, 10:45:20 pm
https://www.youtube.com/watch?v=DzMfnq_M97Q


Ding-a-ling-ling-ling-ling-ling-ling-ling!

Boo-ba-doo-ba-doop!
Boo-ba-doo-ba-doop!

Ring ring ring ring ring ring ring banana phone
Ring ring ring ring ring ring ring banana phone
I've got this feeling, so appealing,
for us to get together and sing. Sing!

Ring ring ring ring ring ring ring banana phone
Ding dong ding dong ding dong ding donana phone
It grows in bunches, I've got my hunches,
It's the best! Beats the rest!
Cellular, Modular, Interactivodular!

Ring ring ring ring ring ring ring banana phone
Boop-boo-ba-doo-ba-doop!
Ping pong ping pong ping pong ping panana phone
It's no baloney, it ain't a p(h)ony
My cellular bananular phone!

Don't need quarters, don't need dimes,
to call a friend of mine!
Don't need computer or TV,
[ Find more Lyrics on www.mp3lyrics.org/ES ]
to have a real good time!
I'll call for pizza. I'll call my cat.
I'll call the white house, have a chat!
I'll place a call around the world, operator get me Beijing
-jing-jing-jing!

(Soprano Sax Solo)
Yeah!

Play that thing!
(Piano Solo)

Whooo Hooo!

Ring ring ring ring ring ring ring banana phone
Boop-boo-ba-doo-ba-doop
Yin yang yin yang yin yang ying yonana phone
It's a real live mama and papa phone,
a brother and sister and a dogaphone,
a grandpa phone and a grammophone too! Oh Yeah!
My cellular, bananular phone!

Banana phone, ring ring ring!
(It's a phone with a peel!)
Banana phone, ring ring ring!
(Now you can have your phone and eat it too!)
Banana phone, ring ring ring!
(This song drives me, Bananas!)
Banana phone, ring ring ring!
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 30, 2009, 12:38:44 am
Epic :L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on May 30, 2009, 07:54:43 am
https://www.youtube.com/watch?v=HbPDKHXWlLQ
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 30, 2009, 08:51:30 am
Ring ring ring ring ring ring ring banana phone!


(http://files.uploadffs.com/a/589ca78a/gmix_banana_phone.jpg)


HAHAHAH     :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 31, 2009, 03:18:25 pm
https://www.youtube.com/watch?v=LDyXdAf3LR0


The monkey goes "My cock" !!! :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Al3X on May 31, 2009, 04:39:25 pm
^ i love family guy :D
Title: Re: Funny Videos/Pictures
Post by: MadMax on May 31, 2009, 07:33:54 pm
some ppl don't like Sabre
https://www.youtube.com/watch?v=YlZ03B1fpVE
Title: Re: Funny Videos/Pictures
Post by: BlueStar on May 31, 2009, 08:03:21 pm
some ppl don't like Sabre
https://www.youtube.com/watch?v=YlZ03B1fpVE
Who wouldn't like Sabre, all like it xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 31, 2009, 08:09:30 pm
cysio doesnt like it  :(
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 31, 2009, 08:51:20 pm
Here it is, UK server. Is it R's house in this street ? :L

(http://img194.imageshack.us/img194/103/yoojpg.png)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 31, 2009, 10:43:30 pm
watch this   https://www.youtube.com/watch?v=rrO8AFGi_rc
 and this  https://www.youtube.com/watch?v=G5WLrvRJCIw
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on June 01, 2009, 01:41:47 am
Here it is, UK server. Is it R's house in this street ? :L

(http://img194.imageshack.us/img194/103/yoojpg.png)
that map isnt accurate. server is here: http://maps.google.co.uk/maps?f=q&source=s_q&hl=en&geocode=&q=SL6+2HP&sll=53.956086,-4.042969&sspn=24.476729,67.5&ie=UTF8&ll=51.499693,-0.709305&spn=0.006285,0.016479&t=h&z=17&iwloc=A
Title: Re: Funny Videos/Pictures
Post by: Thrasher on June 01, 2009, 02:23:06 am
watch this   https://www.youtube.com/watch?v=rrO8AFGi_rc
 and this  https://www.youtube.com/watch?v=G5WLrvRJCIw

(http://forum.adrenalinex.co.uk/Smileys/default/tRDvJjVtKsqb6zdWUBdiJt7emmc.gif)

You can watch the cow actually get owned in this one

https://www.youtube.com/watch?v=nieK4GHov-Y
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 01, 2009, 08:34:03 am
hahah yeh suicidal cows  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 01, 2009, 02:49:26 pm
poor cows   :(
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 05, 2009, 12:48:11 am
(http://obczaj.net/obrazki/61714.jpg)
(http://obczaj.net/obrazki/61677.jpg)
(http://obczaj.net/obrazki/61516.jpg)
(http://obczaj.net/obrazki/61505.jpg)
(http://obczaj.net/obrazki/61454.jpg)
(http://obczaj.net/obrazki/61458.jpg)
(http://obczaj.net/obrazki/61354.jpg)
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on June 05, 2009, 01:00:03 am
loool half price and star wars   ;D
and cool car body looks like carmageddon
(http://www.owned.com/Owned_Pictures/Darth_Vader_In_Online_Game_Scenario_Owned.jpg)
Title: Re: Funny Videos/Pictures
Post by: some_punk on June 05, 2009, 06:15:09 am
(http://hairstylequestions.com/wp-content/uploads/hairy-lady.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on June 05, 2009, 07:52:09 am
omg lol
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on June 05, 2009, 09:53:24 am
O.M.G!
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 05, 2009, 11:09:50 am
blegh (http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 05, 2009, 12:32:00 pm
(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 05, 2009, 12:48:45 pm
(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)(http://cache2.hyves-static.net/images/smilies/default/smiley_sick.gif)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 05, 2009, 01:58:14 pm
 :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 05, 2009, 02:03:11 pm
She's pretty nice... Shame on you guys.


Haha, JOKE !! :L :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 05, 2009, 03:15:43 pm
https://www.youtube.com/watch?v=HEbkCo5oZJ8
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on June 05, 2009, 03:38:55 pm
(http://www.uglypeople.se/images/pictures/700/700.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 05, 2009, 03:40:47 pm
(http://www.uglypeople.se/images/pictures/700/700.jpg)

Rita's girlfriend ? :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on June 05, 2009, 03:50:08 pm
it is man, girl or both? ??? ???
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 05, 2009, 04:03:05 pm
It's a girl stuffed with steroids :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 05, 2009, 04:13:50 pm
nice moustache  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on June 05, 2009, 05:07:58 pm
lol @ transvest
Title: Re: Funny Videos/Pictures
Post by: [MAF]Rac3r on June 05, 2009, 05:36:02 pm
Looks like it's addicted to hormone replacement tablets :L+
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 05, 2009, 05:37:09 pm
:L :L :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 05, 2009, 06:41:28 pm
We can't see her/his lower part of body... So it might be surprising :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 05, 2009, 07:43:46 pm
https://www.youtube.com/watch?v=XfEr_S9xtVY
cool and silly  :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 05, 2009, 08:17:25 pm
PUT IT IN YOUR ZAKJE!

Watch this comedy show, it's in english with dutch subtitles ;) Very funny.

https://www.youtube.com/watch?v=_t55EIwIaus
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on June 06, 2009, 02:06:06 am
https://www.youtube.com/watch?v=jqLDyXnNkF4
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 06, 2009, 08:01:16 am
lol :L
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on June 06, 2009, 09:56:33 am
Morning

(http://forum.adrenalinex.co.uk/Smileys/default/tRDvJjVtKsqb6zdWUBdiJt7emmc.gif)   "GHER"

(http://files.uploadffs.com/1/261a1aa0/squnk.JPG)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on June 06, 2009, 01:00:42 pm
lol you need to clean that pipe
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 06, 2009, 01:18:06 pm
i smoke just joints.. not with pipe.. but i wanna buy a pipe in the future :P

(http://i40.tinypic.com/282j8za.jpg)
lol those things are huge, she probably wishes they stuck straight out  :D

https://www.youtube.com/watch?v=X0rVtvcXjIM

hahaha  ;D
(http://files.uploadffs.com/1/5b0a18a0/drzewo_cipa.jpg)
(http://sopcloud.com/sopclan/images/photoalbum/funny_tree_penis8022.jpg)


https://www.youtube.com/watch?v=eOwKZ-F2xsI
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 06, 2009, 02:26:38 pm
saucepan head
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 06, 2009, 03:53:22 pm
wtf is this ?

(http://www.moparaction.com/Article/Schnapps/1.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 06, 2009, 03:55:21 pm
Well... Thats a stupid american, no offence.
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on June 06, 2009, 06:49:48 pm
I wonder if its legal to drive whatever that is
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 06, 2009, 09:37:04 pm
notice that car is Mercedes Benz.
Title: Re: Funny Videos/Pictures
Post by: ivanduk on June 06, 2009, 10:10:35 pm
this car can beat OverHauling  :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 06, 2009, 11:31:31 pm
notice that car is Mercedes Benz.

was*  :D
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on June 07, 2009, 12:21:37 am
Mirror's Edge  ;D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 07, 2009, 06:56:50 am
Well, it reminds me a car from "Ghost Busters" :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on June 07, 2009, 04:37:05 pm
(http://i42.tinypic.com/30w4kzr.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 07, 2009, 04:45:49 pm
lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on June 07, 2009, 06:43:31 pm
lol
https://www.youtube.com/watch?v=A85soTwdyUY
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 07, 2009, 07:02:06 pm
this is a future ;_;
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on June 10, 2009, 11:43:59 am
https://tv.rockstargames.com/videos/view/id/60AC8344B0911E28 (https://tv.rockstargames.com/videos/view/id/60AC8344B0911E28)

xDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD !!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on June 10, 2009, 01:40:01 pm
(http://i44.tinypic.com/wtjcir.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 10, 2009, 01:40:49 pm
:L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on June 10, 2009, 01:47:38 pm
these funny comics are on:
http://pbfcomics.com/
enjoy  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 10, 2009, 01:49:54 pm
lol
(http://pbfcomics.com/archive_b/PBF246-Bee.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on June 10, 2009, 01:52:40 pm
check this:
http://www.joemonster.org/filmy/7879/What-is-Love-w-18-wersjach
:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on June 11, 2009, 12:21:10 am
:L

I like cysio's signature :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on June 11, 2009, 08:39:04 am
bus drifting :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 11, 2009, 10:49:51 am
GT bus
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on June 12, 2009, 03:56:11 am
nah I meant the Heroes sig but I like the bus too :L
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on June 12, 2009, 12:13:23 pm
(http://files.uploadffs.com/b/9791b2a7/DSC01459.JPG)
(http://files.uploadffs.com/8/eb2780ae/DSC01460.JPG)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 12, 2009, 12:14:21 pm
m4lysz magic, is that your real namee?? wtf

https://www.youtube.com/watch?v=RLDgFolmQIc
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on June 12, 2009, 02:23:10 pm
:L they send those sims to any name
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 12, 2009, 03:00:12 pm
hahaha ok lol

So if I wanna order that sim for Mr Leave Me Outside they will deliver it  :D :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on June 13, 2009, 11:11:29 am
https://www.youtube.com/watch?v=1n9SYRimpR4
Title: Re: Funny Videos/Pictures
Post by: Lewis on June 13, 2009, 03:46:27 pm
http://www.theonion.com/content/video/nascar_coach_reveals_winning
LoL drive fast stratagy  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 14, 2009, 04:54:56 pm
:L :L :L :L :L :L :L
https://www.youtube.com/watch?v=j-IqlnCnKaM
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 14, 2009, 08:14:57 pm
I'm not a racist btw  :D

(http://whereshouldistart.files.wordpress.com/2008/07/nigger-joes-tar-soap.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 15, 2009, 05:36:14 pm
:L

https://www.youtube.com/watch?v=aVj-A1hVwKU
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Al3X on June 15, 2009, 07:22:13 pm
 :D :D :D :D :D :D :D :D :D
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on June 16, 2009, 02:03:03 pm
Might have already been posted, i can't be arsed to go through every page to check.

https://www.youtube.com/watch?v=LHY8NKj3RKs
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 16, 2009, 02:06:43 pm
lol ^
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 16, 2009, 02:51:28 pm
-That clock gonna keep ticking until it reaches 999 !

-What's gonna happen then ?!

-Nothing, you just suck.


:L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 17, 2009, 10:42:30 pm
(http://img31.imageshack.us/img31/7912/stars1424816c.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Al3X on June 18, 2009, 06:16:16 am
lol i heard on news about her yesterday...he wanted only 3 starts....but now she has 56 :D :D :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on June 18, 2009, 06:47:38 am
so funny :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Rac3r on June 18, 2009, 07:11:31 am
Dumb bitch lol How can you not feel a difference between 56 stars and 3 lol

Did you see the man who gave her the tattoo? lol

Gotta find a pic of him lol

(http://www.foxnews.com/images/539841/2_62_tattoogirl_6_320.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 18, 2009, 07:15:48 am
Ah freak !  :-X
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 18, 2009, 02:08:30 pm
lol i heard that she fell asleep at him  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on June 18, 2009, 02:19:48 pm
Who is this girl? xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on June 18, 2009, 02:37:03 pm
https://www.youtube.com/watch?v=jrYxFEm_NNI

lol gtamissions on sa-mp :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Rac3r on June 18, 2009, 04:09:15 pm
Servers like that are the reason I coded AX lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 18, 2009, 05:06:03 pm
THIS IS SO FUCKING FUNNY :L

https://www.youtube.com/watch?v=cyOUJvDpH_w
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 18, 2009, 05:20:32 pm
-God, you're allright ?!

-Fine, why do you ask?


:L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 18, 2009, 05:41:08 pm
loolll
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on June 18, 2009, 11:03:19 pm
buahahahaha
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 18, 2009, 11:48:22 pm
(http://auto.multiplayer.ro/wp-content/uploads/2007/12/beetle_sex.jpg)
(http://bp0.blogger.com/_NmHOPs9j4rc/SDgJO4Vb2lI/AAAAAAAAAN0/vc_VKOIkfx0/s400/boobs_car.jpg)
(http://www.strangevehicles.com/images/content/109980.jpg)
(http://www.spedeworthv8stockcars.com/funny-airliner-crash-bad-flight-pilots-blooper-burned-out-plane.jpg)
(http://www.spedeworthv8stockcars.com/blank%20bins.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 19, 2009, 04:07:38 am
bush is a noob :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on June 19, 2009, 11:45:32 am
(http://files.uploadffs.com/3/7da03055/howtoconfuseanidiot.PNG)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 19, 2009, 12:31:11 pm
(http://files.uploadffs.com/3/7da03055/howtoconfuseanidiot.PNG)
HAHAHAHAHAA, u got me ! :L :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on June 19, 2009, 12:31:57 pm
nice mooNman :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 19, 2009, 12:41:30 pm
There's no video !  ;D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 19, 2009, 01:12:12 pm
Keep on clicking :P
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 20, 2009, 04:55:05 pm
:L :L   this is sick !

(http://img76.imageshack.us/img76/2665/b2ze5.gif)

Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 20, 2009, 05:19:16 pm
omg :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 20, 2009, 05:51:02 pm
that's disgusting :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 20, 2009, 05:54:32 pm
its brilliant :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on June 20, 2009, 05:57:46 pm
^
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 20, 2009, 06:05:33 pm
(http://www.visualjokes.com/pics/583_analtv.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on June 20, 2009, 06:12:52 pm
lol anal
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 20, 2009, 11:07:39 pm
haha I made some pictures of FSR bicycle bags :P

I'll post them monday when I'm at my student room again  :D Don't have the wire here.. :/
Title: Re: Funny Videos/Pictures
Post by: [uXc]Rita on June 21, 2009, 09:47:22 am
(http://img4.imageshack.us/img4/1323/55j1d2tmp.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 21, 2009, 09:49:41 am
hahaha :L :L

so many ezra's :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on June 21, 2009, 11:14:31 am
u shud have used my better picture >:( :L

(http://i44.tinypic.com/2dvk3ex.jpg)

terrorist getting crucified ;)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 21, 2009, 11:34:59 am
rofl  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 21, 2009, 11:40:03 am
lmao :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 21, 2009, 02:08:37 pm
u shud have used my better picture >:( :L

(http://i44.tinypic.com/2dvk3ex.jpg)

terrorist getting crucified ;)

:L :L :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 21, 2009, 03:47:21 pm
Ouch :L :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 22, 2009, 09:54:12 pm
(http://obczaj.net/obrazki/65242.jpg)
(http://obczaj.net/obrazki/62923.jpg)
(http://obczaj.net/obrazki/62742.jpg)
(http://obczaj.net/obrazki/28572.jpg)
(http://obczaj.net/obrazki/28525.jpg)
(http://obczaj.net/obrazki/28477.jpg)

(http://obczaj.net/obrazki/28122.jpg)
https://www.youtube.com/watch?v=E_GfL6YH1_o
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 23, 2009, 05:30:38 am
Whats so funny in Titanic picture lol and Napoleon in Moscow... Everyone knows that he got ownd by cold :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 23, 2009, 08:41:54 am
Whats so funny in Titanic picture lol and Napoleon in Moscow... Everyone knows that he got ownd by cold :L

Titanic got also owned by cold :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 23, 2009, 12:55:32 pm
can u translate that polish picture please?:L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 23, 2009, 01:21:54 pm
(http://uvtblog.com/wp-content/uploads/2009/06/oh-sweet-futurama-748701.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on June 23, 2009, 01:43:29 pm
can u translate that polish picture please?:L
put the money from the right side of a car (passenger's seat'
dont go on the place where cars are ridin (u know, this caruzel :D where u can drive cars and bump to each other xD)
while u driving with a small child, dont let her/him to crash with a mouth at the wheel (lol mouth is used here with a vulgarization lol) and thats the point of it xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 23, 2009, 01:47:04 pm
lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on June 23, 2009, 02:18:21 pm
(http://i40.tinypic.com/nei2io.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 23, 2009, 02:39:38 pm
;_;

(http://img23.imageshack.us/img23/6455/q811a2tmp.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 23, 2009, 02:51:11 pm
:L :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Al3X on June 24, 2009, 10:46:28 am
https://www.youtube.com/watch?v=-jGnZhYKoCY
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 24, 2009, 12:40:08 pm
lool
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on June 24, 2009, 02:09:21 pm
(http://i40.tinypic.com/nei2io.jpg)

That is brilliant.
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 24, 2009, 04:20:09 pm
Haha, yes it is :L :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on June 25, 2009, 10:42:19 pm
Bicycle Repairman :D

https://www.youtube.com/watch?v=U01xasUtlvw
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 25, 2009, 11:27:35 pm
(http://obczaj.net/obrazki/66708.jpg)
(http://obczaj.net/obrazki/66679.jpg)
(http://obczaj.net/obrazki/66559.jpg)
(http://obczaj.net/obrazki/66568.jpg)
(http://obczaj.net/obrazki/66196.jpg)
(http://obczaj.net/obrazki/66191.jpg)
(http://obczaj.net/obrazki/29958.jpg)
(http://obczaj.net/obrazki/29898.jpg)
(http://obczaj.net/obrazki/29919.jpg)
(http://obczaj.net/obrazki/29852.jpg)
(http://obczaj.net/obrazki/29358.jpg)
(http://obczaj.net/obrazki/29248.jpg)
(http://obczaj.net/obrazki/29249.jpg)
(http://obczaj.net/obrazki/29250.jpg)
(http://obczaj.net/obrazki/38351.jpg)
(http://obczaj.net/obrazki/38225.jpg)

http://obczaj.net/pl/57424/
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 26, 2009, 05:12:55 am
(http://www.8notes.com/wiki/images/Mj872.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on June 26, 2009, 05:21:01 am
hmmmm how is that supposed to be fun?
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Al3X on June 26, 2009, 07:01:33 am
Bicycle Repairman :D

https://www.youtube.com/watch?v=U01xasUtlvw


lmao :D :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 26, 2009, 10:39:16 am
hmmmm how is that supposed to be fun?

dunno I was drunk :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on June 26, 2009, 01:30:43 pm
https://www.youtube.com/watch?v=dAkuxb6-gS8
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on June 26, 2009, 03:01:06 pm
roflmao
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on June 26, 2009, 03:58:36 pm
https://www.youtube.com/watch?v=dAkuxb6-gS8
Classic vide  ;D.Nice.

hmmmm how is that supposed to be fun?

dunno I was drunk :L
Holy cow man you are going really insane when you are drunk... :)
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 26, 2009, 09:25:23 pm
https://www.youtube.com/watch?v=lVk9xyJKOeg
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 26, 2009, 11:09:26 pm


hmmmm how is that supposed to be fun?

dunno I was drunk :L
Holy cow man you are going really insane when you are drunk... :)

I drink till I can't stand anymore, that's the way it is :L
Title: Re: Funny Videos/Pictures
Post by: YourMama on June 27, 2009, 06:15:03 pm
Dunno if someone posted this yet..... BTW:

https://www.youtube.com/watch?v=UDTZCgsZGeA

Wazaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa! :L :L :L

Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 27, 2009, 06:20:16 pm
Oooooooold video, but end is awesome :L
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on June 28, 2009, 05:40:58 pm
Could have already been posted as is old, but is totally awsome:

https://www.youtube.com/watch?v=hMnk7lh9M3o
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 30, 2009, 11:55:33 am
:L :L :L

https://www.youtube.com/watch?v=0ewK0vqf278
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Al3X on June 30, 2009, 03:48:19 pm
:L :L :L

https://www.youtube.com/watch?v=0ewK0vqf278


bullshit :o :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 30, 2009, 04:38:41 pm
and why can't the girl be madmax with a white sheet :D
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 30, 2009, 04:40:14 pm
cause i not wear white ;_;
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 30, 2009, 06:07:20 pm
so your no KKK member :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on June 30, 2009, 06:09:40 pm
what it mean?
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 30, 2009, 06:26:49 pm
KKK = Ku-Klux-Klan
fucking racists lol
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 30, 2009, 06:30:25 pm
Are those guys dressed in white with sharp hats or something and they have cutted eyes in those hats ? :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 30, 2009, 06:31:14 pm
yep, they look like this
(http://maaadddog.files.wordpress.com/2009/05/ku-klux-klan.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 30, 2009, 06:36:06 pm
They look nice to me :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 30, 2009, 06:37:11 pm
they are not any nice ;_;
but yea, their costumes look funny :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 30, 2009, 06:40:17 pm
Bad guys  ;)


And wooo 1k posts  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 30, 2009, 06:41:21 pm
1028 for me, woo :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 30, 2009, 07:12:37 pm
1599 !!
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 01, 2009, 11:48:47 am
Over!!  :L

https://www.youtube.com/watch?v=KJCfUm21BsI
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 01, 2009, 02:25:03 pm
haha :L :L
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on July 02, 2009, 09:03:39 am
May have been posted already, but makes me giggle every time:

https://www.youtube.com/watch?v=J---aiyznGQ

Any fan of Streetfighter 2 will love these. Make sure you watch them in YouTube as there is about 8 of them which forms the entire series (i can't be bothered to post all the links) This is part 1:

https://www.youtube.com/watch?v=kLrWgVPeCzI
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 02, 2009, 08:25:50 pm
Rally WRC Jumping compilation  :D there are some realy nice jumps

https://www.youtube.com/watch?v=w4vxLuwn2zA
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on July 02, 2009, 09:14:39 pm
Just for Max:

https://www.youtube.com/watch?v=LT-fuvH8ww4
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 02, 2009, 10:05:01 pm
Just for Max:

https://www.youtube.com/watch?v=LT-fuvH8ww4

lol what an idiot, cant even spell it right :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on July 04, 2009, 01:31:52 pm
(http://i41.tinypic.com/11gq9g5.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 05, 2009, 08:09:43 pm
(http://obczaj.net/obrazki/68992.jpg)
(http://obczaj.net/obrazki/69004.jpg)
(http://obczaj.net/obrazki/68883.jpg)
(http://obczaj.net/obrazki/68885.jpg)
(http://obczaj.net/obrazki/68843.jpg)
(http://obczaj.net/obrazki/68783.jpg)
(http://obczaj.net/obrazki/68787.jpg)
(http://obczaj.net/obrazki/68795.jpg)
(http://obczaj.net/obrazki/67967.jpg)
(http://obczaj.net/obrazki/67969.jpg)
(http://obczaj.net/obrazki/67767.jpg)
(http://obczaj.net/obrazki/67084.jpg)

(http://obczaj.net/obrazki/67582.jpg)




is this czeh ?
(http://obczaj.net/obrazki/67521.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 05, 2009, 09:31:21 pm
is this czeh ?
(http://obczaj.net/obrazki/67521.jpg)

yeh haha, it means Your shit, our pleasure!
:L :L :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 05, 2009, 09:39:36 pm
WASZE GÓWNO, NASZA RADOSC ?
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 06, 2009, 08:36:03 am
WASZE GÓWNO, NASZA RADOSC ?

yep
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on July 06, 2009, 07:59:36 pm
Radosne Gówno :D

http://englishrussia.com/?p=1434 <- watch this :)

http://englishrussia.com/?p=1373 <- and this
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 06, 2009, 09:02:59 pm
Yea russians always does something funny!  :-*
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 07, 2009, 12:03:24 am
(http://obczaj.net/obrazki/61032.jpg)
(http://obczaj.net/obrazki/46027.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 07, 2009, 08:42:39 am
haha, nice pictures max :L :L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on July 07, 2009, 05:05:58 pm
(http://youreowned.yo.funpic.de/i/owned2.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 07, 2009, 11:31:39 pm
(http://obczaj.net/obrazki/69295.jpg)
(http://obczaj.net/obrazki/69241.jpg)
(http://obczaj.net/obrazki/69251.jpg)
(http://obczaj.net/obrazki/69132.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Al3X on July 08, 2009, 03:16:19 pm
https://www.youtube.com/watch?v=FsJH3_txX7s
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 09, 2009, 05:15:00 pm
(http://obczaj.net/obrazki/69379.jpg)
(http://obczaj.net/obrazki/69385.jpg)
(http://obczaj.net/obrazki/69388.jpg)
(http://obczaj.net/obrazki/69356.jpg)
(http://obczaj.net/obrazki/69725.jpg)
(http://obczaj.net/obrazki/69736.jpg)
(http://obczaj.net/obrazki/69681.jpg)
(http://obczaj.net/obrazki/69662.jpg)
(http://obczaj.net/obrazki/69575.jpg)
(http://obczaj.net/obrazki/56651.jpg)
(http://obczaj.net/obrazki/56625.jpg)
(http://obczaj.net/obrazki/60747.jpg)
(http://obczaj.net/obrazki/60731.jpg)



Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 11, 2009, 11:41:03 am
lol riot hacking :L

https://www.youtube.com/watch?v=3kzW5PIZEa4
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 11, 2009, 12:59:08 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 11, 2009, 03:22:00 pm
;_;
Title: Re: Funny Videos/Pictures
Post by: Lewis on July 11, 2009, 05:01:31 pm
https://www.youtube.com/watch?v=L0dwXvAvT20
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 12, 2009, 03:33:56 pm
An English comedian about the dutch supermarket "Albert Heijn", very funny  :D :D

https://www.youtube.com/watch?v=_t55EIwIaus


Tarzan takes a bath:
https://www.youtube.com/watch?v=WXTWa16AMSg

Yay:
https://www.youtube.com/watch?v=PBtcqK55fQA
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 13, 2009, 02:56:17 am
anybody know who larry king is?

(http://files.uploadffs.com/b/a4bfba74/128848917513894020.jpg)

(http://files.uploadffs.com/0/f6550b56/larrykingtotallylookslikeprofessorfarnsworthfromfuturama.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 13, 2009, 08:08:59 am
anybody know who larry king is?

http://en.wikipedia.org/wiki/Larry_King
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 13, 2009, 11:39:05 am
Talk show dude  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 13, 2009, 11:40:18 am
he's a douchebag
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 13, 2009, 11:41:43 am
yeah he is >:(
Title: Re: Funny Videos/Pictures
Post by: ivanduk on July 13, 2009, 04:36:22 pm
(http://www.motika.com.mk/images/stories/07-2009/wtfwtf/Wtf_06.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 13, 2009, 08:06:23 pm
Quote
« Reply #666 on: Today at 18:36:22 »
:L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 13, 2009, 08:33:38 pm
That isn't funny antivirus :D
Title: Re: Funny Videos/Pictures
Post by: ivanduk on July 13, 2009, 09:13:10 pm
That isn't funny antivirus :D

than why are you laughing? ;_;

btw sth for devil :L ;_;
(http://www.motika.com.mk/images/stories/04-2009/zgradi-vo-666-forma/1239619870_1.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 13, 2009, 09:27:56 pm
when i  saw this i remember Final Destination (3 ?)
(http://obczaj.net/obrazki/70047.jpg)

haha
(http://obczaj.net/obrazki/70070.jpg)

(http://obczaj.net/obrazki/69995.jpg)

for M4
(http://obczaj.net/obrazki/70062.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 13, 2009, 10:34:57 pm
btw sth for devil :L ;_;
(http://www.motika.com.mk/images/stories/04-2009/zgradi-vo-666-forma/1239619870_1.jpg)

;_;

when i  saw this i remember Final Destination (3 ?)
(http://obczaj.net/obrazki/70047.jpg)

yea lol  :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 13, 2009, 10:40:00 pm

for M4
(http://obczaj.net/obrazki/70062.jpg)

not for me ??   >:( :( >:(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 13, 2009, 10:40:30 pm
get your own >:(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 14, 2009, 12:30:09 am
??? lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 14, 2009, 12:42:45 am
not showing.......
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 14, 2009, 01:29:19 am
....................... you taking the piss max?
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 14, 2009, 02:21:25 am
sorry, i didn't noticed it not showing, sorry again
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 14, 2009, 02:21:51 am
kk np ;_;
Title: Re: Funny Videos/Pictures
Post by: Myr4c3 on July 14, 2009, 09:00:51 pm
This pic says trues lol  :-* :


(http://img35.imageshack.us/img35/5573/snooby.jpg) (http://img35.imageshack.us/i/snooby.jpg/)

Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 14, 2009, 09:12:06 pm
fucking travian popup at imageshack  >:(
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 14, 2009, 11:27:44 pm
lol.. a while ago I pwnt the dutch travian servers but I'm hated now  :D :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 17, 2009, 06:10:29 am
fucking travian popup at imageshack  >:(

Lol you got that shit too :L


----

(http://www.iwatchstuff.com/2007/11/28/hoff-knight-rider-mustang.jpg)

Still can't forget that episode where knight rider got that button with letter C which opens roof and makes it coupe :L
Title: Re: Funny Videos/Pictures
Post by: Thrasher on July 19, 2009, 07:20:56 pm
Controller needed a thorough cleaning  :D

(http://i2.photobucket.com/albums/y3/MetalThrashingMad/cont-1.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 19, 2009, 07:54:34 pm
Ha, best way to clean small spaces is to clean them with earwax cleaners :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on July 20, 2009, 04:44:51 pm
(http://i25.tinypic.com/14k8jde.jpg)

(http://i28.tinypic.com/2nuocp5.jpg)
:L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 20, 2009, 06:19:24 pm
Havent seen that one with Chuky before. Good one :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on July 20, 2009, 09:11:32 pm
(http://i25.tinypic.com/14k8jde.jpg)

(http://i28.tinypic.com/2nuocp5.jpg)
:L
Stuff i was always in love with. :P

https://www.youtube.com/watch?v=vnRqYMTpXHc

Funny face.Cool song.
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 22, 2009, 06:48:45 am
Omg i cant stop laughing :L :L   All live!

https://www.youtube.com/watch?v=pKaDfALhoPg
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 22, 2009, 07:54:15 am
haha nice :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on July 23, 2009, 07:41:01 pm
OWNED xD
(http://www.fugly.com/media/IMAGES/Funny/Grand_Theft_Auto_Somalia.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 23, 2009, 07:41:33 pm
already completed that game  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 23, 2009, 07:46:41 pm
thats a very oooooooooold game :D

-----------------

(http://img403.imageshack.us/img403/2397/planebg.jpg)

(http://img197.imageshack.us/img197/6848/65242.jpg)

(http://img403.imageshack.us/img403/1169/129629original5bnap.jpg)

(http://img196.imageshack.us/img196/9484/132892originalemq0i.jpg)

(http://img525.imageshack.us/img525/8708/133111originalw3gc1.jpg)

(http://img196.imageshack.us/img196/4703/133112originalxyah0.jpg)

(http://img136.imageshack.us/img136/2646/133113originalm7gru.jpg)

(http://img115.imageshack.us/img115/4530/133131originalw9p78.jpg)

(http://img228.imageshack.us/img228/5571/133327originalhikqj.jpg)

(http://img403.imageshack.us/img403/3033/133537originaloaglh.jpg)

(http://img525.imageshack.us/img525/7050/133555original47pyb.jpg)

(http://img228.imageshack.us/img228/4002/133692originald7gk8.jpg)

(http://img522.imageshack.us/img522/7285/129743originalc5j0t.jpg)

(http://img522.imageshack.us/img522/4448/129744originals4k5v.jpg)

(http://img522.imageshack.us/img522/8908/129904originalb7k0y.jpg)

(http://img41.imageshack.us/img41/6804/130546original1jza6.jpg)

(http://img522.imageshack.us/img522/74/130803originalc15jl.jpg)

(http://img403.imageshack.us/img403/9629/130804originalorhmv.jpg)

(http://img228.imageshack.us/img228/3977/132033originaldk26q.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on July 24, 2009, 01:43:46 am
last 2 epic
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on July 24, 2009, 08:23:00 pm
So that "locked tire couple" means if you lock your tire = you are most stupid man of world. :P Leave it without any safety attachment so the person stealing it can use it without any spends on that. ^^
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 25, 2009, 06:49:31 pm
OWNED xD
(http://www.fugly.com/media/IMAGES/Funny/Grand_Theft_Auto_Somalia.jpg)

This game is real or just funny pic ? :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Al3X on July 25, 2009, 07:14:10 pm
it's real i bought  it 2 weeks ago it's very funny 8)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 25, 2009, 07:26:15 pm
looool
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on July 25, 2009, 08:05:14 pm
https://www.youtube.com/watch?v=zE0NOQG8WXs
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 25, 2009, 08:15:50 pm
and why is 2pac on the front at 0.56 with GTA bronx lol :L
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on July 25, 2009, 10:50:34 pm
(http://img41.imageshack.us/img41/7089/18130351.jpg) (http://img41.imageshack.us/i/18130351.jpg/)
Title: Re: Funny Videos/Pictures
Post by: Thrasher on July 26, 2009, 04:29:31 am
omg devil :L :L :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 26, 2009, 09:22:24 am
 :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 26, 2009, 06:40:28 pm
Oh jalcino understands russian  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 26, 2009, 08:03:51 pm
Oh jalcino understands russian  :D
no, thats serbian ;_;
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 26, 2009, 08:04:12 pm
https://uk.youtube.com/watch?v=6Z55OLcOVQA
https://uk.youtube.com/watch?v=i7dB0LvTxOI


loling :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 26, 2009, 08:10:09 pm
Hmm its kirilica and i can understand it lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 27, 2009, 12:23:48 am
When I was walking through my city I found out there are some people wearing FSR cycling bags on there bicycle.. When I found one parked I took a picture, take a look and have a lol :L

(http://img31.imageshack.us/img31/9917/afb0122.th.jpg) (http://img31.imageshack.us/i/afb0122.jpg/)

(http://img22.imageshack.us/img22/2696/afb0123.th.jpg) (http://img22.imageshack.us/i/afb0123.jpg/)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 27, 2009, 07:48:13 am
It really made me LOL. FastRider :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 27, 2009, 08:15:12 am
haha :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on July 27, 2009, 11:04:28 am
Haha, is he really riding fast with that thing ??? lol :/
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 27, 2009, 11:28:58 am
it are nitro bags ;_;
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 27, 2009, 11:35:21 am
Check this lol  ;D


Its called Professional pc repairing xD

http://www.videogaga.lt/video?id=ojpjverdwfdkehrmbit
Title: Re: Funny Videos/Pictures
Post by: ivanduk on July 27, 2009, 02:15:04 pm
Oh jalcino understands russian  :D
no, thats serbian ;_;

serbish ;_;
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 27, 2009, 05:50:26 pm
whatever :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 27, 2009, 05:52:54 pm
Lb idomiai padaryta.. +5 :D Daugiau tokiu video.. Padarykit video su telefono taisymu ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 27, 2009, 05:54:49 pm
Tai jus geriau su nauju kompu taip padarykit
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 27, 2009, 05:55:33 pm
Labas, nori atsisiusti muzikos ir visiskai nemokamai? uzeik i www.upsas.lt cia rasi ivairiausios muzikos ir kekviena diena vis nauju ;) www.upsas.lt per telefona wap.upsas.lt ))) ;_;
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 27, 2009, 05:56:21 pm
Blemba,kaip zvengiau ;DD pavaret

;_;
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 27, 2009, 05:56:55 pm
ziauru :DDD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 27, 2009, 05:57:20 pm
ziauriai geras :DDD net apsiverkiau ;DDDDDD geriausia vieta kai dulkes vale :DDDDDD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 27, 2009, 05:57:41 pm
Dar koki? prikolu ;DD  :-[
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 27, 2009, 05:58:05 pm
galetumet mano kompiuteri sutvarkyt?xDDDDD
:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 27, 2009, 05:58:09 pm
eina nx xD prikolas xD o jus gal taisote PC Touch Screen? xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 27, 2009, 05:58:45 pm
tas juokas ''he he '' gale zudantis :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 27, 2009, 05:58:47 pm
http://kendo.freeoda.com/viewpage.php?page_id=4 chatas be tabu, ateik ir bendrauk ;D* (mm)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 27, 2009, 05:59:09 pm
Turetu veikt dbr :DDDDD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 27, 2009, 05:59:43 pm
Pas mane irgikaskas ten pypsi, gal galetum paziureti ? xDDDDDDDD ;_;
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 27, 2009, 06:00:07 pm
geras :DDD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 27, 2009, 06:00:23 pm
Reiks ir man dulkes nuo motinines nusiwalyti, kazkur garaze gal rasiu ta dratiny sepety ;DDD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 27, 2009, 06:00:55 pm
ok enough ;_;
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 27, 2009, 06:01:12 pm
kk cia vienas is geriausiu kompu o twarkitojas irgi is geriausiu +55 ;_;
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 27, 2009, 06:01:24 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 27, 2009, 06:06:53 pm
I bet you don't uderstand anything :L And didn't used google translator xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 27, 2009, 06:07:32 pm
nope :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 27, 2009, 06:07:46 pm
< :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 27, 2009, 06:09:59 pm
(http://files.uploadffs.com/1/412e1cbc/2772009_200818.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 27, 2009, 06:11:05 pm
omg :L you get notified on replies aswell?
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 27, 2009, 06:11:21 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 27, 2009, 06:13:16 pm
riot and brea bennett

(http://img102.imageshack.us/img102/5628/funny0472.jpg) (http://img102.imageshack.us/i/funny0472.jpg/)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 27, 2009, 06:15:05 pm
haha :L :L
------------

(http://files.uploadffs.com/a/a3c3a1bd/2772009_201343.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 27, 2009, 06:17:40 pm
riot and brea bennett

(http://img102.imageshack.us/img102/5628/funny0472.jpg) (http://img102.imageshack.us/i/funny0472.jpg/)

hahahaahah that made me lol for real :L :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 27, 2009, 06:36:27 pm
haha :L :L
------------

(http://files.uploadffs.com/a/a3c3a1bd/2772009_201343.jpg)


;_;


------


My old email is spammed by AX screenshots replies :L :L

(http://img34.imageshack.us/img34/4525/23395215.png)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 27, 2009, 08:03:38 pm
yay I found snoopy

(http://listverse.files.wordpress.com/2007/09/funny-dog-tm.jpg)



wooo... this neighbour didn't like this creation :(

(http://i141.photobucket.com/albums/r62/commentyou/funny/images/funny-04.jpg)
Title: Re: Funny Videos/Pictures
Post by: ivanduk on July 27, 2009, 11:10:57 pm
im ?urák yu otec hajzl dotek mé cecek nelegální kokot jsem nejlepší lozer na lomiko.com nyní im je sexy chobotnicí LOL xP
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on July 28, 2009, 12:16:25 am
erm ok
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 28, 2009, 12:47:00 am
^
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 28, 2009, 11:08:48 am
im ?urák yu otec hajzl dotek mé cecek nelegální kokot jsem nejlepší lozer na lomiko.com nyní im je sexy chobotnicí LOL xP

wtf
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 28, 2009, 11:46:07 am
:L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 28, 2009, 02:15:45 pm
commercial lol  ;D

https://www.youtube.com/watch?v=Oj1LOZXRt0Y
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 28, 2009, 02:41:46 pm
hahaha nice :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on July 28, 2009, 03:53:34 pm
(http://i25.tinypic.com/bhhsgj.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 28, 2009, 07:04:31 pm
oh dear!  :o :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on July 29, 2009, 04:43:36 am
best vid ever
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on July 29, 2009, 10:14:43 am
:L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 29, 2009, 06:32:53 pm
Shaq is so great lol. You can find him everywhere :L :L

https://www.youtube.com/watch?v=0gW25PZZHns
Title: Re: Funny Videos/Pictures
Post by: [FSR]Mach5 on July 29, 2009, 08:16:49 pm
Thiese Fights are al fake.But is funny see they ''fighting''
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 29, 2009, 08:17:25 pm
its scripted not fake
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on July 29, 2009, 09:31:20 pm
WWE Monday Night Cooked
;_;
https://www.youtube.com/watch?v=FJ3oHpup-pk
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 29, 2009, 09:44:40 pm
(http://img195.imageshack.us/img195/9127/newbitmapimageumq.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 29, 2009, 09:51:18 pm
WWE Monday Night Cooked
;_;
https://www.youtube.com/watch?v=FJ3oHpup-pk

hahaha cant stop laughing :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Mach5 on July 29, 2009, 10:10:59 pm
:L
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 30, 2009, 10:19:35 am
(http://obczaj.net/obrazki/71884.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 30, 2009, 10:55:08 am
arms healed up?  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 30, 2009, 12:00:01 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 30, 2009, 12:30:04 pm
Roadkill Restaurant  :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 30, 2009, 06:47:11 pm
Thiese Fights are al fake.But is funny see they ''fighting''

I hate that shit... how you can even watch it lol. Everything is so fake and these guys whos fighting are such an idiots full of steroids :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 30, 2009, 06:58:52 pm
Thiese Fights are al fake.But is funny see they ''fighting''

I hate that shit... how you can even watch it lol. Everything is so fake and these guys whos fighting are such an idiots full of steroids :L

i'm really offended by that, but its a form of entertainment just like everything else you watch on tv! so i guess boxers are idiots who are full of steroids
as well?
and its not fake at all, it's scripted so there is a difference, everybody has their rights to not like something, but there is no need to insult and offend the millions of people who are fans of wrestling, it's a sport. i would like to see you fall 20ft off of a ladder and land through 6 tables. that's hardly fake is it?

https://www.youtube.com/watch?v=7J0LJypU3sc

skip to 5:16 and then tell me that its fake and it doesnt hurt?

maybe it's not the best example, but i certainly wouldn't perform a stunt like that. i could find 100 hundred more clips like that from the old wwf days but i would be here all night.
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 30, 2009, 07:11:58 pm
^ i forgot to write one phrase: It's only my opinion.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 30, 2009, 07:16:10 pm
and it sucks tbh, you couldve been more polite about it!
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 30, 2009, 07:16:37 pm
its fake anyway.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 30, 2009, 07:18:58 pm
scripted not fake
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 30, 2009, 07:19:38 pm
i dont know why u dont like it :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 30, 2009, 07:27:43 pm
https://www.youtube.com/watch?v=2kYRgpawj5k

https://www.youtube.com/watch?v=UqxhuSrLu9A


Mick Foley blacked out twice during the match and suffered a dislocated jaw, several broken ribs, an ankle broken in two places, as well as the loss of two teeth. In the same match, Foley was choke slammed through the top of the cage onto the ring, which was covered in actual sharp thumbtacks. The truth is, every ring is made of boards, every chair is made of unforgiving steel, and every table is made of wood strong enough to support the weight of a grown man. When a wrestler attempts such stunts, he is putting his life on the line because he's willing to sacrifice anything for what he loves to do.

please tell me that the bumps he took was fake and it didn't hurt him at all?

Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 30, 2009, 07:38:21 pm
Gee I just wrote some post and you made such a buble lol.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 30, 2009, 07:40:32 pm
i'm standing up for what i believe in, cos i was offended by your post! and i wanted to prove to you that it's not all "fake" like you said

the only thing that is fake though is the punches, but still i wouldnt like to take a fake one to the face. accidents do happen, injurys deaths etc.
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on July 30, 2009, 09:15:07 pm
yeah snick, I feel offended aswell, IM a huge WWE fan, and you should try it before you say its fake
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 31, 2009, 12:35:08 pm
Wrestling is for crazy people only :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on July 31, 2009, 10:43:05 pm
https://www.youtube.com/watch?v=MLnOG85HKMY
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on July 31, 2009, 10:45:12 pm
Caught in an awesome position lol !  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on July 31, 2009, 10:47:28 pm
:L

https://www.youtube.com/watch?v=TiJqWVLEt2U
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on August 01, 2009, 07:34:39 am
(http://obczaj.net/obrazki/71884.jpg)
oh god, thats sick.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 01, 2009, 11:50:09 am
https://www.youtube.com/watch?v=MLnOG85HKMY

hahahaha nice :L :L :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 01, 2009, 02:18:10 pm
\m/ HEAVY METAL \m/

(http://obczaj.net/obrazki/72056.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 02, 2009, 10:38:21 am
https://www.youtube.com/watch?v=MLnOG85HKMY

hahahaha nice :L :L :L

hahahah I was lolling so hard :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 02, 2009, 06:10:03 pm
This one is good :L :L

https://www.youtube.com/watch?v=GQe4tlsfRbY
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 03, 2009, 05:56:04 pm
https://www.youtube.com/watch?v=PwbLiPNVS2U
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 04, 2009, 07:44:28 am
Ironman! :L

(http://static.torrent.lt/v2/thumbnail/964940.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 04, 2009, 01:22:37 pm
(http://www.icanhasmotivation.com/wp-content/uploads/2009/06/ironman.jpg)

(http://www.funnythreat.com/images_funny/images/real-ironman-1.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 06, 2009, 04:38:32 pm
lol airport stairs
(http://obczaj.net/obrazki/72639.jpg)

(http://obczaj.net/obrazki/72603.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on August 06, 2009, 07:11:40 pm
lol is it possible to score with that thing? XD
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 06, 2009, 09:13:08 pm
just give it a hard swing and you'll shoot over everyone :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 06, 2009, 10:25:54 pm
i think they use more balls than just 1  :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 07, 2009, 01:46:21 pm
(http://img6.imageshack.us/img6/7995/mooman.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 07, 2009, 02:02:30 pm
:L :L :L :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 10, 2009, 06:06:54 pm
(http://i26.tinypic.com/or1fnr.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 10, 2009, 06:08:11 pm
Max posting enormous pics and you posting small as shit :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 10, 2009, 06:41:31 pm
change  on 800x600 and pic will be huge
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 11, 2009, 06:15:59 pm
chinise shit can be dangeruos

(http://obczaj.net/obrazki/73022.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 11, 2009, 06:18:52 pm
Who was wearing these must be totall idiot :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 11, 2009, 08:59:40 pm
aww disgusting  :-X
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 11, 2009, 09:42:21 pm
(http://obczaj.net/obrazki/73072.jpg)
(http://obczaj.net/obrazki/73097.jpg)
(http://obczaj.net/obrazki/73125.jpg)
(http://obczaj.net/obrazki/73010.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 12, 2009, 03:09:51 pm
https://www.youtube.com/watch?v=LuSBCIV1zuQ
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 12, 2009, 05:11:08 pm
(http://files.uploadffs.com/f/4997f954/133724originalvdanf.jpg)

(http://files.uploadffs.com/3/2e263ce3/133725originalxzswj.jpg)

(http://files.uploadffs.com/9/b6bb9e9e/133926original1b7hf.jpg)

(http://files.uploadffs.com/d/069dd83b/133942originaleq3cd.jpg)

(http://files.uploadffs.com/e/32e9ef9e/133944originalfvlhy.jpg)

(http://files.uploadffs.com/9/eff59126/133946original9li5t.jpg)

(http://files.uploadffs.com/8/28fb8053/134307originalexun0.jpg)

(http://files.uploadffs.com/4/30394a34/134325originalc3su7.jpg)

(http://files.uploadffs.com/d/9b9cd7cb/134326originaldfbjv.jpg)

(http://files.uploadffs.com/4/dd3d4890/134328original5a870.jpg)

(http://files.uploadffs.com/9/56489fdb/134557originalpboix.jpg)

(http://files.uploadffs.com/2/d6332d18/134566originalg1ktc.jpg)

(http://files.uploadffs.com/b/377eb4de/134567originaln5wzo.jpg)

(http://files.uploadffs.com/0/19dd02c4/135088originalpdhg4.jpg)

(http://files.uploadffs.com/1/513a1ee8/135214originalx4tcr.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on August 13, 2009, 02:23:32 am
ROFLMAO
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 13, 2009, 02:45:29 am
lool

(http://files.uploadffs.com/8/30de8fd4/lool.bmp)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on August 13, 2009, 06:34:15 am
ff is such a quitter :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 13, 2009, 07:47:08 am
and look at his score :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 13, 2009, 09:32:14 am
hahaha :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 13, 2009, 11:41:26 am
lolete
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 13, 2009, 05:28:54 pm
more
(http://obczaj.net/obrazki/73262.jpg)
(http://obczaj.net/obrazki/73271.jpg)
(http://obczaj.net/obrazki/73237.jpg)
(http://obczaj.net/obrazki/73246.jpg)
(http://obczaj.net/obrazki/73148.jpg)
(http://obczaj.net/obrazki/73152.jpg)
(http://obczaj.net/obrazki/73176.jpg)

















and sth SPECIAL:















FAIlronman :L
(http://obczaj.net/obrazki/73272.jpg)















Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 13, 2009, 06:03:19 pm
lol teleport :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 14, 2009, 12:12:58 pm
lol @ that nazi
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 14, 2009, 12:34:40 pm
lol @ that nazi

lol not only nazi use this, it is symbol of Hindu, Buddhism, Jainism, Finnish Air Force, etc..

read this:
http://en.wikipedia.org/wiki/Swastika
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 14, 2009, 01:51:09 pm
didnt know that :L :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on August 14, 2009, 09:29:28 pm
Performance!

Performance, thats the name of the game...

https://www.youtube.com/watch?v=Vn29DvMITu4

A cool sth about two biker. ^^
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 16, 2009, 12:49:04 pm
looool

somebody recorded a small clip of the SAMP 0.3 beta test yesterday, and they just happened to get me in the clip :L

i was the truth at the beginning smoking cigarette

right time right place eh :L

https://www.youtube.com/watch?v=OIJ9bBLea74
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 16, 2009, 01:31:48 pm
lol  :D
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 16, 2009, 02:43:24 pm
lol i see sync is quite better, hope it is

what a waste of Sabre at 0:39  :'(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 16, 2009, 02:44:42 pm
yeah and i was actually leaning against a vehicle, i don't know why it never showed :-\
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 16, 2009, 07:21:45 pm
Ok theres BETA so there will be full 0.3 version soon?  ;D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 16, 2009, 07:22:01 pm
ye
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 16, 2009, 09:53:16 pm
lool

(http://i30.tinypic.com/b7mnnn.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 16, 2009, 10:10:47 pm
:L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 17, 2009, 09:21:10 am
rofl
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on August 17, 2009, 10:35:06 am
https://www.youtube.com/watch?v=tW3_pFrGSe0
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 17, 2009, 10:54:08 am
haha i know this one :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 17, 2009, 11:39:01 pm
big google fan ??
(http://obczaj.net/obrazki/73899.jpg)

Shit-Men (x-Man)
(http://obczaj.net/obrazki/73914.jpg)

hungryyyyy
(http://obczaj.net/obrazki/73935.jpg)

big wheel keep rolling..
(http://obczaj.net/obrazki/73857.jpg)

lost shoe
(http://obczaj.net/obrazki/73858.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 20, 2009, 10:57:51 am
http://www.dumpert.nl/mediabase/604731/93857d4d/komt_die_dodge_charger.html

Max gonna love that vid  :D
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 20, 2009, 01:54:50 pm
yea lol

and 2 specials
(http://obczaj.net/obrazki/74123.jpg)
(http://obczaj.net/obrazki/74083.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 20, 2009, 06:55:16 pm
Laughing out loud :L

https://www.youtube.com/watch?v=C1bhzWoYKX0
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 20, 2009, 08:09:07 pm
thats old :L



hehe this is pretty cool video :

https://www.youtube.com/watch?v=qANKuEweccU
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 20, 2009, 08:39:21 pm
Laughing out loud :L

https://www.youtube.com/watch?v=C1bhzWoYKX0

lol thats from a belgian tv show, in dutch :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on August 21, 2009, 01:05:00 am
(http://video.xfire.com/c9988-4.jpg) (http://www.xfire.com/video/c9988/)

(http://video.xfire.com/c9991-4.jpg) (http://www.xfire.com/video/c9991/)

(http://video.xfire.com/72ae4-4.jpg) (http://www.xfire.com/video/72ae4/)

(http://video.xfire.com/5852e-4.jpg) (http://www.xfire.com/video/5852e/)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 21, 2009, 06:43:57 am
Fuck you disturbded :L I can't watch those videos cuz im not 18 yet... Pls don't make it only for adult next time xD

----

Just wanna see if I can add xfire video on forums. Rate and comment xD

(http://video.xfire.com/f9584-4.jpg) (http://www.xfire.com/video/f9584/)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on August 21, 2009, 06:59:28 am
ppffff logout and say fake date, easy aint it?
Title: Re: Funny Videos/Pictures
Post by: some_punk on August 21, 2009, 07:02:18 am
https://www.youtube.com/watch?v=b89CnP0Iq30
https://www.youtube.com/watch?v=F2TSy0Z5qTE
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 21, 2009, 07:57:26 am
ppffff logout and say fake date, easy aint it?

cant watch it even when im logged off lol
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 21, 2009, 08:02:45 am
"The kids" :L :L

Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 21, 2009, 08:03:08 am
 >:( >:( :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on August 21, 2009, 09:28:21 am
(http://video.xfire.com/c9988-4.jpg) (http://www.xfire.com/video/c9988/)
Quote
This video has been flagged by the Xfire community as possibly unsuitable for some viewers. Please register or log on to verify that you are 18 years or older.
hahaha
...no ;_;
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 21, 2009, 11:25:11 am
we must wait 1 year  :-\ :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 21, 2009, 12:04:48 pm
we must wait 1 year  :-\ :L

not me :L

lol, my youtube account says im 23 but I'm 20... did that cuz of 21+ rules lol :L

but they only have 18+ rules :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 21, 2009, 12:08:12 pm
my youtube account says 29 :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 21, 2009, 01:22:49 pm
ok maybe you know this , or maybe not, anyway funny

why dinosaurs died? too many duels!
(http://obczaj.net/obrazki/74226.jpg)

LOST
(http://obczaj.net/obrazki/74228.jpg)

haircut
(http://obczaj.net/obrazki/74231.jpg)

marketing
(http://obczaj.net/obrazki/74233.jpg)

dirty deeds...
(http://obczaj.net/obrazki/74239.jpg)

The Fast and The Furious
(http://obczaj.net/obrazki/74243.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 21, 2009, 05:04:09 pm
https://www.youtube.com/watch?v=ehEXQi3meBM

https://www.youtube.com/watch?v=vPbmnNy1-AQ
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 21, 2009, 05:07:29 pm
lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 21, 2009, 05:38:38 pm
cba to paste all the time youtube before and after link:
http://www.youtube.com/watch?v=QsEDUL_MLiM&feature=channel_page
http://www.youtube.com/watch?v=8zFfvwSm8UQ&feature=channel_page
http://www.youtube.com/watch?v=r2knnyA-8xw&feature=channel_page
http://www.youtube.com/watch?v=9alH5hnmfwU&NR=1
http://www.youtube.com/watch?v=a8ZFRePk0g0&feature=channel_page
http://www.youtube.com/watch?v=7-c8Ztd7WCk&feature=channel_page
http://www.youtube.com/watch?v=XTFMY4L3ykk&feature=channel
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on August 21, 2009, 06:11:55 pm
use notepad and do this ;_;
(http://files.uploadffs.com/b/f213bb13/notepad.PNG)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 21, 2009, 06:15:08 pm
hi moonman i feel drunk already
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 21, 2009, 09:23:48 pm
https://www.youtube.com/watch?v=qcfheFPKUlA
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 22, 2009, 11:33:51 am
hi moonman i feel drunk already

dunk
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on August 23, 2009, 10:12:43 pm
https://www.youtube.com/watch?v=nk2wViKSh_M
:L :L :L :L :L :L :L :L :L :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 23, 2009, 10:14:14 pm
wtf lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 24, 2009, 11:33:07 am
wtf is that movie for at all :L

to show that gay parents can have children or something :L ?
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 24, 2009, 01:43:40 pm
Nice fight :L :L

https://www.youtube.com/watch?v=d1xSZ8fm6N0
Title: Re: Funny Videos/Pictures
Post by: [RToS]eXtreme on August 24, 2009, 01:54:01 pm
Nice one :))

https://www.youtube.com/watch?v=GncDn4YyGrI
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 24, 2009, 02:39:31 pm
jak sie bawi cygan

lol not big different between pl and sk language :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on August 24, 2009, 03:02:53 pm

to show that gay parents can have children or something :L ?
gay parents already have children ;_;
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 24, 2009, 04:45:40 pm

to show that gay parents can have children or something :L ?
gay parents already have children ;_;

I meant a gay couple :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 24, 2009, 09:16:13 pm
lol what the fuck is that :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 24, 2009, 09:22:21 pm
(http://files.uploadffs.com/b/e07fb809/avatar_1.png)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 24, 2009, 09:22:38 pm
lol


that rly made me laugh :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on August 25, 2009, 12:49:22 am
(http://3.bp.blogspot.com/_cwC8cbngXqw/R_AERwt51fI/AAAAAAAAAO0/CggBipxGLBM/s320/funniest_giraffe_ever.jpg)

(http://i20.photobucket.com/albums/b201/jarkendia/lagaleria/090807_funniest_weird_03.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on August 26, 2009, 03:37:46 pm
https://www.youtube.com/watch?v=arfNofxBtfY
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 26, 2009, 04:14:53 pm
wtf lol
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 26, 2009, 11:24:38 pm
mmmmmmmmmmmm carrotsssssssss 
(http://obczaj.net/obrazki/74927.jpg)

strange fussion ???
(http://obczaj.net/obrazki/74948.jpg)

woo City in your desk  :o
(http://obczaj.net/obrazki/74869.jpg)

lol is this racist ??
(http://obczaj.net/obrazki/74875.jpg)

bananaphone  :D
(http://obczaj.net/obrazki/74881.jpg)




and special for Star Trek fans

USS Dogrerprise :L
(http://obczaj.net/obrazki/74897.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 26, 2009, 11:27:17 pm
lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 26, 2009, 11:29:25 pm
:L
Title: Re: Funny Videos/Pictures
Post by: SQu4l0 on August 26, 2009, 11:29:49 pm
xD
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 26, 2009, 11:30:56 pm
that beer 'BUD LIGHT' have fuckin great commercials
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 26, 2009, 11:32:33 pm
haha yeah the song owns
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 27, 2009, 12:11:08 am
https://www.youtube.com/watch?v=RfMQ_pq19ZQ
https://www.youtube.com/watch?v=7aO3TO5L0bM
https://www.youtube.com/watch?v=N9zxTY50NX8
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 27, 2009, 01:05:39 am
light beer is for gay people only
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 27, 2009, 02:26:14 am
fuck it but look how funny commercials that 'BUD LIGHT' have
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on August 27, 2009, 02:54:21 am
lol bud light has more clients that regular bud in USA
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on August 27, 2009, 05:25:37 am
(http://3.bp.blogspot.com/_ezewf41dE6I/RzimqdFP05I/AAAAAAAAOx8/3qM0ou7tK3o/s400/wojak_super_mocne.jpg) this is my weak beer just 9 VOLT :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on August 27, 2009, 05:45:09 am
jeez 9% thats too much
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 27, 2009, 11:20:11 am
lol bud light has more clients that regular bud in USA

that's why american people are not real beer drinkers. In europe nobody will ever drink light beer, I can't even remember that you can buy it that easily here lol.

And 9% isn't much knutico lol.. Yesterday I had beer with 12%

And my favourite local speciality has 30%, I mix it with coke, tastes so good :)
Title: Re: Funny Videos/Pictures
Post by: [RToS]eXtreme on August 27, 2009, 04:44:58 pm
Is somebody hungry ? :DDD

(http://www.images.best4you.sk/files/c8yi7qn7xk04q7w4gkq6.jpg)


Nude chicken xDDD

(http://www.images.best4you.sk/files/zvc3n7g8nhrsfnrsmyw0.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 27, 2009, 04:49:27 pm
hahah lol @ those chickens :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 27, 2009, 09:55:45 pm
the chickens are SC clan!!!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 27, 2009, 09:58:39 pm
devil's flag counter hahahahahah :DDDDDDDD
Title: Re: Funny Videos/Pictures
Post by: ivanduk on August 27, 2009, 10:03:31 pm
wut about it?
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 27, 2009, 10:04:27 pm
nothing, i was just saying ;_;!!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 27, 2009, 10:44:57 pm

:L :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 27, 2009, 11:15:48 pm
nothing, i was just saying ;_;!!

you lag as hell!!!!!!!!!!!!!
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 28, 2009, 02:35:28 pm
idk where to put it i decided here coz in What are you listening to now? arleady posted (but orginal not gta verion)
enjoy AC/DC - Rock n' Roll Train in  Grand Theft Auto style
it is great
https://www.youtube.com/watch?v=uQaG4EtXh6E
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 28, 2009, 02:45:56 pm
I'm the road warrior...
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Hellmuth on August 28, 2009, 03:02:47 pm
I'm the road warrior...
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 28, 2009, 03:14:53 pm
I'm the asphalt warrior...
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 28, 2009, 03:16:15 pm
I'm the water warrior...
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 28, 2009, 03:49:47 pm
I'm the road warrior...
I'm the asphalt warrior...
I'm the water warrior...
I'm the fire warrior...
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on August 28, 2009, 04:12:13 pm
https://www.youtube.com/watch?v=jENuS9nc9p4
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 28, 2009, 06:16:21 pm
I'm the road warrior...
I'm the asphalt warrior...
I'm the water warrior...
I'm the fire warrior...

I'm the air warrior...
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 28, 2009, 06:22:17 pm
airwolf
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 28, 2009, 06:37:50 pm
You belive this ?
few days ago in Mexico...
https://www.youtube.com/watch?v=2WQrGwzLm1E
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 28, 2009, 06:48:23 pm
creepy as fuck, it reminds me of andre -_-

andrelian
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 28, 2009, 07:28:00 pm
i think it is fake to make noise about it

or this is that Chupacabra ?
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 28, 2009, 07:29:04 pm
it is a very funny video max ;_;
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 28, 2009, 09:39:03 pm
its monkey imo
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 28, 2009, 09:47:02 pm
lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 29, 2009, 01:22:34 am
You belive this ?
few days ago in Mexico...

lol, "in may 2007" and you saw few days ago in mexico lol lol lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 29, 2009, 08:59:51 am
hahaha lol :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 29, 2009, 10:15:01 pm
(http://i30.tinypic.com/20k6knr.jpg)

pedobear lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 29, 2009, 10:24:25 pm

(http://www.picoodle.com/view.php?img=/4/1/20/f_pedobear49m_45e6725.jpg&srv=img33)D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 29, 2009, 10:25:09 pm
idk why pic dont show lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 29, 2009, 10:25:48 pm
I made a nice piece of art, didn't I?
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 29, 2009, 10:31:22 pm
(http://i28.tinypic.com/ifzn2q.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 29, 2009, 10:32:36 pm
bearjew
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 29, 2009, 10:41:05 pm
(http://i30.tinypic.com/20k6knr.jpg)

pedobear lol

(http://allyoucanupload.webshots.com/v/2001698666034005443)
(http://allyoucanupload.webshots.com/v/2003524820440152364)
(http://www.picoodle.com/view.php?img=/4/1/20/f_pedobear6m_1e08f92.jpg&srv=img33)
(http://www.picoodle.com/view.php?img=/4/1/20/f_pedobear10m_406dd12.jpg&srv=img33)
(http://www.picoodle.com/view.php?img=/4/1/20/f_pedobear49m_45e6725.jpg&srv=img33)

:L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 29, 2009, 10:48:21 pm
(http://i28.tinypic.com/2h5inlt.jpg)
(http://i27.tinypic.com/ru5li8.jpg)
(http://i31.tinypic.com/2uo2wrq.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 29, 2009, 11:10:14 pm
pedobear is black! :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 30, 2009, 12:44:46 am
https://www.youtube.com/watch?v=0hNXPvm5-YM
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 30, 2009, 08:43:29 am
lmao :L

so look at this haha

https://www.youtube.com/watch?v=lvruC4I27rk
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on August 30, 2009, 06:49:17 pm
omg he should be killed right now :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 30, 2009, 06:53:11 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on August 30, 2009, 07:08:43 pm
Background heroes compilation xD

https://www.youtube.com/watch?v=zdTelE_P3pc

demotywatory.pl --> (http://img.demotywatory.pl/uploads/1251628350_by_beocezet1212_500.jpg) mad max translate this :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 30, 2009, 07:34:14 pm
that reminds me of this lol
serbian football fans  :D

https://www.youtube.com/watch?v=yRjrhrehGyM
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on August 30, 2009, 07:41:39 pm
omg they are awesome :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 30, 2009, 08:01:41 pm
it is 9 days old video :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 30, 2009, 11:04:38 pm
hahaha this referee rules  :D
https://www.youtube.com/watch?v=MJyMd-gGTdE

Shaquille O'neal aka superman lol

https://www.youtube.com/watch?v=vS6kFvIbGJU
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 31, 2009, 12:00:21 am
(http://files.uploadffs.com/5/ac015ef0/pedo_bear_strikes_again_.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 31, 2009, 07:46:52 am
lmao !! :L :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 31, 2009, 10:15:59 am
There is another vid with Shaq when he was about to jump on ppl but that was just a joke :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on September 01, 2009, 01:48:03 pm
dentist  :D

(http://www.popular-pics.com/PPImages/funny_masks_dentist_1.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on September 01, 2009, 02:38:57 pm
(http://files.uploadffs.com/6/f73b65cf/lool.bmp)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 01, 2009, 02:41:49 pm
lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on September 01, 2009, 02:43:54 pm
i guess you don't know who he is?
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on September 01, 2009, 02:46:28 pm
pod or ironman :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on September 01, 2009, 02:47:27 pm
famous sa-mp hacker who added me to facebook lol
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on September 01, 2009, 02:49:22 pm
lol i saw those dogs and though that he might be iron or pod :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on September 01, 2009, 02:49:56 pm
why pod?
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on September 01, 2009, 02:51:54 pm
famous sa-mp hacker who added me to facebook lol

he isn't that famous when I don't know about him :L

what's his name.. __H__ :L ?
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on September 01, 2009, 02:52:29 pm
he's all over google lol
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on September 01, 2009, 02:53:21 pm
why pod?

Dunno just came to my head
Title: Re: Funny Videos/Pictures
Post by: MadMax on September 01, 2009, 06:36:46 pm
looooooooool
(http://obczaj.net/obrazki/75294.jpg)

looooooooool2
(http://obczaj.net/obrazki/75254.jpg)

WAAAAZZAAAA!!!!
(http://obczaj.net/obrazki/75236.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on September 02, 2009, 09:59:41 pm
Funny vid:

http://www.dumpert.nl/mediabase/612531/7422af11/zeekoe_op_stier.html
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 03, 2009, 01:14:39 pm
(http://files.uploadffs.com/6/5d266fde/136313original4yofs.jpg)

(http://files.uploadffs.com/4/c9264888/136711originalgzf9w.jpg)

(http://files.uploadffs.com/6/a0f66e1a/136806originaloqjh8.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on September 03, 2009, 05:47:55 pm
https://www.youtube.com/watch?v=OidwFnPd0Tg

lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 03, 2009, 05:50:21 pm
lol nice school  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on September 03, 2009, 05:53:06 pm
jeez mine was soft, but not that soft XD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on September 03, 2009, 06:19:45 pm
new sex position
https://www.youtube.com/watch?v=n-dLPPXyJzo

another vid from polish school
https://www.youtube.com/watch?v=k4xYAHe9LV4
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on September 03, 2009, 08:50:02 pm
omg cysio lol :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Mach5 on September 04, 2009, 12:00:09 am
It was you Cysio?  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on September 04, 2009, 09:39:08 am
lol no
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on September 04, 2009, 11:42:21 am
Wazzaa lol :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 04, 2009, 12:34:21 pm
2nd video hahaha :L :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on September 04, 2009, 08:21:06 pm
(http://obczaj.net/obrazki/75535.jpg)
(http://obczaj.net/obrazki/75536.jpg)
(http://obczaj.net/obrazki/75548.jpg)
(http://obczaj.net/obrazki/75558.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on September 04, 2009, 09:40:07 pm
(http://files.uploadffs.com/0/d6180fd8/face_plant.jpg)

(http://files.uploadffs.com/e/524bed15/lqxYTPADevK1X83pGL.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on September 04, 2009, 09:40:46 pm
seems to be painfull :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 05, 2009, 11:11:16 am
(http://obczaj.net/obrazki/75548.jpg)

lmao ! :L

------------

nice photo with dogs  :D
(http://files.uploadffs.com/7/54c6755b/1st_day_of_school.jpg)

(http://files.uploadffs.com/c/fa49c9bd/afroduck.jpg)

(http://files.uploadffs.com/4/8d4447e9/ahh_what_a_feeling.jpg)

(http://files.uploadffs.com/d/2fadd124/blowing_away.jpg)

(http://files.uploadffs.com/9/a9109241/dont_choking.jpg)
Title: Re: Funny Videos/Pictures
Post by: some_punk on September 05, 2009, 06:31:06 pm
https://www.youtube.com/watch?v=baLeMYjIcmI
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on September 05, 2009, 09:37:32 pm
(http://static.demotywatory.pl/uploads/1252172756_by_endrjusdr.jpg)

(http://static.demotywatory.pl/uploads/1252171212_by_MSQ_500.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 05, 2009, 10:27:36 pm
hahaha :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on September 05, 2009, 11:15:27 pm
lol it's riot

(http://files.uploadffs.com/9/613a9247/riot_lol.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on September 05, 2009, 11:41:48 pm
:L
Title: Re: Funny Videos/Pictures
Post by: some_punk on September 06, 2009, 02:57:52 am
HAHAHAHAHAHAHAAHHAAHA RIOT!!!!!
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on September 06, 2009, 07:20:42 am
Tried to finish this campaign  ;D

(http://video.xfire.com/1303d9-4.jpg) (http://www.xfire.com/video/1303d9/)
Title: Re: Funny Videos/Pictures
Post by: some_punk on September 06, 2009, 07:47:52 pm
(http://usera.imagecave.com/Gorf/FatNerd.jpg)
(http://i15.photobucket.com/albums/a386/Smashingions/nerd.jpg)
(http://pix.motivatedphotos.com/2008/9/4/633561391583089110-pervert.jpg)
(http://www.digitalpixelgallery.com/gallery/data/media/6/Pedofile.jpg)
(http://4.bp.blogspot.com/_FbG9rWPXqnc/SEGFjTx_UfI/AAAAAAAAB2k/_zgIX6ed0jU/s320/folder.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 06, 2009, 08:09:09 pm
lol nerds :L
Title: Re: Funny Videos/Pictures
Post by: some_punk on September 09, 2009, 07:19:34 pm
(http://i122.photobucket.com/albums/o272/pjernst777/gifs/starwarslol2.gif)
(http://i122.photobucket.com/albums/o272/pjernst777/gifs/walllol.gif)

(http://i122.photobucket.com/albums/o272/pjernst777/gifs/knightrider.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 11, 2009, 11:46:16 am
https://www.youtube.com/watch?v=Jag7oTemldY
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on September 11, 2009, 12:56:01 pm
lol
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on September 12, 2009, 09:09:53 pm
TracTORRRRRR LOOOOL  ;D ;D ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 12, 2009, 09:21:02 pm
:L :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on September 13, 2009, 05:56:16 am
Moo! TrackTooooR :L :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on September 13, 2009, 09:58:36 pm
If you havent seen these before..

Weird stuff or you might call it silly lol.

GTA 4 - Bloopers, Glitches & Silly Stuff

https://www.youtube.com/watch?v=iWGc76W6Vzo

Latest one, theres more of it if you look on youtube.

Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on September 13, 2009, 10:33:24 pm
all episodes are funny :L

Title: Re: Funny Videos/Pictures
Post by: MadMax on September 13, 2009, 10:57:44 pm
woo Dukes at 0:13, 0:53, 0:55, 0:56, 2:00
and Sabre at 4:33
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on September 14, 2009, 08:48:10 am
(http://images2.wikia.nocookie.net/uncyclopedia/images/thumb/e/e1/RonaldMcHitler.jpg/180px-RonaldMcHitler.jpg)

9992 views btw  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on September 14, 2009, 05:13:57 pm
https://www.youtube.com/watch?v=TzkDaI0z_n0
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 14, 2009, 05:53:48 pm
wtf lol
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on September 14, 2009, 09:02:00 pm
Daemn... That aint funny man.Sorry but... :(
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on September 14, 2009, 09:08:06 pm
if he is retard, it could be very fun for him, I have a special uncle, they get a laugh @ the most simple things, its fun to play with them sometimes, if he is just playing like he was retard, he should plug that shit in his ass and inflate himself till he blows up
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on September 14, 2009, 09:11:04 pm
if he is retard, it could be very fun for him, I have a special uncle, they get a laugh @ the most simple things, its fun to play with them sometimes, if he is just playing like he was retard, he should plug that shit in his ass and inflate himself till he blows up
Ive just laught to that last sentence too.But that boy in vid seems very much like mentally ill.
Playing with them isnt funny at all.
Title: Re: Funny Videos/Pictures
Post by: ivanduk on September 14, 2009, 09:19:13 pm
ill kids doesn't say "lol" when they laugh
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on September 14, 2009, 09:20:47 pm
if he is retard, it could be very fun for him, I have a special uncle, they get a laugh @ the most simple things, its fun to play with them sometimes, if he is just playing like he was retard, he should plug that shit in his ass and inflate himself till he blows up
Ive just laught to that last sentence too.But that boy in vid seems very much like mentally ill.
Playing with them isnt funny at all.

U telling me is not good for them to laugh just for making a funny sound or something? WTF
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on September 14, 2009, 09:24:40 pm
lol.

Making fun of them isnt funny, thats what i say.

Maybe you didnt even think this way, but nevermind.Keep on the track.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on September 14, 2009, 09:46:12 pm
you dont see he is joking?
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on September 15, 2009, 01:00:37 am
He is joking with him,but at least that guy is mental sick(retarded) or how you tell that on english cant see any fun posting videos like this,i could imagine how he easy turn his feelings and start scream and crying for same shit what he did to him with that pipe  :'(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on September 15, 2009, 08:26:43 am
https://www.youtube.com/watch?v=bcNEVKBzlVo
Title: Re: Funny Videos/Pictures
Post by: some_punk on September 15, 2009, 03:02:08 pm
lol nerds :L

nobody got my subliminal message U_U!
Title: Re: Funny Videos/Pictures
Post by: MadMax on September 17, 2009, 11:54:21 am
(http://obczaj.net/obrazki/76453.jpg)
(http://obczaj.net/obrazki/76454.jpg)
(http://obczaj.net/obrazki/76478.jpg)
(http://obczaj.net/obrazki/76479.jpg)
(http://obczaj.net/obrazki/76486.jpg)
(http://obczaj.net/obrazki/76489.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on September 17, 2009, 12:04:00 pm

(http://obczaj.net/obrazki/76489.jpg)


Boom, oil gone  :'(
At least Netherlands has left some gas :L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on September 17, 2009, 04:10:23 pm
(http://profile.ak.fbcdn.net/v229/1587/111/n650978208_4743.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 17, 2009, 04:16:19 pm
(http://obczaj.net/obrazki/76489.jpg)

lol :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on September 17, 2009, 04:23:03 pm
(http://www.funny-city.gr/templates/content/this-is-sparta/this-is-sparta-7.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on September 17, 2009, 04:58:50 pm
this is spam not sparta

wrong answer

correct is this is spam
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on September 17, 2009, 09:13:33 pm
this is spam not sparta

wrong answer

correct is this is spam
No the correct answer is "Spamtaaa®"
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on September 18, 2009, 02:44:54 pm
hahah can't stop laughing at this video

(http://files.uploadffs.com/7/a6d370bd/howtoconfuseanidiot.PNG)
Title: Re: Funny Videos/Pictures
Post by: MadMax on September 18, 2009, 03:28:28 pm
haha yeh coz it is fuckin' funny one :L

(http://obczaj.net/obrazki/75371.jpg)
(http://obczaj.net/obrazki/75373.jpg)
(http://obczaj.net/obrazki/75381.jpg)
(http://static.demotywatory.pl/uploads/1253275618_by_Patusznik_500.jpg)

on the last one text says
'Dragonforce'
The only band that can't perform their own songs at concert'
Title: Re: Funny Videos/Pictures
Post by: [RToS]eXtreme on September 18, 2009, 03:35:15 pm
There are mainly comical cops

https://www.youtube.com/watch?v=nD19Os5oUTg
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 18, 2009, 04:19:56 pm
https://www.youtube.com/watch?v=4pXfHLUlZf4
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on September 18, 2009, 09:13:59 pm
https://www.youtube.com/watch?v=4pXfHLUlZf4
Thats a thing which is on the way of being a classic. ^^
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 18, 2009, 09:18:12 pm
63 278 727 views haha
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on September 18, 2009, 09:28:34 pm
63 278 727 views haha
Well it still needs some age lol, anyway you can still call it a classic. >.<
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on September 18, 2009, 10:08:14 pm
hahah can't stop laughing at this video

(http://files.uploadffs.com/7/a6d370bd/howtoconfuseanidiot.PNG)

Whoo I never saw bin laden en jesus in 1 vid!! cool moo ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on September 19, 2009, 02:33:49 am
haha nice vid
(http://files.uploadffs.com/9/b607992d/nggggggh.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on September 19, 2009, 09:29:19 am
don't look so ugly  :'(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on September 19, 2009, 02:10:25 pm
(http://i38.tinypic.com/28cfxbr.jpg)
:L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on September 19, 2009, 02:15:28 pm
LOL I SCREENSHOTED THE SAME THING

(http://files.uploadffs.com/c/6d49cb05/adrenalinex.bmp)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on September 19, 2009, 02:37:01 pm
Yo antivirus, whats your xfire?  :)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on September 19, 2009, 03:23:29 pm
google bots spam :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on September 20, 2009, 11:47:20 pm
(http://www.matshtik.com/Funny%20Files/janfunnies/blonde_banana.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on September 21, 2009, 10:23:15 am
https://www.youtube.com/watch?v=k6LNnKonTOw
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on September 21, 2009, 11:57:21 am
fake lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 21, 2009, 12:05:34 pm
yea lol, thats bullshit  :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on September 21, 2009, 12:36:51 pm
thats imposible lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 21, 2009, 01:00:58 pm
https://www.youtube.com/watch?v=qqXi8WmQ_WM

https://www.youtube.com/watch?v=jvjDr8KKtsE
Title: Re: Funny Videos/Pictures
Post by: MadMax on September 21, 2009, 01:44:52 pm
(http://obczaj.net/obrazki/77000.jpg)
(http://obczaj.net/obrazki/77025.jpg)
(http://obczaj.net/obrazki/76978.jpg)
(http://obczaj.net/obrazki/76979.jpg)

https://www.youtube.com/watch?v=fCVAhqVqjpE
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on September 23, 2009, 01:10:47 am
tit station :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on September 23, 2009, 06:00:04 pm
carface
(http://obczaj.net/obrazki/77228.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 23, 2009, 06:01:30 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on September 23, 2009, 06:26:52 pm
what for car is the 7th? saab?
Title: Re: Funny Videos/Pictures
Post by: MadMax on September 23, 2009, 06:30:07 pm
yeah seems SaaB 9.3
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on September 23, 2009, 06:46:59 pm
carface

I thought of one too:

(http://static.howstuffworks.com/gif/m-47-general-george-s-patton-medium-tank-2.jpg)
(http://amansworldco.com/wordpress/wp-content/uploads/2009/07/cyclops2.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on September 23, 2009, 07:52:34 pm
lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 23, 2009, 08:37:30 pm
haha  :D
Title: Re: Funny Videos/Pictures
Post by: MadMax on September 24, 2009, 10:33:59 am
https://www.youtube.com/watch?v=HnGX5jL-lhg
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on September 24, 2009, 07:23:12 pm
https://www.youtube.com/watch?v=6gjXZdT0Qqw

 :D :D :D i found it hilarious
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on September 24, 2009, 08:05:01 pm
lol :L

------------

this one says: Watch out for horses :L

(http://files.uploadffs.com/1/6f7b1792/1243259681.jpg)

(http://files.uploadffs.com/e/ab36e1c3/1244379389.jpg)

(http://files.uploadffs.com/6/7ee16849/1243014972.jpg)

(http://files.uploadffs.com/4/839f47b7/1243101750.jpg)

(http://files.uploadffs.com/e/779ae864/1243332898.jpg)

(http://files.uploadffs.com/0/61d30e84/1243333730.jpg)

(http://files.uploadffs.com/3/a3f930d7/1243335703.jpg)

(http://files.uploadffs.com/2/5d772794/1243411985.jpg)

(http://files.uploadffs.com/a/eb81a614/1243429722.jpg)

(http://files.uploadffs.com/a/cddda348/1243516194.jpg)

(http://files.uploadffs.com/8/e36f83ed/1243806611.jpg)

(http://files.uploadffs.com/1/f52c1773/1243806771.jpg)

(http://files.uploadffs.com/f/dfdff4a2/1243868276.jpg)

(http://files.uploadffs.com/6/1bf360c1/1244063856.jpg)

(http://files.uploadffs.com/4/20cd4250/1244288045.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on September 25, 2009, 07:29:29 pm
(http://files.uploadffs.com/2/5d772794/1243411985.jpg)

this one owns
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on September 25, 2009, 10:57:35 pm
Quote
(http://files.uploadffs.com/6/7ee16849/1243014972.jpg)
Sandra Romain porn star and her baby
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on September 26, 2009, 09:36:11 am
You can't hide from McDonald’s!  :D

http://www.weathersealed.com/2009/09/22/where-the-buffalo-roamed/

---------

:L

https://www.youtube.com/watch?v=nKu60YKqsvs
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on September 26, 2009, 07:22:45 pm
(http://files.uploadffs.com/7/5c89723d/pillshere.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on September 26, 2009, 08:07:59 pm
why he used my sock for the molotov  >:( >:(
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on September 26, 2009, 08:18:02 pm
Rofl. There are all equipment from L4D. Pipebomb looks nice :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on September 27, 2009, 09:11:20 pm
yay topgear!

https://www.youtube.com/watch?v=-9AKp35gDco
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on September 29, 2009, 10:26:00 pm
yay topgear!

https://www.youtube.com/watch?v=-9AKp35gDco
Almost. ^^

Check enduro bike version :P

https://www.youtube.com/watch?v=CdLToDQSIvU
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on September 29, 2009, 10:29:12 pm
hahah, the car almost doesn't fit in those small alleys :D

(http://wemakestickers.com/zen1/images/joe%20cool%20snoopy.bmp)
Title: Re: Funny Videos/Pictures
Post by: MadMax on September 30, 2009, 10:15:55 pm
lol this picture owns
(http://www.spacetelescope.org/goodies/posters/large/earth03.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on September 30, 2009, 11:24:48 pm
lol the picture is fucking big xD

now I want the earth posted at the scale of 1:1 lol
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on September 30, 2009, 11:32:36 pm
10004px × 10967px
Hell what is wrong with you Max there is many people with slow internet so cant see any reason why posting picture bigger then 1280x1024 or 1600x1200.Keep that in mind  ;)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on October 01, 2009, 06:12:09 am
dude that made my poor mac mini overheat
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on October 01, 2009, 06:38:08 am
you got a bigger version of that pic, max? i can't even tell what it's meant to be a pic of :(
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on October 01, 2009, 03:35:18 pm
thank god a new page
Title: Re: Funny Videos/Pictures
Post by: MadMax on October 01, 2009, 03:38:31 pm
it was just the biggest picture i have ever seen, can you find bigger ?

that isn't nothing funny, just wanted to 'show' it, btw how big must be monitor to fit this picture? it's size is 10004px × 10967px
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 01, 2009, 03:44:03 pm
NASA monitor lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on October 01, 2009, 04:26:12 pm
just dont do it again
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on October 01, 2009, 05:10:12 pm
(http://img194.imageshack.us/img194/3047/22276724.jpg) (http://img194.imageshack.us/i/22276724.jpg/)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Steven8 on October 01, 2009, 06:17:19 pm
cool resolution :D Can u give link to this huge image? :)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 01, 2009, 06:28:55 pm
LoL Jalicno managed to get it loaded and open it.Nice view.

And know what? My firefox has frozen while trying  to load it and after some time it shut down the main window, downloads were standing still.Plus i checked my task mngr. and saw this...

(http://i224.photobucket.com/albums/dd154/BlankOf/owned.png)

X2.5 of my 512 mb pyshical ram. :( Usually i have 990 total ram. lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 01, 2009, 07:41:42 pm
haha pwnt
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 01, 2009, 08:06:22 pm
cool resolution :D Can u give link to this huge image? :)
heh look at the previous page lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on October 02, 2009, 02:23:07 pm
Kisayol Game lol
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 02, 2009, 08:15:53 pm
RIPped game so i create the shortcut from original game executable with send to cmd. :) I dont give up my laziness and make a name for it, icon is enough. :P
Title: Re: Funny Videos/Pictures
Post by: some_punk on October 03, 2009, 12:07:00 am
http://www.dalealplay.com/informaciondecontenido.php?con=31790
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 03, 2009, 09:07:30 am
http://www.dalealplay.com/informaciondecontenido.php?con=31790


loooool :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on October 03, 2009, 09:43:13 pm
http://www.dalealplay.com/informaciondecontenido.php?con=31790


hahaha WTF rotfl XDXDXD
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 03, 2009, 09:47:34 pm
Heheh. People got really fine reflexes to put the clothes back on lol.
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on October 03, 2009, 10:16:06 pm
Omfg its so hilarious 1:15 :L :L
Title: Re: Funny Videos/Pictures
Post by: some_punk on October 04, 2009, 07:08:18 am
stolen CoD6 gameplay footage
https://www.youtube.com/watch?v=ENVlC1KZ3o8
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 04, 2009, 04:34:47 pm
gayy vid
Title: Re: Funny Videos/Pictures
Post by: Thrasher on October 04, 2009, 09:14:59 pm
goddddd killerbunnies that signature of yours.. mmmmm.....



https://www.youtube.com/watch?v=FWRLdJYvlcA
Title: Re: Funny Videos/Pictures
Post by: MadMax on October 05, 2009, 06:10:32 pm
https://www.youtube.com/watch?v=YKFi-JouyE0
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 05, 2009, 06:29:51 pm
that's old :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 05, 2009, 06:34:52 pm
Haha lol that was a famous chestnut in around here some time ago.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on October 06, 2009, 07:32:34 am
lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 06, 2009, 05:07:48 pm
lol gayy (gayy) :L :L

https://www.youtube.com/watch?v=CK4b09K67M8

https://www.youtube.com/watch?v=7-NOZU2iPA8
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on October 07, 2009, 02:07:08 pm
Omfg  :o :o :o

https://www.youtube.com/watch?v=AzEYxB6r24E
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 07, 2009, 03:06:46 pm
wtf lol :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 07, 2009, 05:10:12 pm
FULL OF FAT!!!
Title: Re: Funny Videos/Pictures
Post by: MadMax on October 07, 2009, 09:45:15 pm
Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu

whatever it mean lol, the longsest lame of place ever

(http://www.panoramio.com/photos/original/12444506.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 07, 2009, 10:06:18 pm
lol who thinks of that when creating a place name xD
Title: Re: Funny Videos/Pictures
Post by: some_punk on October 08, 2009, 08:34:44 am
lol its in hawaii XD i already knew it..
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 09, 2009, 09:31:49 pm
Seems like a bored well regarded person typo that... And people agreed. lol

And... A game, just a game... Makes people like this ? Cant believe.But makes you laugh in somewhat reason lol

https://www.youtube.com/watch?v=jQrDp5vl1pg

Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 09, 2009, 10:21:07 pm
he sounds like a dinosaur lol
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 09, 2009, 10:41:52 pm
he sounds like a dinosaur lol
Quote
« Last Edit: Today at 01:36:41 AM by [FSR]Ush »

Hmm seems like i failed to catch a fail typo. :P
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 09, 2009, 11:52:06 pm
xD

lol vid btw:
https://www.youtube.com/watch?v=2lXh2n0aPyw
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on October 10, 2009, 12:45:39 am
he sounds like a dinosaur lol
how do you know what a dinosaur sounds like :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 10, 2009, 01:11:57 am
he sounds like a dinosaur lol
how do you know what a dinosaur sounds like :L

I knew you was going to say that lol :L
mmm... I don't know, discovery told me how it possibly sounded like.
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on October 10, 2009, 07:22:56 am
Seems like a bored well regarded person typo that... And people agreed. lol

And... A game, just a game... Makes people like this ? Cant believe.But makes you laugh in somewhat reason lol

https://www.youtube.com/watch?v=jQrDp5vl1pg



Looks like hes transforming into some creature from WOW lol. Epic no life MMORPG gamer :L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on October 10, 2009, 07:29:24 am
hmm maybe buzzard beeker, those birds make that sound :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 10, 2009, 12:21:28 pm
lol @ him, beating his head with a shoe :L

https://www.youtube.com/watch?v=2lXh2n0aPyw

hah, nice !  :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 10, 2009, 03:08:50 pm
Bird is the word  :D

https://www.youtube.com/watch?v=2WNrx2jq184
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 10, 2009, 03:54:48 pm
haha this one's good :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on October 10, 2009, 05:47:54 pm
-Brian, don't!

-Bird is the word, bird is the word!  ;D
Title: Re: Funny Videos/Pictures
Post by: some_punk on October 10, 2009, 05:58:09 pm
(http://i38.tinypic.com/2wf3gw8.gif)

LOL!!!
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 10, 2009, 06:04:06 pm
Titterbunnies. >.<

http://belladesoto.us/

http://www.arngren.net/

http://www.lingscars.com/

Epic design FAIL !!!
Title: Re: Funny Videos/Pictures
Post by: some_punk on October 10, 2009, 06:10:38 pm
Killerboobies   8)

http://pic.pbsrc.com/spacer.gif

LOL IT LOOKS IF SHE HAS PENIS xD
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 10, 2009, 06:32:25 pm
Killerboobies   8)

(http://pic.pbsrc.com/spacer.gif)

LOL IT LOOKS IF SHE HAS PENIS xD
Yay much better, wasnt in my creative mode at the moment <.<

This bull doesnt like people passing by near...

https://www.youtube.com/watch?v=mpSHwF97znU

TF2 Gun Sounds, Not so bad to listen lol

https://www.youtube.com/watch?v=UiGXT2nve7Q
Title: Re: Funny Videos/Pictures
Post by: MadMax on October 11, 2009, 03:25:46 pm
http://obczaj.net/pl/928050/
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 11, 2009, 06:04:08 pm
http://obczaj.net/pl/928050/

haha nice :L :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 13, 2009, 12:17:01 pm
mmm melons  :D

(http://www.djmick.co.uk/images/2009/03/men-love-melons.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on October 14, 2009, 01:01:16 pm
Fuck You World!
(http://obczaj.net/obrazki/79093.jpg)

Fail Wars
(http://obczaj.net/obrazki/79098.jpg)
Title: Re: Funny Videos/Pictures
Post by: ivanduk on October 14, 2009, 01:06:27 pm
:L :L :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 14, 2009, 02:57:59 pm
Fuck You World!
(http://obczaj.net/obrazki/79093.jpg)

Not funny? And that toast looks disgusting.
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on October 14, 2009, 02:58:16 pm
https://www.youtube.com/watch?v=9aRbKS9cfRM
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 14, 2009, 05:11:21 pm
https://www.youtube.com/watch?v=9aRbKS9cfRM
This guy have serious talent on making his face hilarious. ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on October 14, 2009, 11:36:18 pm
thy awesomeness
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 15, 2009, 12:39:44 pm
woo, my new sig :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 15, 2009, 12:40:40 pm
whahaha ill use the pod lool :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 15, 2009, 12:41:08 pm
:L :L :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on October 15, 2009, 01:48:15 pm
(http://obczaj.net/obrazki/79143.jpg)

(http://obczaj.net/obrazki/79236.jpg)

(http://obczaj.net/obrazki/79238.jpg)
Title: Re: Funny Videos/Pictures
Post by: ivanduk on October 15, 2009, 04:01:16 pm
is that Nico?
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on October 16, 2009, 08:23:37 am
"What, why did i stop?" :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 16, 2009, 11:46:39 pm
https://www.youtube.com/watch?v=mYyDXH1amic
Title: Re: Funny Videos/Pictures
Post by: some_punk on October 17, 2009, 04:40:52 am
(http://s3.faceinhole.com/09/10/16/645e07d9a10172d9109.jpg)

(http://s3.faceinhole.com/09/10/17/709b67d9a110320271.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 17, 2009, 11:24:58 am
its not any funny lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 17, 2009, 11:51:48 am
its not any funny lol

indeed
Title: Re: Funny Videos/Pictures
Post by: MadMax on October 17, 2009, 11:55:24 am
(http://s3.faceinhole.com/09/10/16/645e07d9a10172d9109.jpg)
bit funny, bit not so much

(http://s3.faceinhole.com/09/10/17/709b67d9a110320271.jpg)
SLASH ?
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 17, 2009, 12:26:52 pm
SLASH ?

/
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on October 17, 2009, 12:55:49 pm
butcher
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 18, 2009, 01:29:57 am
This man is drunk, police is gonna measure how much alcohol is in his blood with that thing... but he thinks its something else, have fun!

https://www.youtube.com/watch?v=-rj_VZS7LCs
Title: Re: Funny Videos/Pictures
Post by: MadMax on October 18, 2009, 10:20:56 pm
amazing movie, amazing graphic
https://www.youtube.com/watch?v=_HBJcA7qkCs
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 19, 2009, 03:15:40 pm
nice
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 21, 2009, 04:07:19 pm
Another urban myth busted:

(http://img18.imageshack.us/img18/5417/urbanmyth.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 21, 2009, 05:05:28 pm
:L :L
these ppl are idiots lol
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on October 21, 2009, 05:30:53 pm
Hah, indeed. What a style...  :-X
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 21, 2009, 06:26:21 pm
amazing movie, amazing graphic
https://www.youtube.com/watch?v=_HBJcA7qkCs
Voo the reflection+sky+the looks of them inside video makes it really feel like a clear sunny day.

And the car has some real "work" put on it.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on October 21, 2009, 08:24:49 pm
(http://files.uploadffs.com/f/7663fa93/epic_fail.bmp)
Title: Re: Funny Videos/Pictures
Post by: ǝǝǝoſ[sXɐ] on October 21, 2009, 08:34:01 pm
for M4
(http://obczaj.net/obrazki/70062.jpg)

Wtf Totalll Bargainnn!!!!!11111!!1!!111!1
Title: Re: Funny Videos/Pictures
Post by: ivanduk on October 21, 2009, 09:13:20 pm
(http://files.uploadffs.com/f/7663fa93/epic_fail.bmp)

:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 21, 2009, 09:43:14 pm
(http://files.uploadffs.com/f/7663fa93/epic_fail.bmp)

lmao ! :L :L
i remember its canberk's race heh
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 21, 2009, 09:51:09 pm
(http://files.uploadffs.com/f/7663fa93/epic_fail.bmp)

lmao ! :L :L
i remember its canberk's race heh

HAAHAHAH that one is good xD

This one is great too:
https://www.youtube.com/watch?v=nBJV56WUDng
Title: Re: Funny Videos/Pictures
Post by: some_punk on October 22, 2009, 04:00:26 am
https://www.youtube.com/watch?v=cyAxqI2Z6CU
https://www.youtube.com/watch?v=K0it1u_WcBI
https://www.youtube.com/watch?v=KhvOMAWIxfk
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 22, 2009, 08:47:11 am
not funny!!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on October 22, 2009, 03:13:12 pm
+1
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 23, 2009, 12:27:26 am
you had sex with dinner or what you gay female from bronx family ? ???
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on October 23, 2009, 11:50:45 am
Lithuanian talents. This guy is so gay his voice and hes 28!  :L :L

https://www.youtube.com/watch?v=xzKBMxuice8

But these guys got some talent  :D

https://www.youtube.com/watch?v=GBamhVRC6KU
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 23, 2009, 04:13:34 pm
Lithuanian talents. This guy is so gay his voice and hes 28!  :L :L

https://www.youtube.com/watch?v=xzKBMxuice8


haha :L
btw what are they talking about, i wanna laugh too :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on October 23, 2009, 05:14:48 pm
One of commission members is asking how old are you :L

And he answers: I'm 28.

Then one of commission members is saying its hard not to lough :L

The guy with yellow T-shirt is saying im gonna juggle balls and buket its like for Lithuania...

After his show the commission member sitting on right saying this must be the worst thing i've ever seen in my life :L

--------

And so on... :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 23, 2009, 05:51:41 pm
lough :L

(spin)
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on October 23, 2009, 06:13:39 pm
for M4
(http://obczaj.net/obrazki/70062.jpg)

Wtf Totalll Bargainnn!!!!!11111!!1!!111!1

LOL YEY  ;D
Title: Re: Funny Videos/Pictures
Post by: Lewis on October 23, 2009, 08:23:40 pm
https://www.youtube.com/watch?v=dQ8LS_AzgYI
Title: Re: Funny Videos/Pictures
Post by: some_punk on October 23, 2009, 08:50:52 pm
not funny!!

lol!! as i will never understand your "european's things"... u will never get to understand latin's things.... lol...

(http://i65.photobucket.com/albums/h209/Kiantsu/ardilla.gif)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 23, 2009, 09:43:03 pm
(http://i65.photobucket.com/albums/h209/Kiantsu/ardilla.gif)

but I love that one :L that thing is cool xD  it's such an epic look hahah

https://www.youtube.com/watch?v=dQ8LS_AzgYI

lol
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on October 24, 2009, 07:14:39 am
https://www.youtube.com/watch?v=dQ8LS_AzgYI

Rofl :@ 0:09 :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 24, 2009, 10:41:25 am
https://www.youtube.com/watch?v=dQ8LS_AzgYI

lmao :L :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on October 24, 2009, 07:31:18 pm
I know it's old but still its hilarious :L :L

https://www.youtube.com/watch?v=glvGfQnx3DI
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 25, 2009, 10:47:56 pm
Tiger woods hole in one, omg lol how sick, via the water.

http://www.dumpert.nl/mediabase/679861/6a8253a8/nice_hole_in_one.html
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 27, 2009, 06:14:18 pm
(http://files.uploadffs.com/d/68ecda23/hahaaa.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on October 27, 2009, 06:24:21 pm
Sorry. :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 27, 2009, 07:31:09 pm
Pwned.

Whats the difference between posting and sending ? :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 27, 2009, 10:05:02 pm
You post a reply and send a pm.
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 27, 2009, 10:29:09 pm
But it says both for private messages. >.<
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 28, 2009, 12:07:21 am
Then is a reply also defined as personal message, which looks very logic if you ask me.
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 28, 2009, 12:32:12 am
Might do.

Its fine. lol

Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 28, 2009, 08:09:32 am
^ lolzor discussion :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 28, 2009, 10:17:07 am
Discussion of this. :D
(http://www.icseguess.com/uploads/images/funny-picture-1475818506.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on October 28, 2009, 11:23:17 am
Poor dog  :-\
Title: Re: Funny Videos/Pictures
Post by: Guardian_Angel on October 28, 2009, 01:30:04 pm
(http://bastardlogic.files.wordpress.com/2008/01/dumb-ass.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 28, 2009, 02:50:34 pm
https://www.youtube.com/watch?v=m_kwsollKow
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on October 28, 2009, 03:30:32 pm
Not fun, real sad to see one of my favorite teams loose to a 3 division team
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 28, 2009, 03:35:33 pm
Such a shame for Real Madrid. Spending 300 million euro on players and still failing to win... HAHAHAHAH

Okay, Im no Real supporter(never been), but the way they treated my countrymen is fucking harsh..

My favorite clubs in europe are: Arsenal and FC Barcelona.

(And I like two Dutch clubs.. FC Groningen(my city muahahah) and PSV Eindhoven)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on October 28, 2009, 07:19:29 pm
What about twente fc? There's a costarrican player there, one of the best in NL my favorites in europe are Liverpool, Real Madrid and Inter
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 28, 2009, 07:47:23 pm
Ruiz!! Yeah good player! I love the way FC Twente plays at the moment.. they won with 4-0 from FC Groningen this weekend :( (my team isn't doing good at all this season)..

Btw, in the Europe League(EL) Twente lost their first match this season.. they played a bad match against the champion of the moldavian competition.

Nice goal of Ruiz here:
https://www.youtube.com/watch?v=G6YIjIOc_A4
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on October 29, 2009, 01:43:46 am
Ya thats a good one, shame he played for the biggest rival of my team here hehe but ya he is good
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 29, 2009, 11:51:26 am
This is coooooooooool!

https://www.youtube.com/watch?v=0XjwoVqM_qE
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on October 29, 2009, 09:56:25 pm
i miss this :'(

(http://files.uploadffs.com/7/d52b738a/gta_sa_20091029_21444039.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on October 29, 2009, 10:07:36 pm
Heh i don't. I always tried to change my car colour so i could not have these :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 29, 2009, 10:45:19 pm
yeah they should've made that able too in 0.3a
Title: Re: Funny Videos/Pictures
Post by: MadMax on October 30, 2009, 12:13:48 am
i miss this :'(

(http://files.uploadffs.com/7/d52b738a/gta_sa_20091029_21444039.jpg)
same, that was great
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on October 30, 2009, 04:52:13 am
(http://i36.tinypic.com/2zzuk3t.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on October 30, 2009, 07:59:56 am
Hi Ush :L :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 30, 2009, 12:07:45 pm
I'm the PinkPanter and you're the Octopussy ezra  :D :D :D
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 30, 2009, 12:31:17 pm
You do it into the head ? Wrong place lol

Grand Theft Auto IV: The Ballad of Gay Tony - First 13 Minutes Gameplay

https://www.youtube.com/watch?v=F00qPl4HfyM
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on October 30, 2009, 12:32:20 pm
(gayy)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 30, 2009, 12:37:43 pm
(gayy)
Indeed :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 30, 2009, 01:02:41 pm
(gayy)

mooman always know where to place the right replies  :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on October 30, 2009, 03:52:47 pm
Strange cloud in Europe ( UFO ) :L

https://www.youtube.com/watch?v=EZiAt35c3Xk
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on October 30, 2009, 04:30:49 pm
Strange cloud in Europe ( UFO ) :L

https://www.youtube.com/watch?v=EZiAt35c3Xk

latvia again?
Its probably as much true as that "meteor" lol :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on October 30, 2009, 04:49:07 pm
Nah first it was seen in Moscow now in Romania :L And this is real just strange weather anomaly which consisted in very rare weather conditions  ;)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 30, 2009, 05:35:07 pm
Nice cloud there!


This is how you get 7 co-pilots. ;D

(http://www.slipperybrick.com/wp-content/uploads/2007/09/ferrari-360-modena-stretched-limo.jpg)
Title: Re: Funny Videos/Pictures
Post by: ivanduk on October 30, 2009, 07:21:51 pm
Why so serious?

(http://images.paraorkut.com/img/funnypics/images/w/why_so_serious_cat-12947.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on October 30, 2009, 08:49:40 pm
This made me so LOL :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on October 30, 2009, 08:58:54 pm
https://www.youtube.com/watch?v=NQ7f9wb88sY
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 30, 2009, 09:50:37 pm
rofl, nice :L :L

some moments looked quite terribly though
Title: Re: Funny Videos/Pictures
Post by: ivanduk on October 30, 2009, 10:18:36 pm
:L

https://www.youtube.com/watch?v=dxg9SJXhjnQ

and here is a funnier harry potter remake


https://www.youtube.com/watch?v=qtQIaf47VAE
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on October 30, 2009, 10:46:32 pm
https://www.youtube.com/watch?v=NQ7f9wb88sY
EPIC ROFL

Bus overbrake and cop pole-kiss are in best of best pack >.<
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on October 30, 2009, 11:12:21 pm

https://www.youtube.com/watch?v=dxg9SJXhjnQ


south park owns the harry potter version :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on November 01, 2009, 08:54:24 am
https://www.youtube.com/watch?v=JZQsA7G0hvQ
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on November 01, 2009, 12:59:21 pm
Holy shit he needs serious help about his addiction.
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 01, 2009, 01:27:40 pm
I already know that one, is funny lol :L

But I think he had more than only alcohol..

BTW CARTMAN FTW <3:
https://www.youtube.com/watch?v=h8CU9UhrNnM

lal:

(http://www.freefoto.com/images/41/01/41_01_52---Elderly-People_web.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on November 01, 2009, 06:05:30 pm
(http://i37.tinypic.com/6j0ewg.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 01, 2009, 06:09:36 pm
cycorder to pc
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on November 01, 2009, 11:41:18 pm
Woo what a game. :)

https://www.youtube.com/watch?v=JnEbhoYVIrE
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on November 02, 2009, 12:56:53 am
where is the fun?
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on November 02, 2009, 03:21:10 pm
:L :L
(http://files.uploadffs.com/4/0d5847cd/1239733077.jpg)

(http://files.uploadffs.com/2/a55824cd/1239733098.jpg)

(http://files.uploadffs.com/2/860625f3/1239733101.jpg)

(http://files.uploadffs.com/5/34915cb3/1239733136.jpg)

(http://files.uploadffs.com/e/45e4ecd8/1239733177.jpg)

(http://files.uploadffs.com/6/9f4c63f3/1239733184.jpg)

(http://files.uploadffs.com/0/4c240c36/1239733194.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on November 02, 2009, 03:22:20 pm
Hah  ;D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 02, 2009, 03:25:15 pm
hahaha nice devil  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on November 02, 2009, 03:26:08 pm
ty :L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on November 02, 2009, 03:31:11 pm
np  ;)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on November 02, 2009, 07:09:04 pm
Thats just one word "greatness" :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on November 03, 2009, 12:01:20 am
last one is epic, never seen a cow giving so much milk with such pressure XD buahahahaha

thy awesomeness
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on November 03, 2009, 06:41:19 pm
Drunkest Guy Ever Goes Back For More Beer
https://www.youtube.com/watch?v=JZQsA7G0hvQ

Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on November 03, 2009, 06:57:13 pm
https://www.youtube.com/watch?v=JZQsA7G0hvQ
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 03, 2009, 07:13:57 pm
yeah repost -1

Whoop, I love borat disco dancing, its a great dance!!

https://www.youtube.com/watch?v=UWtIxRps2FM












LOOOOOOOOOOOOOOL

(http://media1.break.com/dnet/media/2008/5/29may29-the-cats-ass.jpg)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on November 04, 2009, 06:34:16 pm
* Thanks to Ush for fixing up half of todays laugh need. :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 06, 2009, 01:04:56 pm
lol

(http://1.bp.blogspot.com/_wGr8njEWjtI/SpySMe-xV3I/AAAAAAAAETo/iPuJ7Smmgv0/s400/Caitlin+B+.+ow+.+creature.JPG)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on November 06, 2009, 01:47:30 pm
lol what is it  :D
Title: Re: Funny Videos/Pictures
Post by: MadMax on November 06, 2009, 01:54:19 pm
https://www.youtube.com/watch?v=rNYBcnQbdqE
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 06, 2009, 04:23:43 pm
lol what is it  :D

cake :L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on November 06, 2009, 05:13:19 pm
from what? xD
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 06, 2009, 05:31:09 pm
with my well developed intelligence I guess it must be chocolate :L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on November 06, 2009, 06:14:09 pm
:L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on November 06, 2009, 09:00:16 pm
This... This.... Hmm...

This is a CREATURE we DONT know. :L :L

And i really love cakes, but i will think about it before i eat it, maybe its a creature looks and tastes like chocolate ?
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on November 10, 2009, 03:27:54 pm
the most agressive football player ever lol
and it's a woman
https://www.youtube.com/watch?v=2LPIUI_CY44
Title: Re: Funny Videos/Pictures
Post by: ivanduk on November 10, 2009, 03:30:30 pm
omfg i've just watched the same video today! :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on November 10, 2009, 03:32:19 pm
 ;D

https://www.youtube.com/watch?v=6-z_A2CH3BI

https://www.youtube.com/watch?v=plWnm7UpsXk
Title: Re: Funny Videos/Pictures
Post by: MadMax on November 10, 2009, 04:08:33 pm
(http://obczaj.net/obrazki/83764.jpg)

(http://obczaj.net/obrazki/83770.jpg)

(http://obczaj.net/obrazki/83784.jpg)
Title: Re: Funny Videos/Pictures
Post by: ivanduk on November 10, 2009, 06:09:29 pm
(http://i572.photobucket.com/albums/ss168/Razormax8/sith_nazgul.jpg)


poor frodo  :(
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on November 10, 2009, 06:14:10 pm
^ but sexy elf will help frodo to survive  :P
Title: Re: Funny Videos/Pictures
Post by: Gen on November 10, 2009, 09:13:43 pm
http://www.youtube.com/watch?v=ggB33d0BLcY&feature=channel (ftp://http://www.youtube.com/watch?v=ggB33d0BLcY&feature=channel)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on November 10, 2009, 09:41:42 pm
Lol Gen its trying to redirect to a FTP server. >.<

Your embed here;

https://www.youtube.com/watch?v=ggB33d0BLcY

Ok donkey is laughable, but hes a bit too hard on it. :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on November 10, 2009, 10:26:07 pm
lol yea, he is a freak  :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 11, 2009, 04:02:38 pm
OMFG

This is really the funniest thing since ages :L

"Monsieur Bière"

https://www.youtube.com/watch?v=lQNtPw_8ES8
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on November 11, 2009, 04:51:20 pm
hah ush lol, thats nice :L

-------------------

old but good  :D
https://www.youtube.com/watch?v=TGIQr8dqlso

https://www.youtube.com/watch?v=dFum24vQvC4

https://www.youtube.com/watch?v=-mAutchzKuQ
Title: Re: Funny Videos/Pictures
Post by: MadMax on November 11, 2009, 10:24:22 pm
(http://obczaj.net/obrazki/83917.jpg)

(http://i.demotywatory.pl/uploads/1257948149_by_kamilos19_500.jpg)
Title: Re: Funny Videos/Pictures
Post by: some_punk on November 12, 2009, 04:42:50 am
Parody from Glee -I say a little player

LOL

https://www.youtube.com/watch?v=3Lp3s4ygDw0

OM NOM NOM NOM!!

https://www.youtube.com/watch?v=CWK-iyC5oPc
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on November 12, 2009, 04:54:24 am
lol at glee one, we are gonna see that episode this thursday in latin america
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on November 12, 2009, 02:01:10 pm
https://www.youtube.com/watch?v=X4Piuuqqs10
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 12, 2009, 03:19:08 pm
that girl is a bitch jalicno :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on November 12, 2009, 05:39:27 pm
this video is on the previous page already (spin)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 12, 2009, 08:33:34 pm
Do I need to explain more? --> idiot!

https://www.youtube.com/watch?v=75IBHZ2BU0c
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on November 12, 2009, 09:18:44 pm
o_0
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 13, 2009, 12:17:04 pm
In the Netherlands we have those famous walls with food in it. When I was partying tonight I brought a mandarin with me and we bought a cheeseburger and put that mandarin back in xD

Picture:
(http://img21.imageshack.us/img21/1792/afb0329.jpg)

Hahah I never noticed, but I see that they spelled Cheesburger without the 'e' xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on November 13, 2009, 01:24:24 pm
Someone call the spelling police! :(
Title: Re: Funny Videos/Pictures
Post by: some_punk on November 14, 2009, 04:19:41 am
https://www.youtube.com/watch?v=kAOQiCXlrhE

https://www.youtube.com/watch?v=N6XQADRUHHQ
Title: Re: Funny Videos/Pictures
Post by: MadMax on November 14, 2009, 12:31:31 pm
(http://obczaj.net/obrazki/84682.jpg)
(http://obczaj.net/obrazki/84590.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on November 14, 2009, 01:28:33 pm
(http://obczaj.net/obrazki/84590.jpg)

dev playing samp :L :L
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on November 14, 2009, 03:13:46 pm
https://www.youtube.com/watch?v=HTkA9L2J2gY
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on November 14, 2009, 04:39:36 pm
(http://obczaj.net/obrazki/84590.jpg)

dev playing samp :L :L

i dont have a laptop  :D
Title: Re: Funny Videos/Pictures
Post by: some_punk on November 14, 2009, 06:31:48 pm
I love this video!! these girls are so sexy...(http://www.muchachapa.com/images/smiley_babas.gif)
https://www.youtube.com/watch?v=4yjBMlqPnZE


(http://i266.photobucket.com/albums/ii242/psupaul/smithers_141.gif)

(http://i266.photobucket.com/albums/ii242/psupaul/ralph-egg2.gif)


Title: Re: Funny Videos/Pictures
Post by: MadMax on November 15, 2009, 08:41:44 pm
(http://obczaj.net/obrazki/84910.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on November 16, 2009, 02:08:15 pm
(http://obczaj.net/obrazki/84996.jpg)
(http://obczaj.net/obrazki/84999.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 16, 2009, 04:47:10 pm
LOL fail

https://www.youtube.com/watch?v=8z3rRl3bBz4
Title: Re: Funny Videos/Pictures
Post by: some_punk on November 16, 2009, 05:28:36 pm
(http://sam.zoy.org/porn/big_pussy.jpeg)

Devil's cat
(http://images.meredith.com/bhg/images/08/ss_PetsDevilCat.jpg)

Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on November 16, 2009, 05:39:32 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on November 16, 2009, 08:08:16 pm
omg poor cat is starving
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on November 16, 2009, 08:09:31 pm
muscat
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on November 16, 2009, 10:09:01 pm
lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 17, 2009, 02:58:49 pm
(http://blatherwatch.blogs.com/.a/6a00d8341bf6cb53ef01156f75541c970c-320wi)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on November 17, 2009, 07:11:18 pm
:L
(http://img121.imageshack.us/img121/4076/15114592.jpg) (http://img121.imageshack.us/i/15114592.jpg/)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on November 17, 2009, 10:26:17 pm
lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 18, 2009, 08:46:41 am
meow meow meow meow meow meow  :D

https://www.youtube.com/watch?v=LTunhRVyREU
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on November 19, 2009, 02:37:21 am
(gayy)

https://www.youtube.com/watch?v=JlwtsKXm-MM
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 19, 2009, 10:59:08 am
stupid french.

now netherlands isn't in group 1 with the seeding..
Title: Re: Funny Videos/Pictures
Post by: some_punk on November 19, 2009, 03:25:58 pm
(http://blstb.msn.com/i/66/7F69EFB53FC356286535E022CD60F7.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 19, 2009, 03:50:45 pm
haahh the irish soccer union(or whatever the name for that is) makes appeal to replay the match
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on November 19, 2009, 07:14:03 pm
Close your eyes  :-X

https://www.youtube.com/watch?v=Laz0cAZEhWg
Title: Re: Funny Videos/Pictures
Post by: [MAF]PyroFox on November 19, 2009, 10:03:51 pm
French, the cunts. Thierry henry even admitted it! >:( We deserve a rematch!!!!!
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 20, 2009, 03:01:29 am
^ I agree with mr ireland  :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on November 20, 2009, 06:07:09 am
https://www.youtube.com/watch?v=MEqwwLEDyGY best version of Drunkest GUY adventures :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on November 20, 2009, 09:48:36 am
https://www.youtube.com/watch?v=MEqwwLEDyGY best version of Drunkest GUY adventures :D

lol
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on November 20, 2009, 10:02:07 am
I say jump over pool full of snakes is fake, but over Aston... Dunno  ;D

https://www.youtube.com/watch?v=_Dcv9qzWrps
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on November 20, 2009, 03:55:04 pm
Only UK people may know of Bear Grylls, but this is funny:

https://www.youtube.com/watch?v=p3J4Kq1FzVk
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on November 20, 2009, 04:34:53 pm
Discovery is international channel  ;)
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on November 20, 2009, 04:42:16 pm
Discovery is international channel  ;)

Ah cool. :) I didn't know he was on Discovery, as he is on Channel 4 here i think.
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on November 20, 2009, 04:47:52 pm
Man vs. Wild  (http://dsc.discovery.com/tv-schedules/series.html?paid=1.13899.26004.32074.5)
Title: Re: Funny Videos/Pictures
Post by: MadMax on November 20, 2009, 06:34:42 pm
ha ha yeah, he will survive apocalypse and show it on Discovery :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 20, 2009, 06:50:54 pm
wtf didn't know bear grylls was such a pervert
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on November 20, 2009, 11:00:18 pm
Bear Grylls is an awesome guy on TV ;D

lol funny video :L
Title: Re: Funny Videos/Pictures
Post by: some_punk on November 21, 2009, 08:03:52 pm
REAL RALPH (THE SIMPSONS)
(http://www.pendejaditas.com/wp-content/uploads/2009/06/Ni%C3%B1o-Helado-Pendejaditas01.gif)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 22, 2009, 12:51:28 pm
haha :L
Title: Re: Funny Videos/Pictures
Post by: some_punk on November 22, 2009, 09:28:15 pm
https://www.youtube.com/watch?v=AJt8DmE3JSk
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on November 23, 2009, 02:05:46 am
(http://img684.imageshack.us/img684/3235/lolsa.jpg) (http://img684.imageshack.us/i/lolsa.jpg/)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on November 23, 2009, 02:21:51 am
lol epic fail
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on November 23, 2009, 03:02:53 am
(http://kuvaton.com/kuvei/skills.gif)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on November 23, 2009, 06:24:46 am
https://www.youtube.com/watch?v=DaVCfVbucVM



"Jackass team" from my city hehe

https://www.youtube.com/watch?v=bSkQ32vzuSY

and part 2

https://www.youtube.com/watch?v=HPw7dQma7Qk

part 3 (most hardcore for me :D )

https://www.youtube.com/watch?v=KkKvpsrkDu8
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on November 23, 2009, 02:38:55 pm
Two estonian business men talking in english :L :L

http://www.ctv.lt/video/778/GIG-geriausias-i%C5%A1-geriausi%C5%B3-Estai
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on November 23, 2009, 03:17:30 pm
Two estonian business men talking in english :L :L

http://www.ctv.lt/video/778/GIG-geriausias-i%C5%A1-geriausi%C5%B3-Estai

it always asks me something lol
Quote
Šiame puslapyje gausu necenzūruoto turinio, todėl jis nerekomenduojamas jaunesniems nei 14 metų asmenims.
Ar tu jau turi 14 metų?

cant watch it  :(
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on November 23, 2009, 03:20:25 pm
Eh it always asks if you have 14 years old. Just press green button (Taip) and you will be able to watch it  :P
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on November 23, 2009, 03:20:39 pm
hahaha idiots :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on November 23, 2009, 05:52:13 pm
Rebus  :D :D

(http://img109.imageshack.us/img109/7995/mooman.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on November 23, 2009, 06:46:09 pm
mooman!  :D
Title: Re: Funny Videos/Pictures
Post by: some_punk on November 23, 2009, 08:35:24 pm
(http://www.malibumoofrozengriddle.com/Images/Malibu_Moo_Real_1.jpg)
(http://topjokes.org/images/moo.jpg)
(http://www.kloonigames.com/blog/wp-content/uploads/2007/03/moo_shot_03.jpg)
(http://2.bp.blogspot.com/_ZShMpXfhwPw/RbpiAWJIYTI/AAAAAAAAAA4/SB7B3qpj9yc/s320/vaca%2520loca.jpg)
(http://img211.imageshack.us/img211/4897/vaca0hlgh7.jpg)
(http://www.superbastardo.com/misc/superbastardo/data/images//h/hombre_vaca1178284528.jpg)
(http://static.zooomr.com/images/482615_20c3712b84.jpg)
(http://www.tienda-disfraces.es/dinamic/marca_de_agua.php?src=../img_bd/15225xl.jpg)
(http://farm4.static.flickr.com/3346/3300384613_56b321b315.jpg?v=0)
(http://3.media.tumblr.com/mJnzPrzMbpop1jwuH8q1bxbPo1_500.jpg)
(http://f00.inventorspot.com/images/dolphin%20and%20cow.img_assist_custom.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on November 24, 2009, 10:21:07 am
Too much moo!  :o
Title: Re: Funny Videos/Pictures
Post by: MadMax on November 27, 2009, 02:00:04 pm
(http://obczaj.net/obrazki/86507.jpg)

(http://obczaj.net/obrazki/86518.jpg)
(http://obczaj.net/obrazki/86519.jpg)
(http://obczaj.net/obrazki/86520.jpg)
(http://obczaj.net/obrazki/86521.jpg)
(http://obczaj.net/obrazki/86522.jpg)
(http://obczaj.net/obrazki/86523.jpg)
(http://obczaj.net/obrazki/86524.jpg)
(http://obczaj.net/obrazki/86525.jpg)
(http://obczaj.net/obrazki/86526.jpg)
(http://obczaj.net/obrazki/86527.jpg)
(http://obczaj.net/obrazki/86528.jpg)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on November 27, 2009, 04:00:21 pm
:L Insane
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on November 27, 2009, 09:55:18 pm
unbelievable

https://www.youtube.com/watch?v=ePfCWVoLVOA
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on November 27, 2009, 10:01:22 pm
people who jump in front of trains are cunts. if you're going to kill yourself, stick your head in the oven or something, don't force some poor train driver to kill you :@
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on November 27, 2009, 10:08:27 pm
but it was drunk and it fell :(
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on November 27, 2009, 10:11:00 pm
yeah but i just thought i'd use this opportunity to mention my views on people who do that cos there'll probably never be a better time :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on November 27, 2009, 10:18:22 pm
spose so :L
Title: Re: Funny Videos/Pictures
Post by: some_punk on November 28, 2009, 12:36:48 am
i saw that video on news....  she was too high...

a lot of videos like those are in mexico now.... ppl throws down to underground passages and try to suicide... anothers try to jump at next corridor...
 
https://www.youtube.com/watch?v=I1I7KgBWc78
https://www.youtube.com/watch?v=ZWZ1HzbuoO8
https://www.youtube.com/watch?v=9ZKCbZJ__dM
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on November 28, 2009, 10:08:02 am

https://www.youtube.com/watch?v=9ZKCbZJ__dM


WTF  :o :o
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on November 28, 2009, 11:35:14 am
Coca Cola Ad lol

https://www.youtube.com/watch?v=TecLbWk8A3w
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on November 28, 2009, 12:34:04 pm
that's old  :D
Title: Re: Funny Videos/Pictures
Post by: MadMax on November 28, 2009, 06:38:16 pm
https://www.youtube.com/watch?v=0TbQOzHmzH0
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on November 28, 2009, 06:56:36 pm
:L All that run is for nothing, massacre out there lol
Title: Re: Funny Videos/Pictures
Post by: some_punk on November 29, 2009, 09:08:24 pm
https://www.youtube.com/watch?v=tUEyYuZkjVI
(http://www.blackbeltpoker.com/Images/Players/Profile/snoopy_1.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on November 30, 2009, 09:01:21 pm
hahah lool :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on December 01, 2009, 12:33:58 am
(http://files.uploadffs.com/8/6b558b6b/3757.gif)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 01, 2009, 12:41:05 am
:L

Wipple
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on December 02, 2009, 04:21:09 pm
How good does this game look? lol

https://www.youtube.com/watch?v=hOvq3-oG5BM

It's called Sumotori and is under 100k lol

Full info is here:

http://www.fun-motion.com/physics-games/sumotori-dreams/
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 02, 2009, 06:14:50 pm
Weird lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on December 02, 2009, 06:25:04 pm
lol Im gonna get it asap
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 02, 2009, 06:44:36 pm
it is a free game
you can download the attachment if you want
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 02, 2009, 07:00:26 pm
stupid game
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on December 02, 2009, 07:43:53 pm
but very fun
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 02, 2009, 07:57:08 pm
(http://i33.tinypic.com/t6y23r.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 03, 2009, 06:35:40 pm
HAHA this owns! :L

http://www.newgrounds.com/portal/view/515897
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 03, 2009, 06:39:05 pm
wtf crazy shit devil :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 03, 2009, 06:40:03 pm
btw, it's infinite :L
Title: Re: Funny Videos/Pictures
Post by: some_punk on December 03, 2009, 07:11:28 pm
it's good to be MacGyver
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 03, 2009, 08:38:58 pm
I played it like 3 times over again, it was fine. :P
Title: Re: Funny Videos/Pictures
Post by: MadMax on December 03, 2009, 09:38:58 pm
fast as fuck ?
https://www.youtube.com/watch?v=dkHXtftl2dk
*1/8 mile, not 1/4
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 03, 2009, 09:48:05 pm
Why you type 1/8 that small lol
Title: Re: Funny Videos/Pictures
Post by: MadMax on December 03, 2009, 10:41:41 pm
coz 1/8 mile drag is shit lol


(http://obczaj.net/obrazki/87535.jpg)

-------------------------------------------------------------------------------------------
facebook additced ?
(http://obczaj.net/obrazki/87709.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on December 03, 2009, 11:41:22 pm
lol

horse pop
Title: Re: Funny Videos/Pictures
Post by: MadMax on December 04, 2009, 04:43:55 pm
(http://obczaj.net/obrazki/87839.jpg)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 04, 2009, 05:42:31 pm
A ball !! A testicle !!
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on December 04, 2009, 05:48:35 pm
that one is quite fun and disturbing at the same time XD
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 04, 2009, 11:15:16 pm
does someone miss a ball ? :P
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 05, 2009, 08:33:43 am
does someone miss a ball ? :P
yes, it's yours :L


hah, this is pretty interesting
https://www.youtube.com/watch?v=AfDWdIh8BLU
Title: Re: Funny Videos/Pictures
Post by: some_punk on December 05, 2009, 07:52:09 pm
ye... im skateboarder too since i was 16 y.o.
skimboarder since 21 y.o.
https://www.youtube.com/watch?v=b2RnazoEkUw
https://www.youtube.com/watch?v=sHzeDfKr0MI
https://www.youtube.com/watch?v=0bgvOV9Auzw
https://www.youtube.com/watch?v=n3INJUUiKaI
https://www.youtube.com/watch?v=kQq_9o0Jvi8
https://www.youtube.com/watch?v=pSCKlx7Bx0s
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on December 05, 2009, 08:31:26 pm
and where is the damn fun? wrong topic bunnies, or if you think this is fun ITS NOT FUN AT ALL
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 05, 2009, 10:13:29 pm
Maybe for someone else ?
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on December 06, 2009, 01:28:41 am
Rodney Mullen = Legend
Title: Re: Funny Videos/Pictures
Post by: MadMax on December 06, 2009, 01:47:10 am
(http://i4.demotywatory.pl/uploads/1259791148_by_kiku90_500.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 06, 2009, 07:07:52 pm
(http://files.uploadffs.com/a/5/92f05b09/HAHAHA.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 06, 2009, 07:13:22 pm
lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on December 07, 2009, 10:52:11 am
young :L :L
Title: Re: Funny Videos/Pictures
Post by: Lewis on December 07, 2009, 05:01:40 pm
https://www.youtube.com/watch?v=PWNLPl7oIRc
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on December 08, 2009, 09:59:30 pm
Don't breath this!  ;D

https://www.youtube.com/watch?v=vZhWd6nvcWc
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on December 09, 2009, 05:53:53 pm
https://www.youtube.com/watch?v=ldY2s9fxuPs
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 09, 2009, 05:57:13 pm

 .  .
  O
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on December 09, 2009, 06:12:34 pm
what the fuck? ??? ???? ??? ???
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on December 09, 2009, 06:14:06 pm
 ??? ??? :'(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 09, 2009, 06:14:11 pm
(gayy)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on December 09, 2009, 06:52:52 pm
kinda disturbing
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 09, 2009, 07:45:49 pm
meh... that's no fun at all moo.. :(
Title: Re: Funny Videos/Pictures
Post by: ivanduk on December 09, 2009, 09:01:32 pm
LOOL


(http://photos-d.ak.fbcdn.net/hphotos-ak-snc3/hs120.snc3/16743_101358536554660_100000415435121_36770_4381065_n.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on December 09, 2009, 09:11:46 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 09, 2009, 10:04:12 pm
kewl :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on December 09, 2009, 10:14:13 pm
lól

and farts are nitro
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 09, 2009, 10:45:38 pm
Farts...

(http://i47.tinypic.com/11b0njk.png)
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on December 10, 2009, 12:38:30 pm
Ha ha.

https://www.youtube.com/watch?v=D9sXhYlIfRY
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 10, 2009, 04:23:17 pm
:L
Title: Re: Funny Videos/Pictures
Post by: some_punk on December 10, 2009, 05:57:44 pm
https://www.youtube.com/watch?v=ldY2s9fxuPs

this kind of video takes me to think over or meditate.... when im down or when i think that everything is a shit, it really isnt... sometimes when i go in street i saw ppl more "fucked" than me, for every thing that u want to think: bumps, more pour, more ugly, deformed ppl, kids with down syndrome, without parents, without health..... it could be anything.
Shit!! I'm completly normal (i meant in my body), i got health, I got my parents still alive, i got my friends, i go to university.... maybe i dont do trips around the world, maybe i dont get a Ferrari.... but videos like this shows me that i must be happy for every things that i got now.... and maybe i must be less moaning...

Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 10, 2009, 06:16:34 pm
Ha ha.



Thats really extreme lol



this kind of video takes me to think over or meditate.... when im down or when i think that everything is a shit, it really isnt... sometimes when i go in street i saw ppl more "fucked" than me, for every thing that u want to think: bumps, more pour, more ugly, deform, kids with down syndrome, without parents, without health..... it could be anything.
Shit!! I'm completly normal (i meant in my body), i got health, I got my parents still alive, i got my friends, i go to university.... maybe i dont do trips around the world, maybe i dont get a Ferrari.... but videos like this shows me that i must be happy for every things that i got now.... and maybe i must be less moaning...

Thats a thing we should always keep in mind, we sometimes cant.But we see stuff like this to remind us, just take advantage of it, Thank God.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on December 10, 2009, 06:29:02 pm
it's funny as fuck lol. i'm not deformed so yay :D
Title: Re: Funny Videos/Pictures
Post by: ivanduk on December 10, 2009, 06:44:49 pm
(http://www.snorgtees.com/images/brb_fullpic_2.jpg)
Title: Re: Funny Videos/Pictures
Post by: some_punk on December 10, 2009, 06:49:21 pm
it's funny as fuck lol. i'm not deformed so yay :D

viva snoopy  -.-
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on December 10, 2009, 06:57:09 pm
english or else lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 10, 2009, 07:48:25 pm
you don't know viva :L ?

its same as vive la france
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on December 10, 2009, 08:04:33 pm
i don't care lol, people should talk to/about me in english, i find it very disrespectful :-\
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 10, 2009, 08:58:17 pm
I know, I want people to talk to me in Dutch and/or English too :L

Despite I understand a little bit of what people are talking about in France or Spanish I don't to be spoken to in any other language as Dutch or English. And I understand a lot when people are talking German :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on December 11, 2009, 03:31:34 pm
(http://18.media.tumblr.com/tumblr_kudj19223Y1qapmybo1_500.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on December 11, 2009, 03:34:59 pm
What the fuck, dolphins. There are no dolphins xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on December 11, 2009, 03:39:08 pm
It's funny you mention that... my friend sent me this picture, told her exactly the same thing. :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 11, 2009, 03:53:32 pm
haha, it took me a long time to find the dolphins but i can see them now lol
not nine ones though  :-\
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 11, 2009, 04:07:15 pm
my mind is incorrupted, but didnt need that to know :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 11, 2009, 07:26:21 pm
Hmm really interesting, i didnt believe there are dolphins but after reading posts up here, i found them all lol.
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 11, 2009, 09:15:28 pm
I'm trying so hard, but I only find 3 of them :(
Title: Re: Funny Videos/Pictures
Post by: ivanduk on December 11, 2009, 09:18:33 pm
I can only find 1 dolphin, the one with vagina for his tail
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 11, 2009, 09:21:41 pm
I'm at 6 dolphins at the moment :L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on December 11, 2009, 09:52:54 pm
haha same lol, i found 5 more
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on December 11, 2009, 09:59:39 pm
I can only see the vaginal one, meh, Im too disturbed to see good side of something, I just see the best side :P
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 11, 2009, 10:55:21 pm
So its a proof of; the best is not always the good lol


BTW there are "10" dolphins not 9

I marked them right here but DONT click if you want to find all 10 yourself, then check out.

Click me if you're not interested (http://i47.tinypic.com/dgpgte.jpg)

Yea my mouse is perfect at drawing... :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on December 11, 2009, 11:18:15 pm
That's a great optical illusion  :D
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 11, 2009, 11:32:15 pm
yeh lovely, i love them xD

I just remembered there is a story i heard about hidden dolphins, but cant remember enough to tell.
But i know this; there was 7 dolphins hidden inside "nothing", yes a mess of colours... :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on December 12, 2009, 12:16:28 am
9 Dolphins hidden in eroticism is better. ;_;
Title: Re: Funny Videos/Pictures
Post by: MadMax on December 12, 2009, 05:25:32 pm
...and don't tell me NASCAR is boring, please

https://www.youtube.com/watch?v=6UJ5jD6OJiE
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 12, 2009, 06:35:07 pm
(http://www.mrtees.com/images/Nascar-Boring.gif) :L

I dont say anything, the picture says something.And nascar is REALLY COOL when you see some touches turning into massacre. :) e.g. @ 2.30
Title: Re: Funny Videos/Pictures
Post by: MadMax on December 12, 2009, 06:56:39 pm
(http://img143.imageshack.us/img143/268/bored5iu.jpg)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 12, 2009, 07:02:04 pm
(http://img143.imageshack.us/img143/268/bored5iu.jpg)

:L Instant Reply ®

http://www.facebook.com/video/video.php?v=214206387648&ref=nf

I couldnt find on youtube, its insane! Just same as the real car lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 12, 2009, 08:29:39 pm
nascar is driving in an oval
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 12, 2009, 09:44:44 pm
http://www.nascar.com/races/tracks/

Are you sure ? :-\ Nascar has normal circuit races also.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 12, 2009, 10:07:50 pm
(http://files.uploadffs.com/a/1/732b1a3f/12122009_230458.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on December 12, 2009, 10:09:30 pm
lol  :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on December 12, 2009, 10:11:41 pm
WE ARE POPULAR!  8)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 12, 2009, 10:20:59 pm
some guest wants to apply for the tournament :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on December 12, 2009, 11:17:34 pm
guest viewing topic squ4l0
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 12, 2009, 11:26:30 pm
hahaha, look at Joe's birthday :L
(http://files.uploadffs.com/a/4/4145429a/kjggkggggg.jpg)
Title: Re: Funny Videos/Pictures
Post by: ivanduk on December 12, 2009, 11:53:21 pm
(http://i351.photobucket.com/albums/q461/kevlq/402px-Chuck_norris_toilet_paper.png)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 13, 2009, 12:01:26 am
I hate Chuck Norris, what's so damn funny about the dude?
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on December 13, 2009, 01:39:19 am
dude I so totally agree with you, most stupid trend ever, even worse than cm punk fans
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 13, 2009, 10:06:39 am
yeah, Rambo pawns Chuck Norris  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on December 13, 2009, 11:55:44 am
1st part best  of rambo
Title: Re: Funny Videos/Pictures
Post by: MadMax on December 13, 2009, 01:01:06 pm
If you have five dollars and Chuck Norris has five dollars, Chuck Norris has more money than you.

There is no 'ctrl' button on Chuck Norris's computer. Chuck Norris is always in control.

Apple pays Chuck Norris 99 cents every time he listens to a song.

Chuck Norris can sneeze with his eyes open.

Chuck Norris can eat just one Lay's potato chip.

Chuck Norris is suing Myspace for taking the name of what he calls everything around you.

Chuck Norris destroyed the periodic table, because he only recognizes the element of surprise.

Chuck Norris can kill two stones with one bird.

When the Boogeyman goes to sleep every night, he checks his closet for Chuck Norris.

Chuck Norris doesn't read books. He stares them down until he gets the information he wants.

There is no theory of evolution. Just a list of creatures Chuck Norris has allowed to live.

Outer space exists because it's afraid to be on the same planet with Chuck Norris.

Chuck Norris does not sleep. He waits.

Chuck Norris is currently suing NBC, claiming Law and Order are trademarked names for his left and right legs.

Chuck Norris is the reason why Waldo is hiding.

Chuck Norris counted to infinity - twice.

There is no chin behind Chuck Norris’ beard. There is only another fist.

When Chuck Norris does a pushup, he isn’t lifting himself up, he’s pushing the Earth down.

Chuck Norris is so fast, he can run around the world and punch himself in the back of the head.

Chuck Norris’ hand is the only hand that can beat a Royal Flush.

Chuck Norris can lead a horse to water AND make it drink.

Chuck Norris doesn’t wear a watch, HE decides what time it is.

Chuck Norris can slam a revolving door.

Chuck Norris does not get frostbite. Chuck Norris bites frost

Remember the Soviet Union? They decided to quit after watching a DeltaForce marathon on Satellite TV.

Contrary to popular belief, America is not a democracy, it is a Chucktatorship.
----------------------------------------------------------------------------------------------------------------------------------
http://obczaj.net/pl/ <-- CHECK THIS, VERY FUNNY (no porn, no virus, clean)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 13, 2009, 01:16:31 pm
Ehh, no.

Fuck Chick Norris
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 13, 2009, 02:21:25 pm
I dont get why is he the person mention in those jokes, no other person ? Whats his speciality ? I like his movies lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 13, 2009, 03:00:23 pm
http://obczaj.net/pl/ <-- CHECK THIS, VERY FUNNY (no porn, no virus, clean)
hah, racist jokes
but this one is great :L :L
(http://obczaj.net/obrazki/88789.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 13, 2009, 03:01:41 pm
hahahah I really like that one :L

btw, I found ironmans wifey :L

(http://www.myextralife.com/wp-content/uploads/2007/12/hot-chick-ugly.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 13, 2009, 06:49:01 pm
hahaha :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on December 14, 2009, 11:36:50 am
(http://img.perezhilton.com/wp-content/uploads/2009/12/original-1__oPt.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Phil_Ivey on December 14, 2009, 12:29:12 pm
those racist jokes are too funny rofl
Title: Re: Funny Videos/Pictures
Post by: ivanduk on December 14, 2009, 02:45:12 pm
https://www.youtube.com/watch?v=h4xZMEqg7jQ

T-mobile commercial :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 14, 2009, 04:12:15 pm
haha i have seen it on TV already :L
probably because originally it's a czech commercial lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 14, 2009, 04:16:31 pm
stupid language (gayy)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on December 14, 2009, 04:38:19 pm
oh dear
Title: Re: Funny Videos/Pictures
Post by: [MAF]Rac3r on December 14, 2009, 05:52:46 pm
Quote
majidali19 (2 months ago) Show Hide
+7
It reminds me of Grand Theft Auto San-Andreas.
https://www.youtube.com/watch?v=1KVn3lajzjs
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 14, 2009, 06:28:02 pm
Any news about that jetpack ?
Title: Re: Funny Videos/Pictures
Post by: ivanduk on December 14, 2009, 09:49:58 pm
It runs on steam, so it can fly in the air for only 40 seconds


Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on December 14, 2009, 10:26:46 pm
fail
Title: Re: Funny Videos/Pictures
Post by: some_punk on December 15, 2009, 04:33:53 am
watch out with roadtop... LOL
https://www.youtube.com/watch?v=16wXhiYXEaw
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on December 15, 2009, 05:07:07 am
roflmfao
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 15, 2009, 02:01:05 pm
https://www.youtube.com/watch?v=ZN5PoW7_kdA
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on December 15, 2009, 02:10:53 pm
i love those :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on December 15, 2009, 03:15:52 pm
hahah same
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 15, 2009, 03:49:30 pm
me too  :D
Title: Re: Funny Videos/Pictures
Post by: some_punk on December 16, 2009, 04:42:13 am
https://www.youtube.com/watch?v=lC6dWYkuo7c
https://www.youtube.com/watch?v=ydyw5R0vuVM
https://www.youtube.com/watch?v=ghqAQ-2oH2Q
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on December 16, 2009, 06:17:14 am
hmmm wonder where is the fun

here something that Im sure will get at least a smile out

https://www.youtube.com/watch?v=jzs7ICVKlRA
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 16, 2009, 11:04:30 am
I'm not going to look 4 minutes to that stupid hamster lol
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on December 16, 2009, 12:35:32 pm
lol @ ush
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on December 16, 2009, 03:35:30 pm
aw u dont like my lovely stupid hamster?
Title: Re: Funny Videos/Pictures
Post by: some_punk on December 16, 2009, 03:44:58 pm
I'm not going to look 4 minutes to that stupid hamster lol

^

so... this is funny huh??

i did piss on me -.- [...]
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on December 16, 2009, 04:04:47 pm
you pissed on yourself?
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 16, 2009, 04:16:46 pm
ahh groose
Title: Re: Funny Videos/Pictures
Post by: some_punk on December 16, 2009, 04:56:04 pm
you pissed on yourself?

when someone laughs a lot, that one can laugh until piss himself

its a common saying
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on December 16, 2009, 05:09:39 pm
I'm not going to look 4 minutes to that stupid hamster lol

^

so... this is funny huh??

i did piss on me -.- [...]

ya, quite funnier than 3 girls playing guitar hero
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 16, 2009, 05:10:50 pm
I'm not going to look 4 minutes to that stupid hamster lol

^

so... this is funny huh??

i did piss on me -.- [...]

ya, quite funnier than 3 girls playing guitar hero

the annoying orange I posted on the previous page is way funnier :L
Title: Re: Funny Videos/Pictures
Post by: some_punk on December 16, 2009, 05:13:28 pm
Quote
the annoying orange I posted on the previous page is way funnier :L

yeee... XD that orange reminds me fernando almeja lol..

Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on December 16, 2009, 05:26:45 pm
yeee... XD that orange reminds me fernando almeja lol..

init
Title: Re: Funny Videos/Pictures
Post by: MadMax on December 17, 2009, 12:40:08 am
(http://obczaj.net/obrazki/89482.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on December 17, 2009, 12:50:59 am
why you cant sleep :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 17, 2009, 06:55:11 pm
Easy to read it but it feels like flashing so bad.
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on December 18, 2009, 08:35:01 am
probably a repost but i laugh every time :L
https://www.youtube.com/watch?v=8DxKG2EW1Hc
Title: Re: Funny Videos/Pictures
Post by: [MAF]Rac3r on December 18, 2009, 10:14:33 am
lol I thought the two of the dragsters were going to fail.

I've watched it twice, laughed both times. Good un'.

EDITl:  3/3 now
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on December 18, 2009, 10:18:13 am
You want funny fails, check this website out, there is loads on it and a new one posted every day:

www.todaysbigfail.com

Classic: http://www.todaysbigfail.com/view/20080811
Title: Re: Funny Videos/Pictures
Post by: [MAF]Rac3r on December 18, 2009, 10:29:50 am
Holy shit, silly bastards lol That was so close to a fucking total burn out!
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on December 18, 2009, 10:34:39 am
I must have a black heart, i get proper lols at the bloke when he rolling on the floor screaming.
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on December 18, 2009, 12:56:40 pm
http://www.todaysbigfail.com/view/20080812 hahahaha nguahguahguha oooh ughg ooooh
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on December 18, 2009, 01:05:53 pm
lol, she makes some proper lollage winded sounds.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Rac3r on December 18, 2009, 01:21:44 pm
lol

This one is great! Probably why it was number 1.

http://www.todaysbigfail.com/view/20091106
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on December 18, 2009, 04:12:39 pm
and its tunning up the band....1.....2.....3.....4.....5..... Sweet Chin Music

http://www.todaysbigfail.com/view/20080917
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 19, 2009, 10:29:12 am
lol

This one is great! Probably why it was number 1.

http://www.todaysbigfail.com/view/20091106
Holy fail... He got whole warehouse down and sure his job down too! :P

LSD Effect lol
Nice effects

https://www.youtube.com/watch?v=h9EpnVAl5JA
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on December 19, 2009, 04:03:26 pm
hahaha awesome, I heard you have hard time to recognize yourself in a mirror
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 19, 2009, 08:03:41 pm
Yes cause of the dirt in the mirror, im looking hard to find a clear spot.
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on December 22, 2009, 11:32:50 am
(http://5.media.tumblr.com/tumblr_kuwmneuWUG1qaobyfo1_250.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 22, 2009, 12:27:55 pm
epic :L
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on December 22, 2009, 02:15:37 pm
(http://5.media.tumblr.com/tumblr_kuwmneuWUG1qaobyfo1_250.gif)

:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on December 22, 2009, 02:41:15 pm
(http://files.uploadffs.com/b/8/1b56847b/snoteater.gif)
:(
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on December 22, 2009, 02:49:42 pm
Awful  :-X
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 22, 2009, 02:51:21 pm
(http://www.hetmeisjedatopdinsdaghetbierschenkt.nl/wp-content/uploads/2008/12/poop-shoot.jpg)

(http://files.uploadffs.com/b/8/1b56847b/snoteater.gif)
:(

(http://wiegertjepostma.files.wordpress.com/2009/05/ieuw_phixr.jpg)

:(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on December 22, 2009, 02:52:36 pm
(http://files.uploadffs.com/b/8/1b56847b/snoteater.gif)

ffs
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on December 22, 2009, 02:53:51 pm
(http://wiegertjepostma.files.wordpress.com/2009/05/ieuw_phixr.jpg)
wtf :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on December 22, 2009, 03:09:26 pm
moo is that you in your avatar? :o
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on December 22, 2009, 03:09:57 pm
nah :L
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on December 22, 2009, 03:19:43 pm
Lol moomanovic @ your avatar
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 22, 2009, 04:14:45 pm
moo is that you in your avatar? :o

he is on ax forum :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 22, 2009, 08:49:15 pm
I remember some people here fan of splinter cell, here is a nice coop story gameplay trailer. :)

Splinter Cell Conviction

https://www.youtube.com/watch?v=K7wb86fz7Ic
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 22, 2009, 09:41:02 pm
humm cool
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on December 23, 2009, 02:57:14 pm
https://www.youtube.com/watch?v=A2guQYivZ6w
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 23, 2009, 03:44:23 pm
hahaaa :L :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 23, 2009, 05:35:46 pm
Ooooops Mr.Bird ruins the scene :L

(http://cache.gawker.com/assets/images/jalopnik/2009/11/bird_crap_google.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 23, 2009, 06:30:16 pm
hahaha LOOOOOOOL love hahaha :L thats so funny :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 23, 2009, 09:34:50 pm
LMAO!! :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 24, 2009, 03:12:00 pm
More "The annoying orange"

Part 2.
https://www.youtube.com/watch?v=l7F5nIA8xmw

Part 3.
https://www.youtube.com/watch?v=xjdBCeUdAmI

And part 4, uploaded yesterday.
https://www.youtube.com/watch?v=fOxg8hT30r0
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 24, 2009, 07:17:50 pm
What an annoying orange :L
Title: Re: Funny Videos/Pictures
Post by: ǝǝǝoſ[sXɐ] on December 24, 2009, 08:04:09 pm
Reminds me of my pet orange before he died :'(. Stupid noob got shot by a chicken and died >:(.

Ontopic: Epic fail game names:
https://www.youtube.com/watch?v=yQLQ-NCUbtU
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 24, 2009, 08:22:01 pm
Do they really exist ? :L
All weirdos & good commentary.

If it moves, shoot it!
If it lives, shoot it again :L

Looooolz at 51
Death by Dying...
Title: Re: Funny Videos/Pictures
Post by: ivanduk on December 24, 2009, 08:24:32 pm
(http://photos-e.ak.fbcdn.net/hphotos-ak-snc3/hs202.snc3/20931_1313280154239_1297735150_30932329_4963891_n.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on December 24, 2009, 08:33:21 pm
(http://photos-e.ak.fbcdn.net/hphotos-ak-snc3/hs202.snc3/20931_1313280154239_1297735150_30932329_4963891_n.jpg)
"hopefull" still gets a tick? :(
Title: Re: Funny Videos/Pictures
Post by: ivanduk on December 25, 2009, 01:11:23 pm
https://www.youtube.com/watch?v=Ujkkuf5T_xY
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on December 25, 2009, 02:47:59 pm
looooooooool
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on December 25, 2009, 02:54:55 pm
Cba to watch whole video. What a tard  :-X
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 25, 2009, 05:26:04 pm
omg, total idiot
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on December 25, 2009, 05:30:23 pm
he is awesome, he should make more extreme videos
Title: Re: Funny Videos/Pictures
Post by: MadMax on December 25, 2009, 06:10:54 pm
ye, love these extreme videos
https://www.youtube.com/watch?v=zrSwaA-FAj4
https://www.youtube.com/watch?v=S4YbC6OLAlo

and another persons
https://www.youtube.com/watch?v=Sf8cM7f6P2I
https://www.youtube.com/watch?v=GWptcrms0hc
https://www.youtube.com/watch?v=klebaGtX9R8
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 25, 2009, 07:50:07 pm
http://mojevideo.cz/view.php?id=4652
http://mojevideo.cz/view.php?id=4562
http://mojevideo.cz/view.php?id=4643
Title: Re: Funny Videos/Pictures
Post by: MadMax on December 26, 2009, 12:31:44 pm
(http://obczaj.net/obrazki/91057.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on December 26, 2009, 10:44:03 pm
(http://paski.org/paski/kupa.jpg)
NEO kid
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on December 26, 2009, 11:06:11 pm
NEO xDDDDD
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 29, 2009, 09:46:44 am
What a great person he is :L

(http://mmreddy.nomadlife.org/uploaded_images/RickAstley-717066.jpg)
Title: Re: Funny Videos/Pictures
Post by: ivanduk on December 30, 2009, 07:14:00 pm
(http://photos-g.ak.fbcdn.net/hphotos-ak-snc3/hs058.snc3/14566_209776468748_209774958748_3067376_2442551_n.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on December 30, 2009, 07:39:15 pm
(http://media.ebaumsworld.com/picture/capnmorgan2007/UglierGirlfriends.png)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 30, 2009, 09:55:02 pm
What a loop.

There is no dummy coming out of nowhere, check carefully. :L

(http://jahmdesigns.com/images/stick_people_R.gif)

Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on December 30, 2009, 11:09:57 pm
haha, the one sitting in the bottom right corner
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on December 30, 2009, 11:21:08 pm
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on December 30, 2009, 11:22:00 pm
omg :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on December 31, 2009, 12:41:41 am
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on December 31, 2009, 08:45:14 pm
Haha m-ooman(on purpose moo :L)  made a trend out of this. :L

Yes.. With all that spam, its still infinite.We dont lose any dummy. :L

NOW we will lose some of them :L

(http://i50.tinypic.com/vxjm0y.png)
(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)(http://jahmdesigns.com/images/stick_people_R.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on January 01, 2010, 02:10:47 am
(http://consumerist.com/relativeprices.jpg)

 :-\
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on January 01, 2010, 05:02:48 pm
(http://imgur.com/pRmNZ.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on January 01, 2010, 05:12:47 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 01, 2010, 05:22:05 pm
haha :L

Not funny, but amazing.. this is just madness :L

https://www.youtube.com/watch?v=QgutBgcZhFw
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on January 01, 2010, 10:17:33 pm
O.o quick stuff.I think this thing is worse than road races when you make a mistake. ???
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on January 02, 2010, 04:06:46 pm
https://www.youtube.com/watch?v=ITHRvEXz2Y0
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on January 02, 2010, 09:09:08 pm
Couldn't understand what he was saying lol. Hmm.. He's been playing MW2 for 17 hours :L and he got obsessed with someting. Jesus, just look at him :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on January 03, 2010, 01:18:15 am
What the ?! At least its not MMO game.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on January 03, 2010, 11:42:49 am
give kid camera...
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on January 04, 2010, 05:16:50 pm
Just for moo:

https://www.youtube.com/watch?v=f9iIgQN5uZE
Title: Re: Funny Videos/Pictures
Post by: [UK]SheepFucka on January 04, 2010, 05:19:22 pm
ooo ouch!
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on January 04, 2010, 06:06:26 pm
:O
Title: Re: Funny Videos/Pictures
Post by: MadMax on January 04, 2010, 08:31:33 pm
https://www.youtube.com/watch?v=Xv5J5cBwwFc

real ?
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on January 04, 2010, 08:42:28 pm
seems real, I think the distance is safe enough, would be awesome to see that
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on January 04, 2010, 09:10:19 pm
What? Of course it is real lol. Nice speed though
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on January 04, 2010, 10:23:24 pm
Hmm nice view.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 04, 2010, 11:24:43 pm
lol, offensive results :L
(http://files.uploadffs.com/c/f/3852ff92/obamaswife.JPG)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 04, 2010, 11:41:15 pm
LOOOOOOOOOOOL THIS IS FUCKING HILARIOUS :L :L :L

https://www.youtube.com/watch?v=NVEVs135mZs
Title: Re: Funny Videos/Pictures
Post by: [FSR]Mach5 on January 04, 2010, 11:42:36 pm
100th page  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on January 05, 2010, 12:28:13 am
people are scared of some really strange things :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on January 05, 2010, 12:45:12 am
Really, really and really strange :L

Google has nothing to do but agree with offensive results :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 05, 2010, 12:57:22 am
Arachibutyrophobia- Fear of peanut butter sticking to the roof of the mouth.

This is not a video or photo, but still funny.

List of all phobias.
http://www.phobialist.com/

I'm having logizomechanophobia and logophobia, it's so scary to post this that I let someone else type.

But I don't talk with anyone cause I also suffer of laliophobia.
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on January 05, 2010, 07:59:27 am
I'm having Acrophobia but not the strongest level of that. I just dislike very tall buildings :L

And wooo my first topic with 100 pages  ;D
Title: Re: Funny Videos/Pictures
Post by: [UK]SheepFucka on January 05, 2010, 02:51:08 pm
lol fear of peaches? wow thats crazy.. only thing i dislike is those "daddy long legs" look like flyin spiders eeeek horrible! they always come flyin near ya D: http://images.wikia.com/uncyclopedia/images/thumb/c/c9/Daddy_Long_Legs.jpg/180px-Daddy_Long_Legs.jpg
Title: Re: Funny Videos/Pictures
Post by: ivanduk on January 05, 2010, 04:26:01 pm
Some of you will probably laugh at me, but a have a phobia of moths. I don't know why, but I can't stand them  :-X

(http://bugs.bio.usyd.edu.au/learning/resources/Entomology/images/Topics/importance/bogongMoth.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on January 05, 2010, 04:35:24 pm
laugh?
nothing funny
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on January 05, 2010, 06:03:23 pm
Hmm, beside peach its nothing.

Scaring from flying little creatures are way easy.I scare too when i see some over-grown fly lol.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 05, 2010, 06:11:48 pm
lol fear of peaches? wow thats crazy.. only thing i dislike is those "daddy long legs" look like flyin spiders eeeek horrible! they always come flyin near ya D: http://images.wikia.com/uncyclopedia/images/thumb/c/c9/Daddy_Long_Legs.jpg/180px-Daddy_Long_Legs.jpg

Hah I hate them too, I always get scared when I see it flying around :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on January 05, 2010, 07:12:13 pm
moskitoes: squash em when they are standing on a wall, moths: swing a shoe at them, instant kill
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on January 05, 2010, 07:19:25 pm
i don't have a phobia of mosquitos but i really really hate them. they love to bite me and buzz around my head when i'm trying to get to sleep. it'd drive me insane :L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on January 05, 2010, 07:30:51 pm
Yeah, they're so fucking annoying, last summer I was in a house near a lake, and there it was crawling with mosquitos. Believe me, newspaper is the best object to kill them with :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on January 05, 2010, 09:12:07 pm
ye they are very annoying in nigh
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 05, 2010, 09:18:21 pm
so you are one of them lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on January 05, 2010, 09:21:24 pm
Black African Grilos. I don't have a phobia of them but they look so tough lol

(http://4.bp.blogspot.com/_cKUtdWbDgC0/SMWLwjaGjKI/AAAAAAAABr0/3HDPvROPAr0/s400/grilo_do_campo.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 05, 2010, 09:40:21 pm
List of all phobias.
http://www.phobialist.com/

LOL Russophobia - Fear of Russians.  :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on January 05, 2010, 09:42:18 pm
they will hack you :-X
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 05, 2010, 09:42:44 pm
 :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on January 05, 2010, 10:02:24 pm
Alliumphobia- Fear of garlic.
vampires!
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on January 05, 2010, 10:05:51 pm
Detective Monk has all these phobias :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on January 06, 2010, 01:37:35 am
easy solution for moskitoes: turn a fan on
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 06, 2010, 09:27:54 am
easy solution for moskitoes: turn a fan on

or start smoking :L
or get a mosquito net :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on January 06, 2010, 11:40:24 pm
https://www.youtube.com/watch?v=Ci8n8vhrtMg
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 06, 2010, 11:41:49 pm
Haha I saw that one today, had a good lol  ;D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Mach5 on January 07, 2010, 12:12:04 am
:L this is so funny
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on January 07, 2010, 03:12:34 am
haha   :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on January 07, 2010, 10:44:27 am
:L :L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on January 07, 2010, 02:18:20 pm
https://www.youtube.com/watch?v=_NLXlZivlyA

:L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 07, 2010, 05:10:57 pm
he looks like a poof

and Family Guy FTW! :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 08, 2010, 12:02:14 pm
woo spongebob  :D

(http://shinymedia.blogs.com/photos/uncategorized/spongebob.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on January 08, 2010, 01:48:16 pm
spongeboobs
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 08, 2010, 02:00:59 pm
haha max :L nice one
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 08, 2010, 10:30:10 pm
She's got some stickers on her nipples lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Mach5 on January 09, 2010, 12:06:44 am
:L
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on January 09, 2010, 12:13:39 pm
https://www.youtube.com/watch?v=SWXcDZNgOWs
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 09, 2010, 03:04:39 pm
fucking nice and funny :L

http://theskunk.org/2009/08/congressman-legalizes-pot-for-himself/
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 09, 2010, 04:22:25 pm
lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 09, 2010, 05:34:36 pm
https://www.youtube.com/watch?v=_tb_5Nn7-6w
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on January 09, 2010, 06:13:12 pm
Hmmmm kay
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on January 09, 2010, 06:31:47 pm
(http://i47.tinypic.com/16m90jt.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 09, 2010, 07:13:42 pm
rofl that guy wanna die or what :L
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on January 09, 2010, 07:35:48 pm
https://www.youtube.com/watch?v=cf8a-32bDMo
Title: Re: Funny Videos/Pictures
Post by: Bobo on January 09, 2010, 07:49:37 pm
http://www.youtube.com/watch?v=urq1L6a13uQ
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on January 09, 2010, 08:43:12 pm
hilarious
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on January 09, 2010, 08:46:20 pm
https://www.youtube.com/watch?v=L1BDM1oBRJ8
Title: Re: Funny Videos/Pictures
Post by: [AK47]skunk on January 09, 2010, 09:08:22 pm
[youtube]
I think that this oranges got high ;D

rofl that guy wanna die or what :L
Maybe he is smoking unvisible joints ;D

Bobo heh ja na swoje urodziny kuchnie podjaralem :(

[youtube]
:(
Title: Re: Funny Videos/Pictures
Post by: MadMax on January 09, 2010, 09:12:43 pm
(http://obczaj.net/obrazki/92656.jpg)
Title: Re: Funny Videos/Pictures
Post by: [AK47]skunk on January 09, 2010, 09:19:08 pm
O kurwa Madmax very funny :D

Something from me :) Unbore doors :P

(http://img697.imageshack.us/img697/9536/defendius2doorlock.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on January 09, 2010, 09:20:55 pm
(http://obczaj.net/obrazki/92464.jpg)
(http://obczaj.net/obrazki/92472.jpg)
Title: Re: Funny Videos/Pictures
Post by: falco355 on January 09, 2010, 09:34:36 pm
https://www.youtube.com/watch?v=_tb_5Nn7-6w

french style lol  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 09, 2010, 09:57:06 pm
(http://obczaj.net/obrazki/92464.jpg)

haha :L
Title: Re: Funny Videos/Pictures
Post by: [UK]SheepFucka on January 09, 2010, 10:02:29 pm
rofl
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on January 10, 2010, 05:56:40 pm
:o

https://www.youtube.com/watch?v=PGlerZNyvEM
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 10, 2010, 06:57:38 pm
wtf
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on January 11, 2010, 12:22:43 pm
https://www.youtube.com/watch?v=HbwAunLpYYw
Title: Re: Funny Videos/Pictures
Post by: [MAF]PyroFox on January 12, 2010, 06:31:29 pm
http://www.jaimelegif.com/ (http://www.jaimelegif.com/)

Keep scrolling down :o
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 12, 2010, 06:44:48 pm
hm cool, poor chickens though  :(
Title: Re: Funny Videos/Pictures
Post by: [2F2F]fure on January 13, 2010, 01:20:33 pm
Im never coming back on this thread.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on January 13, 2010, 01:30:13 pm
i didn't wanna see that lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on January 13, 2010, 01:33:37 pm
aww removed. :-\

Though it did hurt looking at it :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 13, 2010, 02:42:02 pm
aww removed. :-\

Though it did hurt looking at it :L

indeed. :o
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on January 13, 2010, 03:38:33 pm
lol I missed it
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on January 13, 2010, 08:32:54 pm
meh 2
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on January 13, 2010, 09:14:50 pm
Want to see it? I can send in pm :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on January 13, 2010, 09:18:57 pm
ive seen it thanks, probably Disturbed did see too.
Dont wanna see it  again :L how did he let himself be put up like that :/
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on January 13, 2010, 09:20:01 pm
I didnt see it, pm me
Title: Re: Funny Videos/Pictures
Post by: [AK47]skunk on January 13, 2010, 09:21:29 pm
https://www.youtube.com/watch?v=b1aHP_ylxEU
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on January 13, 2010, 09:22:10 pm
I didnt see it, pm me

pm sent, lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on January 13, 2010, 09:24:35 pm
buahahahahahaha thats hilarious, stupid asshole XD

and fatal video (I think) not as fun as the pic HAHAHAHAHAHA
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on January 13, 2010, 09:25:55 pm
I knew you would come up with a comment like this :L


Thats sad, only sad.
Title: Re: Funny Videos/Pictures
Post by: ivanduk on January 13, 2010, 10:33:12 pm
Sent it to me too, i didnt saw it(whatever you were watching :o)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on January 13, 2010, 10:37:06 pm
u sure? I mean its very fun, but some people might get shocked
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 13, 2010, 11:25:45 pm
https://www.youtube.com/watch?v=b1aHP_ylxEU

Hooooly shit !!!  :o
Epic fail indeed
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 13, 2010, 11:30:30 pm
haha nice

(http://media.ebaumsworld.com/2007/11/Hungry_Elephant.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on January 14, 2010, 12:50:05 am
literally smelling his ass
Title: Re: Funny Videos/Pictures
Post by: MadMax on January 14, 2010, 04:08:01 pm
(http://obczaj.net/obrazki/93092.jpg)
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on January 14, 2010, 04:22:15 pm
Not it's intended reaction, but this advert always makes me lol

https://www.youtube.com/watch?v=K54-kgkPyek
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on January 15, 2010, 01:51:49 am
https://www.youtube.com/watch?v=TJRTg3Wau9M
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on January 15, 2010, 06:44:21 am
Puta puta!! :L
Title: Re: Funny Videos/Pictures
Post by: some_punk on January 15, 2010, 08:52:51 am
https://www.youtube.com/watch?v=NMMFSCMR0Dc


its in spanish, but i think that u will know what hes doing!! LOL
https://www.youtube.com/watch?v=kWQVQl_Yz6k
Title: Re: Funny Videos/Pictures
Post by: [UK]SheepFucka on January 15, 2010, 04:23:10 pm
haha spongebob is great!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on January 15, 2010, 06:05:54 pm
https://www.youtube.com/watch?v=wPzZRhE0hMI
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on January 15, 2010, 07:52:00 pm
lel
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on January 16, 2010, 12:13:37 am
Some loops are boring but looolz




its in spanish, but i think that u will know what hes doing!! LOL

Cool porn :L
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on January 16, 2010, 05:03:55 pm
(http://www.macksimpson.com/adverb/images/doritos-japan-lg-x1x.jpg)
Title: Re: Funny Videos/Pictures
Post by: some_punk on January 18, 2010, 08:10:52 am
(http://winniewong.typepad.com/shelby/images/popsicle.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on January 18, 2010, 08:06:06 pm
(http://obczaj.net/obrazki/93801.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on January 19, 2010, 01:12:54 pm
(http://21.media.tumblr.com/tumblr_kwgvx3fGxc1qzh5gno1_500.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on January 19, 2010, 06:27:55 pm
https://www.youtube.com/watch?v=-_z8A_0NDfw
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on January 19, 2010, 06:29:23 pm
haha
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on January 19, 2010, 06:56:23 pm
Ballz!

Well lack of topic to post it at;

http://www.jasonepowell.com a different photography idea but blame we cant see whats behind the old picture lol

(http://www.findlove-keeplove.com/images/sign1.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on January 20, 2010, 02:09:22 pm
(http://obczaj.net/obrazki/94051.jpg)


and this scene owns lol
'make the pencil disappear'

https://www.youtube.com/watch?v=2KX3OriDpgg
Title: Re: Funny Videos/Pictures
Post by: [UK]SheepFucka on January 20, 2010, 02:12:09 pm
ew!
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on January 20, 2010, 06:23:36 pm
Nice disappearance... But we dont see it as it is supposed to be not seen.Its magic. :L

Have you seen this ? A cool IV movie related to Fast and Furious series.

https://www.youtube.com/watch?v=8kczuX-nXYI

Part 2 is way better in quality and quality (production)

https://www.youtube.com/watch?v=JvptBXUvn0U

Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 21, 2010, 12:07:08 pm
(http://thelittlecriminal.files.wordpress.com/2009/06/power-rangers_turboranger1.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on January 21, 2010, 10:17:44 pm
(http://obczaj.net/obrazki/94511.jpg)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on January 22, 2010, 12:30:11 pm
|----------|
| looolzzzz!!!!!!!!!!!!!
|----------|

:L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 22, 2010, 01:16:23 pm
i dont like "this is sparta" jokes.
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on January 22, 2010, 02:18:13 pm
I find them funny :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on January 22, 2010, 09:23:48 pm
(http://obczaj.net/obrazki/94556.jpg)
Title: Re: Funny Videos/Pictures
Post by: falco355 on January 22, 2010, 09:25:00 pm
Nice disappearance... But we dont see it as it is supposed to be not seen.Its magic. :L

Have you seen this ? A cool IV movie related to Fast and Furious series.

https://www.youtube.com/watch?v=8kczuX-nXYI

Part 2 is way better in quality and quality (production)

https://www.youtube.com/watch?v=JvptBXUvn0U



i already see that, i love that
with french speak, totally great

Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on January 22, 2010, 09:33:55 pm
https://www.youtube.com/watch?v=ieK1PTXmopE
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on January 22, 2010, 10:34:12 pm
:L

https://www.youtube.com/watch?v=JjUTb6sOncM
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Al3X on January 23, 2010, 06:46:17 am
https://www.youtube.com/watch?v=S4ZO2FD4pNA
https://www.youtube.com/watch?v=SFsHPFhtEYQ
https://www.youtube.com/watch?v=gHCxdlZ7G18
https://www.youtube.com/watch?v=lRefZf3gj74
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 23, 2010, 10:05:51 am
:L

https://www.youtube.com/watch?v=JjUTb6sOncM

It seems they are stoned lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 23, 2010, 11:57:45 am
loooooool xD

ye I think they're stoned too :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on January 23, 2010, 02:27:01 pm
(http://obczaj.net/obrazki/94641.jpg)
(http://obczaj.net/obrazki/94659.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 23, 2010, 02:32:07 pm
haha loool max nice one  ;D
Title: Re: Funny Videos/Pictures
Post by: some_punk on January 23, 2010, 05:12:01 pm
https://www.youtube.com/watch?v=qtmdGMPgU7I
Title: Re: Funny Videos/Pictures
Post by: MadMax on January 23, 2010, 06:56:53 pm
(http://obczaj.net/obrazki/94954.jpg)
(http://obczaj.net/obrazki/95018.jpg)
(http://obczaj.net/obrazki/94803.jpg)
(http://obczaj.net/obrazki/94744.jpg)
(http://obczaj.net/obrazki/94773.jpg)

M4 is there lol
(http://obczaj.net/obrazki/94838.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 23, 2010, 09:33:34 pm
hahaha nice pics max :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on January 23, 2010, 09:34:59 pm
Hey Malsyz, grab a bicycle for me!

Yes, windows are real.As you see. :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on January 24, 2010, 12:50:36 pm
https://www.youtube.com/watch?v=J---aiyznGQ https://www.youtube.com/watch?v=WHzhFyQTerc

(http://failblog.files.wordpress.com/2010/01/epic-fail-equality-fail.jpg) (http://failblog.files.wordpress.com/2010/01/epic-fail-music-store-fail.jpg) (http://failblog.files.wordpress.com/2009/12/epic-fail-paternity-fail.jpg)

(http://failblog.files.wordpress.com/2010/01/epic-fail-restaurant-name-fail.jpg) (http://failblog.files.wordpress.com/2010/01/129083784614900617.jpg) (http://failblog.files.wordpress.com/2009/11/129029888861085838.jpg)

(http://failblog.files.wordpress.com/2010/01/129079664876819920.jpg) (http://failblog.files.wordpress.com/2010/01/129075471915707086.jpg) (http://failblog.files.wordpress.com/2009/12/epic-fail-playpen-fail.jpg) (http://failblog.files.wordpress.com/2009/12/epic-fail-toy-missile-launcher-fail.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 24, 2010, 02:59:33 pm
lmao :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 24, 2010, 03:33:23 pm
(http://failblog.files.wordpress.com/2010/01/129079664876819920.jpg)

gross lol
Title: Re: Funny Videos/Pictures
Post by: [2F2F]FeTaK_SvK on January 24, 2010, 11:36:16 pm
are u hungry?

https://www.youtube.com/watch?v=27NX_MMIkLY
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on January 25, 2010, 11:24:50 am
old  ;D
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on January 25, 2010, 09:30:17 pm
Watch this video to the end pls.  ;)

http://www.worktobejudged.com/strippause/peca.html
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on January 26, 2010, 03:41:21 pm
Didnt let me see deeper :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 26, 2010, 07:20:37 pm
haha asshole  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on January 26, 2010, 07:22:20 pm
:@
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on January 26, 2010, 09:20:13 pm
 :D :D :D
https://www.youtube.com/watch?v=YXrU1GFqYEU
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on January 26, 2010, 09:51:59 pm
today morning im going to work open metro (news paper) in underground and i see this on the 1st page!

(http://files.uploadffs.com/d/d/c0c2db08/DSC00015.JPG)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 26, 2010, 09:54:50 pm
hahaha loooool :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on January 26, 2010, 09:55:07 pm
Wtf is this thing ? :L
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on January 26, 2010, 10:00:22 pm
its most sad looking fish in the world xD
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on January 26, 2010, 10:01:44 pm
What kind of fish is that :O Maybe it's from Chernobyl :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on January 26, 2010, 10:05:40 pm
it's lilrunty haha!
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on January 26, 2010, 10:07:36 pm
http://www.ccll.org.uk/ho/

im a chernobyl child i was born in the middle east poland 46 days before explozion. (BUT IM FINE xDDDDD)
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on January 26, 2010, 10:43:09 pm
LOL the metro, its a good paper sometimes ^^
Title: Re: Funny Videos/Pictures
Post by: ivanduk on January 28, 2010, 07:10:37 pm
(http://files.uploadffs.com/d/c/2eeac67f/Photo_0300.jpg)

xDDD
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on January 28, 2010, 07:11:51 pm
lol this
Title: Re: Funny Videos/Pictures
Post by: MadMax on January 28, 2010, 09:25:37 pm
(http://obczaj.net/obrazki/95668.jpg)
Title: Re: Funny Videos/Pictures
Post by: Epicnawb on January 28, 2010, 09:39:02 pm
OMG! That weird looking thing , Its... A..... BLOBFISH! :o
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on January 28, 2010, 09:47:45 pm
(http://obczaj.net/obrazki/95668.jpg)

hehehe
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on January 28, 2010, 09:52:24 pm
http://www.ccll.org.uk/ho/

im a chernobyl child i was born in the middle east poland 46 days before explozion. (BUT IM FINE xDDDDD)

I think i killed your uncle in S.T.A.L.K.E.R.

Sorry!
Title: Re: Funny Videos/Pictures
Post by: MadMax on January 28, 2010, 11:05:46 pm
OMG! That weird looking thing , Its... A..... BLOBFISH! :o

blobfish ftw!
(http://smackamack.files.wordpress.com/2009/03/psyphrthree.jpg)
(http://www.whaletimes.org/Courtesy%20of%20NOAA%20MBARI%202002%20EJB_052202_034.jpg)(http://1.bp.blogspot.com/_u3jJqwb8ieY/SajHv_03xDI/AAAAAAAAAII/xMhVIo4udtw/s1600/2787625749_8407a7a8fd.jpg)
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on January 28, 2010, 11:14:47 pm
lol max the bottom 1 looks like you  :o
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on January 29, 2010, 07:23:09 pm
lol i cant eat that
(http://files.uploadffs.com/d/b/27cdb9e3/Untitled2.png)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 29, 2010, 08:14:50 pm
ugly fish lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on January 29, 2010, 08:17:53 pm
(http://i49.tinypic.com/153liqo.jpg)
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on January 29, 2010, 08:40:14 pm
loool

(http://files.uploadffs.com/d/2/e71a2f0d/DSC00892.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on January 30, 2010, 08:53:52 pm
:D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on January 30, 2010, 08:58:01 pm
haha :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on January 30, 2010, 09:10:31 pm
xD  ;D
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on January 30, 2010, 09:11:33 pm
rofl
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on January 30, 2010, 11:21:57 pm
i had to get rid of the damn buttons.
(http://files.uploadffs.com/d/6/15aa600d/DSC00897.JPG)

Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on January 30, 2010, 11:30:20 pm
lol m4, you and your wondering fingers  :P
Title: Re: Funny Videos/Pictures
Post by: [2F2F]FeTaK_SvK on January 31, 2010, 02:55:48 am
(http://i48.tinypic.com/rstn36.jpg)
Title: Re: Funny Videos/Pictures
Post by: some_punk on January 31, 2010, 05:44:05 am
This is funny sound! hahahaha WATCH THE WHOLE VIDEO!!! xD ;D
https://www.youtube.com/watch?v=p01fm0r2rBc
i love brasilian girls :D they always are horny LOL
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on January 31, 2010, 06:32:38 am
(http://img99.imageshack.us/img99/4738/zabka.th.jpg) (http://img99.imageshack.us/i/zabka.jpg/) I stick this frog on mirror in T4 of my friend :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on January 31, 2010, 12:16:30 pm
How did he react :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on January 31, 2010, 12:32:57 pm
just laugh and then romove it :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on February 01, 2010, 11:30:21 am
https://www.youtube.com/watch?v=wBDm47kxyik

might be old, lol.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on February 01, 2010, 05:28:50 pm
hah :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on February 01, 2010, 11:09:31 pm
Epic :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on February 03, 2010, 07:02:57 pm
https://www.youtube.com/watch?v=v1m8a4Jl4ZI
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on February 03, 2010, 07:11:37 pm
lmao  :D :D
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on February 03, 2010, 07:12:20 pm
 ;D HAHA PWNED
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on February 05, 2010, 10:43:44 am
 ;D

https://www.youtube.com/watch?v=OhwhPhss-QE

Title: Re: Funny Videos/Pictures
Post by: some_punk on February 05, 2010, 11:01:23 pm
(http://i5.photobucket.com/albums/y194/Barnze/wanker.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on February 06, 2010, 01:36:54 am
M-M-M-M-MONSTER POST...

(http://img.moronail.net/img/2/6/2626.jpg)
(http://img.moronail.net/img/0/9/2609.jpg)
(http://img.moronail.net/img/0/8/2608.jpg)
(http://img.moronail.net/img/0/5/2605.jpg)
(http://img.moronail.net/img/0/4/2604.jpg)
(http://img.moronail.net/img/9/5/2595.jpg)
(http://img.moronail.net/img/7/9/2579.jpg)
(http://img.moronail.net/img/6/0/2560.jpg)
(http://img.moronail.net/img/5/9/2559.jpg)
(http://img.moronail.net/img/4/5/2545.jpg)
(http://img.moronail.net/img/3/7/2537.jpg)
(http://img.moronail.net/img/3/3/2533.jpg)
(http://img.moronail.net/img/2/0/2520.jpg)
(http://img.moronail.net/img/0/9/2509.jpg)
(http://img.moronail.net/img/9/7/2497.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on February 06, 2010, 09:24:15 am
Great pics :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on February 06, 2010, 12:08:07 pm
Heh yeah, that Polish remover is epic :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on February 06, 2010, 12:42:28 pm
Heh yeah, that Polish remover is epic :L

haha loool I was looking at it but didn't notice poland was gone :L :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on February 06, 2010, 09:44:57 pm
Same lol.I felt like something was moved and map rotation has changed :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on February 06, 2010, 10:05:29 pm
Without Poland Europe would be better. Baltic would rule more :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on February 06, 2010, 10:13:21 pm
Europe will not exsist without Poland, it there was no Poland Hitler could get whole Europe and everyone will speak german lol
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on February 06, 2010, 10:31:39 pm
tbh, russian winter stopped german troops and they got killed (sent back to Germany ;D )  :P
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on February 06, 2010, 10:56:03 pm
Europe will not exsist without Poland, it there was no Poland Hitler could get whole Europe and everyone will speak german lol

He got Poland in 1939 already.. I don't see the point in what you're telling. If America/British didn't save us from Hitler Russia would took over whole Europe as far as possible...

Ooohh... Poland thinks that pedobear is a olympic mascot :L

(http://i48.tinypic.com/2cp3nrb.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on February 07, 2010, 01:54:24 pm
If that's real, I want to shake the hand of whoever snuck it in there.  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on February 07, 2010, 07:13:20 pm
Without Poland Europe would be better. Baltic would rule more :L

your poor cuntry was in ZSRR :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on February 07, 2010, 08:59:30 pm
USSR*
Title: Re: Funny Videos/Pictures
Post by: MadMax on February 07, 2010, 09:32:20 pm
(http://www.johnserra.com/CCCP.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on February 07, 2010, 11:29:01 pm
(http://files.uploadffs.com/d/2/3fb521b7/sorrybus.jpg)
(http://files.uploadffs.com/d/6/ac246f6a/hitmanmonkey.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on February 09, 2010, 04:18:29 pm
(http://obczaj.net/obrazki/97821.jpg)
Title: Re: Funny Videos/Pictures
Post by: Epicnawb on February 09, 2010, 04:25:08 pm
LOL @ TEH HORSE XD  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on February 09, 2010, 04:54:39 pm
lool :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on February 10, 2010, 09:04:00 pm
HORSE = WIN.

(http://i36.tinypic.com/nox9ub.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on February 10, 2010, 11:01:26 pm
haha :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on February 11, 2010, 01:57:30 pm
(http://gijss.web-log.nl/photos/uncategorized/2008/08/30/l8303027_wesp.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on February 11, 2010, 02:54:39 pm
LOL @ the tard!! :L :L
http://mojevideo.cz/view.php?id=4898
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on February 11, 2010, 08:51:18 pm
Same person has one more retarded beatbox.More retarded than this :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on February 12, 2010, 04:26:24 pm
(http://files.uploadffs.com/d/8/04098eb5/funnydogpicturesspotdog.jpg)
Title: Re: Funny Videos/Pictures
Post by: Dead on February 12, 2010, 05:00:54 pm
(http://files.uploadffs.com/d/8/04098eb5/funnydogpicturesspotdog.jpg)

wtf :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on February 12, 2010, 05:43:47 pm
women do spot my hotdog  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on February 12, 2010, 06:27:24 pm
(http://files.uploadffs.com/d/8/04098eb5/funnydogpicturesspotdog.jpg)

lmao :L :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on February 13, 2010, 01:00:14 pm
(http://cdn2.knowyourmeme.com/i/1748/original/577px-Pedobear_17.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on February 13, 2010, 01:12:24 pm
(http://img194.imageshack.us/img194/2287/freecandyvan1.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on February 13, 2010, 01:16:43 pm
OMG REAL LIVE BOOMER  :o :o :o

(http://media.ebaumsworld.com/picture/boc1500/FreeCandy.png)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on February 13, 2010, 01:19:06 pm
BOOMER!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on February 13, 2010, 03:22:22 pm
^omg lol

(http://pix.motivatedphotos.com/2009/11/23/633945960575635740-freecandy.jpg)

https://www.youtube.com/watch?v=5eXsSluPNxY

https://www.youtube.com/watch?v=Pdoe-fvrHfc
Title: Re: Funny Videos/Pictures
Post by: falco355 on February 13, 2010, 09:16:56 pm
Chicken opera  ;D  ;D

https://www.youtube.com/watch?v=K2EMPi_a59A

MooMan

https://www.youtube.com/watch?v=-QVmaeh0bUw

Can you do thaT?

https://www.youtube.com/watch?v=S3oscd_CLTI
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on February 13, 2010, 09:27:04 pm
I like to MOO MOO you like to MOOOOOOOO :L

Title: Re: Funny Videos/Pictures
Post by: MadMax on February 13, 2010, 09:29:57 pm
(http://obczaj.net/obrazki/98702.jpg)
(http://obczaj.net/obrazki/98705.jpg)
(http://obczaj.net/obrazki/98706.jpg)
(http://obczaj.net/obrazki/98708.jpg)
(http://obczaj.net/obrazki/98709.jpg)
(http://obczaj.net/obrazki/98710.jpg)
(http://obczaj.net/obrazki/98711.jpg)
(http://obczaj.net/obrazki/98712.jpg)
(http://obczaj.net/obrazki/98714.jpg)
Title: Re: Funny Videos/Pictures
Post by: falco355 on February 13, 2010, 09:33:17 pm
woooo, hardcore >:(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on February 13, 2010, 10:56:43 pm
(http://files.uploadffs.com/d/c/c917cdbb/dirtymind.jpg)

(http://files.uploadffs.com/d/1/d2cd109c/1244731503.jpg)

(http://files.uploadffs.com/d/c/5cecc662/1251193930.jpg)

(http://files.uploadffs.com/d/7/427f71f7/1251194007.jpg)

(http://files.uploadffs.com/d/1/5a29130d/htmlcoder.jpg)

(http://files.uploadffs.com/d/5/42f05cca/mommy.jpg)

(http://files.uploadffs.com/d/a/88e9ac68/cows.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on February 14, 2010, 12:26:16 am
funny must be my alter ego :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on February 14, 2010, 11:49:00 am
(http://i48.tinypic.com/sfwm55.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on February 14, 2010, 01:17:46 pm
Snoopy's avatar is epic. (http://files.uploadffs.com/d/5/fd755960/timewarpwaterballoon.gif)
Title: Re: Funny Videos/Pictures
Post by: Dead on February 14, 2010, 01:18:44 pm
Snoopy's avatar is epic. (http://files.uploadffs.com/d/5/fd755960/timewarpwaterballoon.gif)

Time warp
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on February 14, 2010, 02:11:17 pm
1 second in 5 seconds with 200fps FTW :L

@Max hmm... Riot! :L

Bus is epic lol
Title: Re: Funny Videos/Pictures
Post by: falco355 on February 14, 2010, 07:15:35 pm
Ckicken techno

https://www.youtube.com/watch?v=8VxJV9hKonQ
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on February 14, 2010, 10:02:45 pm
awesome pics max lol
Title: Re: Funny Videos/Pictures
Post by: ... on February 14, 2010, 11:13:37 pm
mdr ça passe en pub à la télé celle la? (asking to falco if this one is an ad on tv in france)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on February 15, 2010, 05:14:16 am
https://www.youtube.com/watch?v=H6IeASZZf1c

enjoy :D
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on February 15, 2010, 06:39:54 pm
hahahahahhah  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on February 15, 2010, 06:54:22 pm
Win.  ;)
Title: Re: Funny Videos/Pictures
Post by: falco355 on February 15, 2010, 07:00:03 pm
mdr ça passe en pub à la télé celle la? (asking to falco if this one is an ad on tv in france)

pas celle la, mais celle de l'opéra oui
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on February 16, 2010, 01:27:11 pm
:L
Mosque made of weapons.

(http://www.geenstijl.nl/archives/images/moskeewapen.jpg)
Title: Re: Funny Videos/Pictures
Post by: Dead on February 16, 2010, 01:46:11 pm
lol :L
(http://i49.tinypic.com/14xnsb7.jpg)
Title: Re: Funny Videos/Pictures
Post by: ivanduk on February 16, 2010, 01:48:20 pm
original:
(http://teflon.files.wordpress.com/2009/01/nice_big_cup_of_stfu.jpg)
Title: Re: Funny Videos/Pictures
Post by: falco355 on February 16, 2010, 03:28:06 pm
Stupid cat

https://www.youtube.com/watch?v=wY6wGOxSRV8

https://www.youtube.com/watch?v=kFDKz7WskNU
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on February 16, 2010, 10:27:06 pm
1st video ftw.
 ;D
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on February 17, 2010, 09:53:54 am
https://www.youtube.com/watch?v=4_pS46YRMIQ

It has to be a spoof.....surely?

Edit - Clearly not a spoof. Dear god!! There is more:

https://www.youtube.com/watch?v=8NZBxwjcwMc

And one more link:

http://www.watkykjy.co.za/2010/02/die-antwoord-vs-enya-orinoco-ninja-flow-wedding-djs-remix/

This has a 'cover' of Enya - Orinoco Flow by them which has amazingly funny/fucked up lyrics.
Title: Re: Funny Videos/Pictures
Post by: falco355 on February 17, 2010, 12:42:18 pm
i love crazy cats

https://www.youtube.com/watch?v=rutbA5nmwuc
https://www.youtube.com/watch?v=o_O969rkLPg
https://www.youtube.com/watch?v=e8F9txsHzQI
Title: Re: Funny Videos/Pictures
Post by: some_punk on February 18, 2010, 07:22:21 am
https://www.youtube.com/watch?v=1VAV-o3Ld0U
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on February 18, 2010, 09:25:47 am
@ simon, that dude is fucking freaky :o
Title: Re: Funny Videos/Pictures
Post by: some_punk on February 18, 2010, 09:59:28 am
(http://fitjohnny.files.wordpress.com/2009/06/hater.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on February 18, 2010, 12:37:01 pm
(http://files.uploadffs.com/d/f/b825fdbe/jump.jpg)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on February 18, 2010, 12:45:37 pm
If she did jump, others would jump over again cause of her little earth quake.
Title: Re: Funny Videos/Pictures
Post by: MadMax on February 18, 2010, 02:25:50 pm
(http://files.uploadffs.com/d/f/b825fdbe/jump.jpg)

1st picture - 10 girls
2nd picture - only 9
lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on February 18, 2010, 02:46:15 pm
ahah indeed, epic fail
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on February 18, 2010, 05:52:23 pm
Hmm not careful enough :( I knew something was strange with zoomed picture :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on February 18, 2010, 11:28:00 pm
@Killerbunnies: I can't believe I actually watched that.  :D
Title: Re: Funny Videos/Pictures
Post by: some_punk on February 18, 2010, 11:33:13 pm
@Epoxi, lol!! i love those british videos XD check the relatives videos on youtube ROFLMAO

https://www.youtube.com/watch?v=d2pB3QNvziU

https://www.youtube.com/watch?v=g4-8-bldLs4

https://www.youtube.com/watch?v=hriTDaIJ4Go
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on February 19, 2010, 09:04:52 am
@ simon, that dude is fucking freaky :o
Indeed! ha ha
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on February 19, 2010, 01:35:01 pm
@ bunnies, @ first video, @ 1:30 :L
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on February 19, 2010, 03:36:00 pm
https://www.youtube.com/watch?v=Phyg_uIPQII

Classic, but totally freaky music video:

https://www.youtube.com/watch?v=Pe-XNav5mWU
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on February 20, 2010, 09:16:19 am
https://www.youtube.com/watch?v=-GNnftq744I lol :D
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on February 20, 2010, 03:21:57 pm
Thats just... just... just... epic! :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on February 20, 2010, 04:22:16 pm
Haha, agree Love :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on February 21, 2010, 10:26:04 am
(http://28.media.tumblr.com/tumblr_kv14daeRet1qzxds1o1_500.jpg)

(http://i.imgur.com/JPx1G.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on February 21, 2010, 10:57:52 am
Haha nice :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on February 21, 2010, 11:11:02 am
looool :L "i licked the icing of the sofa" :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on February 21, 2010, 11:38:01 am
:L :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on February 21, 2010, 11:46:16 pm
L4D'ers check out :L

https://www.youtube.com/watch?v=CVRoXPAhpfg
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on February 22, 2010, 02:35:17 pm
(http://s2.postimage.org/R1Dl0-2940cc9c3f73d1a2018b47f324f33f49.jpg)
Title: Re: Funny Videos/Pictures
Post by: ivanduk on February 22, 2010, 09:37:12 pm
OWNED LOL
(http://www.dailyhaha.com/_pics/facebook-hookup.jpg)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on February 22, 2010, 09:43:44 pm
Thats a real ownage now... :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on February 22, 2010, 09:46:15 pm
hahaha that dude pwnt himself :L

aaaaaaaahhh I love charlie the unicorn

https://www.youtube.com/watch?v=DgXy0fquj2g
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on February 22, 2010, 11:20:07 pm
Guess thats not going to create a hot topic in here :L Weird ad lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on February 22, 2010, 11:23:59 pm
OWNED LOL
(http://www.dailyhaha.com/_pics/facebook-hookup.jpg)


hahahahahha lololololololol
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on February 22, 2010, 11:25:18 pm
http://www.facebook.com/video/video.php?v=343003335475&ref=nf

This is art... :P
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on February 22, 2010, 11:27:04 pm
now there's a tiger i'd like to get bitten by :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on February 22, 2010, 11:29:26 pm
OWNED LOL
(http://www.dailyhaha.com/_pics/facebook-hookup.jpg)


hahahahahahahahahahahahahahahahahaha :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on February 22, 2010, 11:54:01 pm
now there's a tiger i'd like to get bitten by :L

rawr
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on February 23, 2010, 01:05:03 am
https://www.youtube.com/watch?v=k4C1lnVq_OE
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on February 23, 2010, 01:26:25 am
ftw haha
Title: Re: Funny Videos/Pictures
Post by: [2F2F]FeTaK_SvK on February 23, 2010, 09:20:16 pm
http://www.facebook.com/video/video.php?v=343003335475&ref=nf

This is art... :P

what about this art? :P
(http://i45.tinypic.com/1zg6kh3.jpg)

sketch in bottom si mine...top one is my friend
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on February 23, 2010, 09:46:18 pm
Nice sketch. You should put it on a wall.  ;)

Took one look at this, I could not stop laughing...

https://www.youtube.com/watch?v=UUgCm7HYJwU

And for you VC fans...

(http://img64.imageshack.us/img64/9246/catbus.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on February 23, 2010, 10:29:07 pm
lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on February 23, 2010, 10:52:40 pm
omg that pikachu mod owns :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on February 23, 2010, 11:45:59 pm


what about this art? :P
[]http://i45.tinypic.com/1zg6kh3.jpg[

sketch in bottom si mine...top one is my friend
Woop nice work too! I love the pictures look so fulfilled with a life.Wonder if i managed to tell what i wanted. :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on February 24, 2010, 12:07:15 am
cat bus :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on February 24, 2010, 08:57:04 am
http://www.facebook.com/video/video.php?v=343003335475&ref=nf

This is art... :P

what about this art? :P
(http://i45.tinypic.com/1zg6kh3.jpg)

sketch in bottom si mine...top one is my friend

Very cool.
Title: Re: Funny Videos/Pictures
Post by: MadMax on February 24, 2010, 06:32:28 pm
(http://obczaj.net/obrazki/100874.jpg)
(http://obczaj.net/obrazki/100900.jpg)
(http://obczaj.net/obrazki/100902.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on February 24, 2010, 08:18:37 pm
Guess thats not going to create a hot topic in here :L Weird ad lol

What exactly is Hot Topic? Didn't the kids from South Park burn it down?
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on February 24, 2010, 08:42:50 pm
I dont know anything about that, just a variant from "hottopic.com"

Holyweed lol
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on February 26, 2010, 10:33:09 pm
:o

░█▀▀ ░█▀█ ░█ ░█▀▀ ░░█▀▀ ░█▀█ ░█ ░█
░█▀▀ ░█▀▀ ░█ ░█ ░░░░█▀▀ ░█▀█ ░█ ░█
░▀▀▀ ░▀ ░░░▀ ░▀▀▀ ░░▀ ░░░▀░▀ ░▀ ░▀▀▀

https://www.youtube.com/watch?v=V77sHgqzWZk
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on February 26, 2010, 10:34:43 pm
what the.... :o
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on February 26, 2010, 10:51:28 pm
awwww BLAH! that's really disgusting picture
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on February 26, 2010, 11:34:14 pm
holy shit hahaha I would puke if I ever see that in a chicken box
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on February 27, 2010, 11:58:30 am
Hahah looooool :L :L
https://www.youtube.com/watch?v=7ZRMECFe5Ko
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on February 27, 2010, 01:18:02 pm
Don't like the music but the rest is great :L :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on February 27, 2010, 08:19:46 pm
Yeah, only germans can start a World War :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on February 27, 2010, 08:57:10 pm
Hahhaha epic shit. :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]FeTaK_SvK on February 28, 2010, 02:03:34 am
https://www.youtube.com/watch?v=9VYLCP0JeIU
Title: Re: Funny Videos/Pictures
Post by: falco355 on February 28, 2010, 01:38:02 pm
https://www.youtube.com/watch?v=smVE7C6m9NY
Title: Re: Funny Videos/Pictures
Post by: MadMax on February 28, 2010, 11:27:21 pm
(http://obczaj.net/obrazki/101610.jpg)
(http://obczaj.net/obrazki/101612.jpg)
(http://obczaj.net/obrazki/101613.jpg)
Title: Re: Funny Videos/Pictures
Post by: ... on March 01, 2010, 08:01:23 pm
American football in france... ya we still have to learn a bit?
https://www.youtube.com/watch?v=7_VTH52TGOQ

And the French.... ROCKY BALBOA !!
https://www.youtube.com/watch?v=hqOBR_Xbw2I
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 03, 2010, 06:32:59 pm
Can anyone translate this? :L :L :L

https://www.youtube.com/watch?v=4_o47Gs6DQ0
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 03, 2010, 07:18:49 pm
lol, ask cysio
Title: Re: Funny Videos/Pictures
Post by: MadMax on March 03, 2010, 08:28:14 pm
(http://obczaj.net/obrazki/102061.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 03, 2010, 08:30:56 pm
lool  :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 03, 2010, 08:38:12 pm
why would anyone make such a piece of crap :L
Title: Re: Funny Videos/Pictures
Post by: falco355 on March 05, 2010, 07:06:05 pm
https://www.youtube.com/watch?v=9XkfCEtw84s
Title: Re: Funny Videos/Pictures
Post by: some_punk on March 05, 2010, 10:28:45 pm
https://www.youtube.com/watch?v=9XkfCEtw84s

el chile habanero es picoso, pero hay otros mas picosos que esos, hay unos mas chiquitos como pildoras, son lo doble de picosos....

vengan a mexico y prueben los verdaderos chiles!! XD
Title: Re: Funny Videos/Pictures
Post by: falco355 on March 06, 2010, 11:42:37 am
TRANSLATION PLZ  ???
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 06, 2010, 12:25:35 pm
Abandoned by humans.. looks creepy

(http://upload.wikimedia.org/wikipedia/commons/b/b3/Streetcar-SRM.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 06, 2010, 01:41:42 pm
omfg loooooooool hahahahahaha LMAOOOOOO that's fuckin hilarious :oooooooooooooooooooooooooooooo

i cant stop laughin :L :L :L :L :L :L :L :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on March 06, 2010, 01:48:22 pm
this is awful  :'(
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 06, 2010, 01:56:55 pm
couldn't find a topic for it :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on March 09, 2010, 12:57:10 am
fast shit lol, it is so fucking fast, can't even see it clearly
https://www.youtube.com/watch?v=VPmwx6A5sqY
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on March 09, 2010, 09:33:54 am
lol kewl
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on March 09, 2010, 03:20:21 pm
Pushing up to 3 laps/sec :o

*that fly is annoying me...
Title: Re: Funny Videos/Pictures
Post by: [FSR]Michal on March 09, 2010, 03:43:50 pm
it is a fake look at the bird speed :P they also accelerate :P:D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 10, 2010, 02:55:02 pm
(http://i39.tinypic.com/1z4liyp.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 10, 2010, 05:20:20 pm
haha ^ :L
----------
(http://i.imgur.com/GxzeV.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 10, 2010, 05:25:34 pm
I don't even insert the dvd as pirate :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 10, 2010, 05:34:44 pm
Joe Lajoie ftw :L
https://www.youtube.com/watch?v=AE4zF36dPxE
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 10, 2010, 05:37:42 pm
crazy people :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Rac3r on March 10, 2010, 05:39:42 pm
Chorus guy lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 10, 2010, 05:40:50 pm
I rather pass by and see MC Porn fly :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 10, 2010, 05:46:29 pm
hahahahaha
Title: Re: Funny Videos/Pictures
Post by: sam on March 10, 2010, 06:47:32 pm
(http://roflrazzi.files.wordpress.com/2010/01/celebrity-pictures-mel-gibson-braveheart-roasting-marshmallows.jpg)
(http://roflrazzi.files.wordpress.com/2008/09/david-hasselhoff-yes-the-wall.jpg?w=418&h=600)
(http://roflrazzi.files.wordpress.com/2008/09/patrick-stewart-for-the-last-time-geordi.jpg?w=499&h=328)
(http://failblog.files.wordpress.com/2010/01/129079719418109561.jpg)
(http://failblog.files.wordpress.com/2010/01/epic-fail-pet-store-fail.jpg)
(http://failblog.files.wordpress.com/2010/01/129079003197262718.jpg)
(http://thereifixedit.files.wordpress.com/2010/01/129085472022400149.jpg?w=494&h=345)
(http://punditkitchen.files.wordpress.com/2010/01/political-pictures-ron-paul-shoes-fabulous.jpg)
(http://punditkitchen.files.wordpress.com/2010/01/129067186596049056.jpg)
(http://ihasahotdog.files.wordpress.com/2010/01/funny-dog-pictures-satelite-upload.jpg)
(http://icanhascheezburger.files.wordpress.com/2008/01/funny-pictures-emo-wall.jpg)
(http://www.zwani.com/graphics/funny_pictures/images/funny-pictures247.jpg)


(http://www.andromada.net/forum_files/fly.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on March 10, 2010, 06:52:25 pm
lol

(http://i40.tinypic.com/2v19ppy.png)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 10, 2010, 06:55:41 pm
lol @ the flies :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on March 10, 2010, 09:49:09 pm
Todays lol meal is from Nobody, thanks for the tasty lols.If i knew who posted it... Id hug him, but nobody knows it... :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 10, 2010, 10:11:25 pm
haha the flies :L
Title: Re: Funny Videos/Pictures
Post by: [CX]Cristiano on March 10, 2010, 10:54:31 pm
Precious = chair
(http://kibeloco.com.br/files/104/2010/03/Precious-Poltrona.jpg)

10 shirts that people should not use  :P
(http://kibeloco.com.br/files/104/2010/03/10-camisas.jpg)

curling  :D
(http://kibeloco.com.br/files/104/2010/02/curling-Brasil.jpg)

Thief gets stuck in chimney trying to break into restaurant
(http://kibeloco.com.br/files/104/2010/02/bandido-chamine.jpg)

DUCK IN CLUBBING OF STRIP-TEASE
(http://colunas.globoesporte.com/files/89/2010/02/2el84ux.jpg)


Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on March 11, 2010, 09:29:35 am
(http://26.media.tumblr.com/tumblr_kz1bts5ILs1qai2kao1_500.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 11, 2010, 05:13:18 pm
https://www.youtube.com/watch?v=zuVsLR_2GX0
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 11, 2010, 09:25:10 pm
(http://26.media.tumblr.com/tumblr_kz1bts5ILs1qai2kao1_500.jpg)

I'd like to have a lil' meal with her ;)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on March 11, 2010, 10:45:15 pm
lil' Meal ???

YOU'D eat her as the MEAL :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on March 13, 2010, 03:00:23 am
(http://26.media.tumblr.com/tumblr_kz2nffWp2c1qzh5gno1_100.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 13, 2010, 09:10:19 am
:L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 13, 2010, 11:28:36 am
haha dirty vertigo
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on March 13, 2010, 06:17:05 pm
(http://motogpworld.net/wp-content/uploads/2009/09/objects.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on March 13, 2010, 06:45:19 pm
unless they're doing laps
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 13, 2010, 07:30:41 pm
(http://www.netstate.com/states/mottoes/images/ca_eureka.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on March 14, 2010, 11:35:33 am
[youtubeHD]DD5UKQggXTc[/youtubeHD]
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 14, 2010, 11:41:20 am
rrrrrrrrrrrrrrrrrrrrreeeeeeeeeeppooosst!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on March 14, 2010, 04:02:51 pm
falky you sly little...

(http://img.moronail.net/img/6/4/2864.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on March 14, 2010, 09:27:14 pm
I remember that, was flying over Greenland to test out the new set of F-22's flying capabilities under freezing conditions.
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 14, 2010, 11:14:51 pm
I remember that, was flying over Greenland to test out the new set of F-22's flying capabilities under freezing conditions.

It always freezes if you go high enough up in the troposhere. In fact, above Greenland the temperature decreases less as above the equator.
Title: Re: Funny Videos/Pictures
Post by: MadMax on March 14, 2010, 11:57:45 pm
(http://obczaj.net/obrazki/104589.jpg)
(http://obczaj.net/obrazki/104614.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 15, 2010, 12:43:37 am
Ahahah I lolled at both of them :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 15, 2010, 01:36:18 pm
hah :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on March 15, 2010, 06:52:05 pm
 :) WTF at driving test one. Here in the UK it's other way around.

/failed twice
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 15, 2010, 09:33:10 pm
Lies. Skin colour has nothing to do with it.

These people who take off the exam are always grumpy old men.. blegh, I failed first time because he was grumpy.. 2nd try he was in good mood(I had same guy again, coincidence).. and I passed!
Title: Re: Funny Videos/Pictures
Post by: ... on March 16, 2010, 12:03:33 pm
https://www.youtube.com/watch?v=cGXvliz3PJ4 anyone can translate what they saying? I think it's serbian or some other slavic language.
https://www.youtube.com/watch?v=b67bP9CroZc
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 16, 2010, 12:15:19 pm
Bosnia or something..
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on March 16, 2010, 05:10:51 pm
:L

(http://boxothoughts.files.wordpress.com/2008/07/mao-zedong.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 16, 2010, 11:08:09 pm
(http://img185.imageshack.us/img185/6175/1212g.jpg) (http://img185.imageshack.us/i/1212g.jpg/)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on March 17, 2010, 03:15:46 am
lol nice edit
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on March 17, 2010, 08:58:45 pm
Skin colour has nothing to do with it.

Yeah, you're right actually, I was being a penis. To be fair the DSA is probably the most uncorrupted organisation ever. If you threatened to kill their family they'd still probably fail you.

(http://213.186.58.23/wp-content/uploads/2010/03/Paddys-Day_english.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Patrx on March 17, 2010, 09:16:57 pm
woo today my day St Patrick  :-X
Title: Re: Funny Videos/Pictures
Post by: some_punk on March 18, 2010, 07:56:12 am
:) im there!
Title: Re: Funny Videos/Pictures
Post by: [AK47]skunk on March 18, 2010, 08:09:04 am
 ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on March 18, 2010, 11:21:20 am
(http://27.media.tumblr.com/tumblr_kzb3qs9S2f1qa6hcco1_500.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 18, 2010, 11:22:35 am
Hahah I remember that when I still played with LEGO.
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on March 18, 2010, 11:56:37 am
(http://26.media.tumblr.com/tumblr_kzfl0pElWn1qzxzwwo1_500.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on March 18, 2010, 01:26:14 pm
hah haven't seen that one before :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 18, 2010, 01:32:26 pm
haha @ 1:00 lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on March 18, 2010, 01:40:47 pm
Click here to feed me i am starving !
Title: Re: Funny Videos/Pictures
Post by: BlueStar on March 18, 2010, 01:54:23 pm
nice : D
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on March 18, 2010, 03:49:16 pm
BOOMER!!!!!!

(http://26.media.tumblr.com/tumblr_kzfl0pElWn1qzxzwwo1_500.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on March 18, 2010, 04:30:32 pm
Click here to feed me i am starving !

Where
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on March 20, 2010, 12:09:38 am
https://www.youtube.com/watch?v=uCPdI_jSamE

LOL, you have to watch this. Pitbull punches a guy in the face in the middle of the video, and doesn't miss a beat.
Title: Re: Funny Videos/Pictures
Post by: MadMax on March 20, 2010, 12:38:22 am
(http://obczaj.net/obrazki/105956.jpg)
(http://obczaj.net/obrazki/105912.jpg)
(http://obczaj.net/obrazki/105852.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 20, 2010, 10:01:10 am
lol @ the first one :L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on March 20, 2010, 04:42:41 pm
(http://photos-d.ak.fbcdn.net/hphotos-ak-snc3/hs163.snc3/19057_1235236556599_1099750826_30620798_4327779_n.jpg)
(http://citynoise.org/upload/940.jpg)
Title: Re: Funny Videos/Pictures
Post by: Killaz on March 20, 2010, 05:14:05 pm
haha;d
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on March 22, 2010, 01:35:04 pm
lol
(http://i44.tinypic.com/vqia07.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]PyroFox on March 22, 2010, 02:08:26 pm
(http://i.imgur.com/UvOr8.gif)
Title: Re: Funny Videos/Pictures
Post by: ... on March 22, 2010, 04:31:58 pm
https://www.youtube.com/watch?v=97ejk5NOrR8

toot-tone giant size:
(http://www.artofthestate.co.uk/photos/Swiss_Re_tower_vert.jpg)

https://www.youtube.com/watch?v=nojWJ6-XmeQ
Title: Re: Funny Videos/Pictures
Post by: some_punk on March 22, 2010, 07:47:12 pm
https://www.youtube.com/watch?v=CG7g-EDR8C8

https://www.youtube.com/watch?v=HxNODdxg2iY

Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on March 23, 2010, 03:10:14 pm
:L

https://www.youtube.com/watch?v=Qq8Uc5BFogE


-------------

This is where I'm going with my class on excursion this April  :D

http://www.sovietbunker.com/en/

It's the only bunker like this in whole Europe. Watch the video please :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Hellmuth on March 24, 2010, 08:01:54 pm
https://www.youtube.com/watch?v=aoRD1wmvwUc
Title: Re: Funny Videos/Pictures
Post by: [MAF]Rac3r on March 25, 2010, 01:00:54 pm
[ youtube ]  link  [ /youtube ]

Old but still funny, shame about the quality but I couldn't find a better link. Probably posted before too, oh well. Worthy of a laugh.
Code: [Select]
[youtube]http://www.youtube.com/watch?v=9rXq71all4Y[/youtube]
https://www.youtube.com/watch?v=9rXq71all4Y
Title: Re: Funny Videos/Pictures
Post by: [UK]SheepFucka on March 25, 2010, 02:11:34 pm
lolol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 25, 2010, 02:31:09 pm
what cellphone you got sheep?
Title: Re: Funny Videos/Pictures
Post by: [UK]SheepFucka on March 25, 2010, 02:38:27 pm
er one that rings, lol idk its a shitty nokia
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 25, 2010, 02:55:16 pm
woo

nokia 6300, yeah that one is old.
Title: Re: Funny Videos/Pictures
Post by: ivanduk on March 25, 2010, 07:58:18 pm
(http://photos-h.ak.fbcdn.net/hphotos-ak-snc3/hs428.snc3/24666_401884983091_401884418091_4987962_4049910_n.jpg)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on March 25, 2010, 11:27:30 pm
[ youtube ]  link  [ /youtube ]

Old but still funny, shame about the quality but I couldn't find a better link. Probably posted before too, oh well. Worthy of a laugh.
Code: [Select]
[youtube]http://www.youtube.com/watch?v=9rXq71all4Y[/youtube]
lol.Especially Toyola made me laugh :P
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on March 26, 2010, 12:23:22 pm
(http://30.media.tumblr.com/tumblr_kzvrt4wbxZ1qzjbm1o1_400.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Hellmuth on March 26, 2010, 01:47:02 pm
https://www.youtube.com/watch?v=itYyM4Y9ydE

I laughen everytime
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 26, 2010, 01:52:34 pm
wtf lol
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Hellmuth on March 26, 2010, 01:54:35 pm
https://www.youtube.com/watch?v=VTO5yiN1b-I

https://www.youtube.com/watch?v=7xJC0Z68Eps
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 26, 2010, 01:55:03 pm
lmao lol ^

https://www.youtube.com/watch?v=TkMh-WaWMJo

https://www.youtube.com/watch?v=fkgeK0o7fJc

https://www.youtube.com/watch?v=r3F73LWWyLQ
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Hellmuth on March 26, 2010, 01:59:22 pm
rofl, 1st one was best.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 26, 2010, 02:03:08 pm
looooool

https://www.youtube.com/watch?v=C3saXCfYv74

https://www.youtube.com/watch?v=ciI2AqwWAbY

https://www.youtube.com/watch?v=L19HrJmtvXc
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Hellmuth on March 26, 2010, 02:11:53 pm
LMFAO
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 28, 2010, 12:37:28 pm
https://www.youtube.com/watch?v=ZN5PoW7_kdA
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 28, 2010, 12:42:30 pm
:L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 29, 2010, 12:39:06 am
lol

(http://files.uploadffs.com/a/1/2bb41f9c/t4e6.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on March 29, 2010, 05:38:18 am
online?
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 29, 2010, 07:35:51 am
hahah m4 is driving backwards
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 29, 2010, 03:32:14 pm
https://www.youtube.com/watch?v=G8nQ4YwF16M
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on March 29, 2010, 03:56:32 pm
(http://img.moronail.net/img/8/0/3380.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on March 29, 2010, 03:59:27 pm
That reminds me of this: http://worlds-highest-website.com/
 :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 29, 2010, 10:26:57 pm
(http://files.uploadffs.com/a/3/ff8135b6/25880_105184982849579_100000742343685_101455_1513877_n.jpg)
Title: Re: Funny Videos/Pictures
Post by: some_punk on March 31, 2010, 03:50:33 am
WTF!?!?!?!?! what means debil?????

debil means Weak in spanish...

what means debil in polak or english?? :S im puzzled
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on March 31, 2010, 07:50:53 am
retard :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 31, 2010, 10:50:41 am
(http://www.cowc.org/files/WooBus%20logo1.JPG)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on March 31, 2010, 12:52:30 pm
(http://files.uploadffs.com/a/8/13e780fb/tumblr_l03v80ZqHI1qae091o1_500.jpg)
Title: Re: Funny Videos/Pictures
Post by: Larry on March 31, 2010, 02:45:19 pm
 :o
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on March 31, 2010, 03:00:44 pm
Hahah and everytime he lies his nose gets longer  :o
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on March 31, 2010, 04:13:43 pm
Hahah and everytime he lies his nose gets longer  :o

Lies down in bed with someone you mean.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on March 31, 2010, 04:30:41 pm
lolol with some dude
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 01, 2010, 12:16:29 am
@ falky: OH SNAP!
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Al3X on April 01, 2010, 05:38:57 pm
https://www.youtube.com/watch?v=yc86ZXFsriM
Title: Re: Funny Videos/Pictures
Post by: migs005 on April 02, 2010, 11:36:51 am
What a mouthful!

https://www.youtube.com/watch?v=u4Okn36sGoU

TheLastAirbender
Title: Re: Funny Videos/Pictures
Post by: slowdoh on April 02, 2010, 03:00:37 pm
I was thinking 'keep it clean man' before i actually watched the video D: :x
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on April 03, 2010, 09:30:29 am
(http://27.media.tumblr.com/tumblr_l03x3xVo2v1qaobbko1_400.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on April 03, 2010, 04:23:35 pm
http://www.youtube.com/watch?v=O43v4ix6FEQ
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 03, 2010, 04:44:21 pm
OMGWTFBBQ
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 03, 2010, 05:47:02 pm
Wtf lol
Isn't that from Terminator 2? :L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on April 03, 2010, 09:06:04 pm
it is
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 03, 2010, 11:38:37 pm
wtf I need to watch that movie again, cant remember that part
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on April 05, 2010, 09:08:15 am
(http://www.buyyourall.com/images/mobilephone/snoopy%20mobile%20phone_1.jpg)
Title: Re: Funny Videos/Pictures
Post by: Dead on April 05, 2010, 09:08:57 am
:L :L :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 05, 2010, 12:19:30 pm
haha :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 05, 2010, 12:20:51 pm
lol :L
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 05, 2010, 09:01:25 pm
https://www.youtube.com/watch?v=686paGax_eg
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 06, 2010, 04:51:10 am
parking fail

(http://sphotos.ak.fbcdn.net/hphotos-ak-snc3/hs406.snc3/24606_375260772741_108818807741_3850482_476652_n.jpg)

(http://sphotos.ak.fbcdn.net/hphotos-ak-ash1/hs446.ash1/24606_375260767741_108818807741_3850481_6092482_n.jpg)

car fell off parking lot up the hill

(http://sphotos.ak.fbcdn.net/hphotos-ak-ash1/hs444.ash1/24503_404315862958_708217958_5090206_4637062_n.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]FeTaK_SvK on April 06, 2010, 08:52:21 am
!!!! :DDD
http://www.noelshack.com/uploads/P0rnsexy038488.swf
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on April 06, 2010, 09:42:05 am
https://www.youtube.com/watch?v=LkYfxw2ZXYg
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 06, 2010, 03:53:58 pm
loool wtf, that' crazy :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 07, 2010, 12:28:00 pm
http://roosterteeth.com/archive/episode.php?id=1199

lol nice
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 07, 2010, 05:12:58 pm
http://www.creepygif.com/images/full/922.gif
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 07, 2010, 05:39:49 pm
(http://www.creepygif.com/images/full/922.gif)
Can't see it  :-X
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 07, 2010, 09:20:54 pm
Hm strange, worked before..

http://www.creepygif.com/images/full/922.gif
look there to see Apple fans!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 07, 2010, 09:27:25 pm
It's still the same -___-
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 07, 2010, 09:36:39 pm
heh wtf, it was working for me.. and now its not again, argh leave it. Crap site.

lol, it doesn't even work on their own site for me.. lol.

http://www.creepygif.com (its below on the 1st page)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on April 07, 2010, 09:43:20 pm
they can tell what page you're loading it from. if you load it from here, then it gets blocked. if you load it from there, it loads. buuuuuuuut your browser caches images so it doesn't have to load them again ang again so you can post it here and since your browser already has it loaded from there, it's not blocked but only for you. and if you load it from here and go there, it'll still be blocked until it's deleted from your cache
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 07, 2010, 09:46:42 pm
(gayy)
Title: Re: Funny Videos/Pictures
Post by: MadMax on April 07, 2010, 11:42:56 pm
(http://obczaj.net/obrazki/109587.jpg)
(http://obczaj.net/obrazki/109438.jpg)
(http://obczaj.net/obrazki/109439.jpg)
(http://obczaj.net/obrazki/109440.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on April 08, 2010, 12:10:32 am
(http://imgur.com/gBjlO.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on April 08, 2010, 12:14:26 am
lmfao
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 08, 2010, 12:47:15 am
lol quality
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 08, 2010, 01:37:36 am
lol @ last one
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on April 08, 2010, 10:19:34 am
(http://29.media.tumblr.com/tumblr_l0j62iqG5g1qagpgbo1_500.png)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 08, 2010, 10:31:12 am
haha common problem :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 08, 2010, 10:43:16 am
caves was annoying too
Title: Re: Funny Videos/Pictures
Post by: [UK]SheepFucka on April 08, 2010, 11:18:24 am
lolol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 09, 2010, 01:22:56 pm
(http://i.imgur.com/AzoqK.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 09, 2010, 01:23:06 pm
lmao!
Title: Re: Funny Videos/Pictures
Post by: Epicnawb on April 09, 2010, 02:32:46 pm
lol! xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on April 10, 2010, 04:07:12 am
https://www.youtube.com/watch?v=yGeuiZr-u50
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 10, 2010, 05:49:34 am
https://www.youtube.com/watch?v=TKfwnXQ6PY4

https://www.youtube.com/watch?v=ZmndyXG--UU

________________________________________________________

these are not funny but i like it :)

https://www.youtube.com/watch?v=9LXknb3GOAU

https://www.youtube.com/watch?v=qAsbneT7Dgk
Title: Re: Funny Videos/Pictures
Post by: migs005 on April 10, 2010, 06:49:55 am
Dancin' Hitler

https://www.youtube.com/watch?v=1do0JI-JG4M

You are watching state-sponsored North Korean television. It's Kim Jong il Friday. Thank God, it's mandatory. Watch or you will be thrown in the Pokchong River!

https://www.youtube.com/watch?v=k_-Ik98poTg

You are watching state-sponsored North Korean television. You can change the channel, but you get the same thing.

https://www.youtube.com/watch?v=XIA-kSzd7-8

A military parade to honor our Eternal President Kim il-Sung

https://www.youtube.com/watch?v=7cPb45tzgdQ

Thanksgiving Parade...

https://www.youtube.com/watch?v=jbCz-btE7Tk





Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 10, 2010, 01:30:56 pm
That 8-bit video is FREAKING AWESOME.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 10, 2010, 01:32:15 pm
yep
Title: Re: Funny Videos/Pictures
Post by: [UK]SheepFucka on April 10, 2010, 01:47:03 pm
:o
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 10, 2010, 04:02:20 pm
Where is your God now?

http://www.fail.com.mx/youtube-videos-de-risa-en-espanol/epic-fail-ninos-bailando-reggaeton-perreo-videos-chuscos/

Sorry, I couldn't embed it.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 10, 2010, 04:42:56 pm
wtf :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 10, 2010, 05:11:48 pm
jesus fuckin christ, we gotta kill all those reggaeton bullshit star wannabe, put a huge electric dildo in their asses and fry them motherfuckers. Fuck reggaeton and everything it stands for
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on April 10, 2010, 05:28:02 pm
"New York Gets Destroyed 8-bit Style VIDEO" awesome

https://www.youtube.com/watch?v=cgwxXKsZhAo
https://www.youtube.com/watch?v=nxM1cnphLpw
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 10, 2010, 07:23:13 pm
jesus fuckin christ, we gotta kill all those reggaeton bullshit star wannabe, put a huge electric dildo in their asses and fry them motherfuckers. Fuck reggaeton and everything it stands for

You'll have to go through me first. RAAAAAAAAAAAAAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGGGGGGGGGGHHHHHHHHHHH.

(http://i.imagehost.org/0256/pol.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 11, 2010, 12:18:20 am
This is called daggeren(in dutch but probably also anywhere else).

I don't hate the dance haha, would love if a girl did that with me. But children doing this is gross.
Title: Re: Funny Videos/Pictures
Post by: migs005 on April 11, 2010, 02:48:44 am
Your watching state-sponsored North Korean television. Get it on or die!

https://www.youtube.com/watch?v=NtVIUs511to


At the peak of the fearful relationship between North Korea and America, we have found this video.

North Koreans made this video as a protest against America. They made this in South Korea and broadcast it on a TV news show.

https://www.youtube.com/watch?v=kZEQRZiGZo0

FUCK'N USA

Bush evil! Bush evil!

We clearly remember the blood and tears we shed.
And you were the cause of our country's division.

FUCKING USA!

And we won't forget all of the horrible massacres.
You are a country of murderers.

FUCKING USA!

But if America is such a righteous country,
then why can't we say what we want to say?
Have you, you made us into slaves of our own precious land?
So now we are yelling!

WE ARE AGAINST AMERICA!

You stole the Olympic gold medal from us.
You are a dastardly thief.

FUCKING USA!

You have the ability to steal everything and go on a rampage.
You are a monstrous thief.

FUCKING USA!

Did you hear Bush's violent threats?
Such an audacious country!

FUCKING USA!

You threaten war in North Korea and intrude our internal affairs.
You are a country of gangs.

FUCKING USA!

But if America is such a beautiful country,
then why can't we say what we want to say?
And we're worried about what kind of damage we could get from America.
So now we are yelling!

YANKEE GO HOME!






Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 11, 2010, 04:41:12 am
who is this fuckin retard?
Title: Re: Funny Videos/Pictures
Post by: Dead on April 11, 2010, 05:32:26 am
Thelastairbender also known as thelasthomo.I'm sick of his north korean crap :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 11, 2010, 05:44:58 am
I thought people were paid to be on that stupid guy side, but I see he is followed by extremely ignorant people, they really need help, hope they notice they are in hell
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 11, 2010, 08:07:25 pm
(http://i.imgur.com/Rzz0K.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 12, 2010, 12:31:15 pm
https://www.youtube.com/watch?v=jspubRgyfj4
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on April 12, 2010, 12:59:13 pm
Noob dad  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 12, 2010, 02:29:53 pm
Haha :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 12, 2010, 02:39:32 pm
hahaha that was funny
Title: Re: Funny Videos/Pictures
Post by: ... on April 12, 2010, 10:09:36 pm
https://www.youtube.com/watch?v=_MgARhy18_Q
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 13, 2010, 12:39:17 am
DOODOOCACA's song
https://www.youtube.com/watch?v=IJ1D0A3Ns30



if you dont know it, this the original doodoocaca peepee
https://www.youtube.com/watch?v=q5NO0_qIunE
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 13, 2010, 04:30:36 am
doodoocaca song, I nearly fell asleep, original video, I almost died laughin
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 13, 2010, 05:15:24 pm
https://www.youtube.com/watch?v=_MgARhy18_Q
rofl :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 14, 2010, 12:08:59 pm
Awww, poor guy.
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on April 14, 2010, 03:20:33 pm
https://www.youtube.com/watch?v=_MgARhy18_Q
rofl :L

lmfao
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on April 14, 2010, 05:22:32 pm
 ;D

(http://i42.tinypic.com/24q8rix.jpg)

 :P

(http://i43.tinypic.com/k2g39s.jpg)

ouch hard
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 14, 2010, 05:27:24 pm
(http://i42.tinypic.com/24q8rix.jpg)
wow ive never seen that one before... LOL!
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on April 14, 2010, 05:34:56 pm
lool then you have much drink

(http://i43.tinypic.com/2dt39ep.jpg)

 :o ;D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 14, 2010, 05:39:37 pm
bad, some of them aren't even opened!!
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on April 14, 2010, 05:42:44 pm
(http://i39.tinypic.com/256zgjs.jpg)


(http://i39.tinypic.com/fdhw6w.jpg)




bad, some of them aren't even opened!!

ye xD thats bad 8)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 15, 2010, 10:57:38 am
(http://i44.tinypic.com/v8n4bb.jpg)

(http://cache.gawkerassets.com/assets/images/12/2010/04/500x_mishitbus.jpg)

(http://i41.tinypic.com/1441ohj.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on April 15, 2010, 05:13:22 pm
(http://i44.tinypic.com/2v926nl.jpg)



rock on grandmom XD
(http://i39.tinypic.com/2nbzvpj.jpg)


(http://i39.tinypic.com/2j1moat.jpg)


(http://i44.tinypic.com/2ljlxfk.jpg)



then you need good eyes:
(http://i40.tinypic.com/o85lvo.jpg)


(http://i44.tinypic.com/2vwfy1w.jpg)

(http://i43.tinypic.com/2i8kwfs.jpg)


(http://i42.tinypic.com/2mzk5zs.jpg)



(http://i39.tinypic.com/9t1ksm.jpg)


good luck: ???
(http://i42.tinypic.com/16pffb.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 15, 2010, 06:36:48 pm
(http://i44.tinypic.com/v8n4bb.jpg)
(http://i42.tinypic.com/16pffb.jpg)
The best ones :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 15, 2010, 07:15:01 pm
whats so fun about the plates?
Title: Re: Funny Videos/Pictures
Post by: ... on April 15, 2010, 09:51:01 pm
(http://www.tallrite.com/weblog/blogimages/refs2006/AmericanWorld.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 15, 2010, 10:39:56 pm
(http://www.wordsaboutthings.co.uk/wp-content/uploads/2009/12/berlusconi.jpg)
(http://img.metro.co.uk/i/pix/2009/09/BerlusconiG_450x406.jpg)
(http://www.spadeworker.com/wp-content/uploads/2009/09/real-politics.jpg)
(http://www.internet-news.it/wp-content/uploads/2009/03/berlusconi_cannocchiale.jpg)
(http://driverrob.files.wordpress.com/2009/06/berlusconi.jpg)
(http://1.bp.blogspot.com/_5Udxu_jeDDw/SyZb7ENcNcI/AAAAAAAAAnc/3W3EFGwYrdw/s400/silvio-berlusconi.jpg)

OHHHHHHH YEAAAAAAHH.
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 15, 2010, 11:36:04 pm
(http://img22.imageshack.us/img22/354/0462s.jpg)
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on April 15, 2010, 11:39:49 pm
(http://www.wordsaboutthings.co.uk/wp-content/uploads/2009/12/berlusconi.jpg)
(http://img.metro.co.uk/i/pix/2009/09/BerlusconiG_450x406.jpg)
(http://www.spadeworker.com/wp-content/uploads/2009/09/real-politics.jpg)
(http://www.internet-news.it/wp-content/uploads/2009/03/berlusconi_cannocchiale.jpg)
(http://driverrob.files.wordpress.com/2009/06/berlusconi.jpg)
(http://1.bp.blogspot.com/_5Udxu_jeDDw/SyZb7ENcNcI/AAAAAAAAAnc/3W3EFGwYrdw/s400/silvio-berlusconi.jpg)

OHHHHHHH YEAAAAAAHH.

is my premier  ;D ;D ;D ;D ;D ;D ;D ;D ;D ;D ;) :D :D :D :D :D :D
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 15, 2010, 11:41:38 pm
CYSIO hahahahaa
(http://static.funnyjunk.com/gifs/120px_pedobear2.gif)




(http://i574.photobucket.com/albums/ss186/horchata777/van.gif)


(http://img21.imageshack.us/img21/9482/thumbshumor16.jpg)
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on April 15, 2010, 11:42:06 pm
(http://2.bp.blogspot.com/_5KQbD2fCCxw/SKDicL2vSPI/AAAAAAAABIk/nzKgvDuy-Vs/s400/the-deadliest-catch.jpg)
 :D :D :D :D ;D ;D ;D :D :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on April 16, 2010, 10:15:31 am
Seriously, wtf UK  :o

https://www.youtube.com/watch?v=b8363R9XbGY
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 16, 2010, 10:26:33 am
As with most countries, our Eurovision team are the scum of our music industry. Wait, so why isn't Cheryl Cole there?...

(http://www.sharingmachine.com/prodimages/quab-200.gif)

Quote from: Urban Dictionary
Pronounced (Kwaaaahhb)

1) A quab is a term used to describe the situation where you walk into your room and find you uncle and an octopus under your sheets.
2) Quab is the term used when no other swear could even grasp the complexity of the situation or event.
YOu could be a quab, be a qaubber, be qaubbing, or just doing the act of qaub.
Nephew: Oh my god uncle frank?
Uncle: Oh hello billy, why dont you go out and play some baseball, huh sport?
Nephew: bu but but but....
Uncle: *Pushes out of room* Now run along now.

Boy: Wow Sally is such a Quabber for quabbing that guy
Boy 2: I know right.
boy: Hey sally your a Quab!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 16, 2010, 03:22:42 pm
Eurovision SUXXXXXXXXXXXXXXXXXXXXXXX
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on April 16, 2010, 03:48:00 pm
(http://www.nataliedee.com/100608/BYB-quab.jpg)
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 16, 2010, 08:55:58 pm
(http://www.lsw.uni-heidelberg.de/users/sbrinkma/pictures/you_rock_you_rule.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 16, 2010, 09:03:55 pm
i was bored so i searched for killerbunnies on google images, sorry kb LOL

(http://files.uploadffs.com/a/7/f40e7146/killerbunnies.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 16, 2010, 09:28:29 pm
Oh dear!  :-X

:L
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 16, 2010, 09:47:05 pm
i was bored so i searched for killerbunnies on google images, sorry kb LOL

(http://files.uploadffs.com/a/7/f40e7146/killerbunnies.gif)

epic liar : )
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 16, 2010, 09:47:33 pm
search for it yourself then lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 16, 2010, 09:48:48 pm
I'm struggling to work out how that picture is even possible.
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 17, 2010, 05:38:24 am
hollyyyy shiiiiitttt
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on April 17, 2010, 09:49:05 am
w00www ;D
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on April 17, 2010, 11:55:53 am
disgusting ::)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on April 17, 2010, 12:49:07 pm
(http://i43.tinypic.com/10sbpyh.jpg)

(http://i41.tinypic.com/16a7703.jpg)

(http://i43.tinypic.com/11u9ijn.jpg)

(http://i42.tinypic.com/dfbxxe.jpg)


 ;D :D ;) :)

(http://i42.tinypic.com/nq6xkm.jpg)

(http://i43.tinypic.com/5z0ehk.jpg)

haha
(http://i41.tinypic.com/2nvcyg5.jpg)

(http://i39.tinypic.com/2aakgg8.jpg)

(http://i44.tinypic.com/10ye97p.jpg)

(http://i43.tinypic.com/2rctzjo.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 17, 2010, 08:26:38 pm
(http://i40.tinypic.com/1zprxnq.png)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 17, 2010, 08:27:54 pm
Haha wtf :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 17, 2010, 08:32:14 pm
lol mod haha

i bet that was an infernus :o
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 18, 2010, 05:19:14 am
:L :L :L :L :L :L :L :L :L :L
(http://i40.tinypic.com/1znlr7t.jpg)





search for it yourself then lol

Lame liar (http://www.anikaos.com/040-onion_msn_smilies/onion_msn_smilies/onion_msn_smilies-05.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 18, 2010, 06:22:46 am
(http://i41.tinypic.com/2qltqmb.png)
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 18, 2010, 07:07:09 am
photoshoped -.-

pega el link y te creo...
Title: Re: Funny Videos/Pictures
Post by: [AK47]skunk on April 18, 2010, 12:04:04 pm
https://www.youtube.com/watch?v=138346sq8Fk
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 19, 2010, 12:02:20 am
https://www.youtube.com/watch?v=vt2i0ts-uck




https://www.youtube.com/watch?v=7mP3oGnr0Gw
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 19, 2010, 05:23:28 pm
photoshoped -.-

pega el link y te creo...

ah fak off, took the screenshot, Im not gettin a fuckin link just for u to believe
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on April 19, 2010, 05:28:34 pm
lol, :o


Title: Re: Funny Videos/Pictures
Post by: MadMax on April 19, 2010, 10:26:25 pm
this shit owns, best 47 seconds of the week
https://www.youtube.com/watch?v=ZmXswHuxy98
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 19, 2010, 10:32:10 pm
what the... lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 19, 2010, 10:42:44 pm
lool
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 19, 2010, 10:51:28 pm
polish language xD
Title: Kangaroo FTW ! Funny
Post by: [SFX]Kim on April 19, 2010, 10:58:11 pm
http://www.youtube.com/watch?v=g_FVD0BR2Mc&feature=player_embedded
Title: Re: Kangaroo FTW ! Funny
Post by: [FSR]Ush on April 19, 2010, 11:05:26 pm
http://forum.adrenalinex.co.uk/index.php/topic,362.0.html
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on April 20, 2010, 01:46:51 am
duh duh duh duh-deh dah-duh deh-duh
Title: Re: Kangaroo FTW ! Funny
Post by: [SFX]Kim on April 20, 2010, 02:24:55 am
Oh ok , sorry
Title: Re: Funny Videos/Pictures
Post by: [SFX]Kim on April 20, 2010, 02:26:12 am
Kangoroo FTW !

http://www.youtube.com/watch?v=g_FVD0BR2Mc&feature=player_embedded
Title: Re: Kangaroo FTW ! Funny
Post by: [FSR]Ush on April 20, 2010, 05:54:19 am
np

(http://xenophilius.files.wordpress.com/2008/11/kangaroo-treehugger.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 20, 2010, 09:00:58 am
duh duh duh duh-deh dah-duh deh-duh

that sound like dutch
Title: Re: Funny Videos/Pictures
Post by: [UK]SheepFucka on April 20, 2010, 09:23:37 am
haha goooo kangeroo
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 20, 2010, 12:55:43 pm
(http://lh5.ggpht.com/_-a-RBE6tjuw/SiwgIJmY9SI/AAAAAAAAACw/zB6hu0z7Aj4/6+-+Blond+neger.jpg)
Title: Re: Funny Videos/Pictures
Post by: [AK47]skunk on April 20, 2010, 02:08:22 pm
This is your new haircut? ;D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 20, 2010, 03:09:18 pm
Yep, supercool isn't it!
Title: Re: Funny Videos/Pictures
Post by: [AK47]skunk on April 20, 2010, 03:40:00 pm
Cool 8)
Title: Re: Funny Videos/Pictures
Post by: ivanduk on April 21, 2010, 01:52:50 pm
https://www.youtube.com/watch?v=TRqYvkjeaF4
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 21, 2010, 01:56:16 pm
Hah :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 21, 2010, 02:01:17 pm
that looks creepy lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on April 21, 2010, 03:21:09 pm
lOL

o_O
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 21, 2010, 03:50:59 pm
WTF?!

https://www.youtube.com/watch?v=0mcxALZrUI8
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 21, 2010, 03:52:35 pm
english please ::)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 21, 2010, 04:00:05 pm
use translator
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 21, 2010, 04:02:47 pm
cysio is our translator!!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 21, 2010, 04:03:48 pm
use translator

yeah cos im gonna type down everything they're saying then translate it to english lol......................
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 21, 2010, 04:09:00 pm
we can't even type it down because it sounds like crap in my ears :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on April 21, 2010, 04:09:45 pm
use translator

yeah cos im gonna type down everything they're saying then translate it to english lol......................
lol sounds easy enough
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 21, 2010, 04:12:03 pm
:P
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 21, 2010, 04:22:35 pm
we can't even type it down because it sounds like crap in my ears :L

same with german here + i laugh while im listening that :L

use translator

yeah cos im gonna type down everything they're saying then translate it to english lol......................

i had to do this when i was young  ;)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 21, 2010, 04:26:19 pm
hard life aye :P
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 21, 2010, 04:35:10 pm
we can't even type it down because it sounds like crap in my ears :L

same with german here + i laugh while im listening that :L

As you know I don't speak German as native language.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on April 21, 2010, 04:55:34 pm
My post wasnt made for attack you  ;) i just hate that country, language and german peoples.
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 21, 2010, 04:58:04 pm
hehe, well.. we(the Netherlands) used to hate them too.. but I think we're pretty okay with the western part since they split up and after 1989 also with the eastern part. nowadays we don't hate them anymore, only with football  :D
Title: Re: Funny Videos/Pictures
Post by: ivanduk on April 21, 2010, 07:08:10 pm
Hate their language, there are like 5 synonyms for each word they've got
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 21, 2010, 10:49:20 pm
https://www.youtube.com/watch?v=hNpma0auou8
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 21, 2010, 10:53:43 pm
typical woman for ya

that scream made me bloody jump though
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 21, 2010, 11:02:24 pm
lol!!!

btw shes american, english or from somewhere else... shes not mexican XD
Title: Re: Funny Videos/Pictures
Post by: MadMax on April 22, 2010, 02:03:47 pm
(http://obczaj.net/obrazki/110675.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 22, 2010, 07:24:25 pm
OMG Ush's avatar.  :D

(http://i.imgur.com/FVd96.gif)

(http://img682.imageshack.us/img682/7240/1a99600bd4ff558d6a44faa.jpg) (http://img682.imageshack.us/i/1a99600bd4ff558d6a44faa.jpg/)
(http://img.moronail.net/img/9/2/4192.jpg)
(http://img.moronail.net/img/8/7/4187.jpg)
(http://retailrise.com/system/files/images/shoplift.jpg)
(http://img.moronail.net/img/6/9/4169.jpg)
(http://img.moronail.net/img/6/4/4164.jpg)
(http://img.moronail.net/img/2/7/4127.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 22, 2010, 08:07:10 pm
lol @ the last one :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 22, 2010, 08:14:00 pm
(http://img.moronail.net/img/8/7/4187.jpg)

''its'' :(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 23, 2010, 01:09:55 pm
Probably just didn't have any apostrophes lying around.
Title: Re: Funny Videos/Pictures
Post by: bleh on April 23, 2010, 07:00:06 pm
(http://imgur.com/32tqa.jpg)
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 23, 2010, 08:18:36 pm
The horse man - Philiphines got Talent

https://www.youtube.com/watch?v=69_eq7nsHB0
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on April 24, 2010, 03:47:44 am
Fags like those don't have a place in my country imo.
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 24, 2010, 05:21:30 am
Maybe he is TheLastAirBender :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on April 24, 2010, 06:05:05 am
(http://24.media.tumblr.com/tumblr_l1bn10Sux61qzswiwo1_400.jpg)

..
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 24, 2010, 07:45:50 am
jesus fuckin christ
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on April 24, 2010, 07:48:55 am
wtff :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 24, 2010, 09:56:07 am
(http://24.media.tumblr.com/tumblr_l1bn10Sux61qzswiwo1_400.jpg)

..

hahahaha pure class

fairplay to the dude
Title: Re: Funny Videos/Pictures
Post by: ivanduk on April 24, 2010, 02:16:11 pm
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc3/hs376.snc3/24094_1355671816792_1381357819_31164217_3220076_n.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 24, 2010, 06:10:09 pm
That's terrible.  :o
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on April 24, 2010, 07:40:47 pm
ahaha tali tubi xD nicee
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 24, 2010, 10:13:21 pm
USH

https://www.youtube.com/watch?v=jmwB-oKwk5U
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 24, 2010, 10:55:12 pm
@ Bunnies: He's so high he can't see through the volcanic ash.  :D

(http://img.moronail.net/img/6/2/4262.jpg)
(http://img.moronail.net/img/2/8/4228.jpg)
(http://img.moronail.net/img/5/9/1559.jpg)
(http://4gifs.com/gallery/d/152749-1/Pageant_attack.gif)

Madmax IRL :L :
(http://filesmelt.com/dl/ksvhl.jpg)
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on April 25, 2010, 01:14:16 am
(http://www.gta-expert.com/index.php/galleria/Images/gtaivnews/poster_wanted_niko.jpg)

FRIENDS OF SNOOPY
(http://trickyrelativity.files.wordpress.com/2009/07/snoopy.jpg)


FOR FALKY :D
(http://thebeautybrains.com/wp-content/uploads/2008/08/flaky.jpg)


FOR KILLERTUBBIES
(http://rookery2.viary.com/storagev12/996000/996162_5798_625x1000.jpg)
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 25, 2010, 09:13:20 am
Maybe some vids have already posted...

Latin school...
https://www.youtube.com/watch?v=9Cz_Oq_4i-o

Brazilian school...
https://www.youtube.com/watch?v=sESVQlxxNlU

is this french??? wtf! -.- mental sick
https://www.youtube.com/watch?v=jJzSj0f2zrk

intolerance teacher... there are another ways
https://www.youtube.com/watch?v=KbdWVO8D8uQ

WTF!! shes crazy!!
https://www.youtube.com/watch?v=NN06chJ4G_s

Lets kill this faggot
https://www.youtube.com/watch?v=iVdbPrwyU54

Title: Re: Funny Videos/Pictures
Post by: MadMax on April 26, 2010, 01:15:25 am
(http://obczaj.net/obrazki/111404.jpg)
(http://obczaj.net/obrazki/111296.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 26, 2010, 06:38:39 pm
hahahaha (spin) ;_; (spin)

(http://imgur.com/A8LZB.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on April 26, 2010, 06:39:28 pm
tell everyone about our secret forum why don't you :(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 26, 2010, 06:40:49 pm
you just did a good job of that yourself :(
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on April 26, 2010, 07:17:26 pm
(http://imgur.com/grfra.jpg)

(http://imgur.com/q69Oh.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 26, 2010, 07:53:24 pm
Hahaha, the first one got me :L :L
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on April 26, 2010, 11:22:56 pm
 :)
Title: Re: Funny Videos/Pictures
Post by: MadMax on April 26, 2010, 11:30:21 pm
(http://obczaj.net/obrazki/111438.jpg)
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on April 26, 2010, 11:31:26 pm
(http://i283.photobucket.com/albums/kk316/Undertaker876/crazy-cat.gif)

(http://obczaj.net/obrazki/111438.jpg)
>:(
(http://www.misterseed.com/images/scopion2.jpg)

You like scorpion?


 
is Madmax?

(http://images.paraorkut.com/img/funnypics/images/c/crazy_dance-12762.gif)

:-* ;)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 26, 2010, 11:47:53 pm
u fail at gif links
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on April 26, 2010, 11:58:59 pm

porno video for cat  :D

(http://img96.imageshack.us/img96/3862/26112907.gif)


(http://img96.imageshack.us/img96/3407/84919954.gif)



fixed!!!
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 27, 2010, 12:01:22 am
yet another fail
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on April 27, 2010, 12:06:33 am
yet another fail
fixed :)

(http://i283.photobucket.com/albums/kk316/Undertaker876/crazy-cat.gif)


>:(
(http://www.misterseed.com/images/scopion2.jpg)

You like scorpion?


 
is Madmax?

(http://images.paraorkut.com/img/funnypics/images/c/crazy_dance-12762.gif)

:-* ;)

[/quote]
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 27, 2010, 12:55:56 am
(http://imgur.com/3TAm7.jpg)
(http://imgur.com/xnSoS.gif)
(http://imgur.com/tSWdO.gif)
(http://imgur.com/c9ZNa.gif)
(http://imgur.com/p3qd1.gif)
(http://imgur.com/h3DEg.gif)
(http://imgur.com/uJH6Q.gif)
(http://imgur.com/lKprT.gif)
(http://img13.imageshack.us/img13/6743/powerwheelspusheddownhi.gif)
(http://img685.imageshack.us/img685/8229/2mzbqecjpg.gif)
(http://img339.imageshack.us/img339/3198/wtf1q.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on April 27, 2010, 05:10:08 am
Quote
(http://imgur.com/3TAm7.jpg)

omfg
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on April 27, 2010, 11:18:11 am
Quote
(http://imgur.com/3TAm7.jpg)

omfg
ohhhh yeaahhhh   :P :P :P :P :P :P :P :P :P
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on April 27, 2010, 11:35:46 am
Quote
Im first Italian play driver in ADRENALINEX RACING !
no you aren't! :)
Title: Re: Funny Videos/Pictures
Post by: MadMax on April 27, 2010, 01:27:21 pm
(http://obczaj.net/obrazki/111571.jpg)
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on April 27, 2010, 01:46:33 pm
Quote
Im first Italian play driver in ADRENALINEX RACING !
no you aren't! :)
is true, but I have a career in the server ;)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 27, 2010, 01:50:38 pm
why because you are djharley? =/
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on April 27, 2010, 01:55:37 pm
i don't know Djharley ,and my nickname was always Scorpion

if I remember correctly my first nickname was Scorpion_ITA
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on April 27, 2010, 02:56:27 pm
(http://imgur.com/h3DEg.gif)

I will try this one at home  :D ;D
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on April 27, 2010, 04:57:37 pm
(http://i42.tinypic.com/sc8h2g.jpg)

(http://i42.tinypic.com/f5514z.jpg)

(http://i43.tinypic.com/15rbf61.jpg)

(http://i44.tinypic.com/2ps289z.jpg)

(http://i40.tinypic.com/2czwx2t.jpg)

(http://i40.tinypic.com/vr7cxy.jpg)



(http://i43.tinypic.com/2f0g100.jpg)

(http://i39.tinypic.com/5lnc3l.jpg)

(http://i40.tinypic.com/15ofcck.jpg)

(http://i39.tinypic.com/2eb7gbp.jpg)

(http://i44.tinypic.com/ehxhug.jpg)

(http://i39.tinypic.com/aw3ogp.jpg)



(http://i40.tinypic.com/15qf85u.jpg)

(http://i39.tinypic.com/34t7ubr.jpg)

(http://i39.tinypic.com/160q1jn.jpg)

(http://i42.tinypic.com/1zvecu1.jpg)

(http://i43.tinypic.com/2hwck11.jpg)

(http://i39.tinypic.com/10gdyl4.jpg)

(http://i42.tinypic.com/17p99t.jpg)

(http://i42.tinypic.com/1zohsvk.jpg)

(http://i44.tinypic.com/14jm8mo.jpg)

(http://i39.tinypic.com/2dvtp2u.jpg)

(http://i42.tinypic.com/2znwk1v.jpg)

(http://i41.tinypic.com/sg1oia.jpg)

(http://i44.tinypic.com/slkvvo.jpg)

(http://i43.tinypic.com/x4i1xl.jpg)

(http://i41.tinypic.com/5o737n.jpg)

(http://i44.tinypic.com/e9brlk.jpg)

(http://i41.tinypic.com/f9qebr.jpg)

(http://i39.tinypic.com/2cn8vb6.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on April 27, 2010, 05:43:30 pm
Haha nice :L
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on April 27, 2010, 05:52:02 pm
(http://i44.tinypic.com/2vnl56v.jpg)

Lada Limousine

Russian Limousine xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 27, 2010, 05:59:07 pm
haha @ the russian car, cant say cars cos it seems they only have one type of car xD ((

actually they were all good lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on April 27, 2010, 07:09:00 pm
jeez how the hell people gets out that bus?
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on April 27, 2010, 09:23:50 pm
(http://i40.tinypic.com/2yv16v8.gif)

lmao:
(http://img188.imageshack.us/img188/2820/callmeal.gif)

(http://i42.tinypic.com/24o0cv5.jpg)
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 27, 2010, 11:46:00 pm
https://www.youtube.com/watch?v=SEVU-YLpM8A
Title: Re: Funny Videos/Pictures
Post by: MadMax on April 27, 2010, 11:47:17 pm
ye this lol, very true lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on April 28, 2010, 09:56:11 am
(http://29.media.tumblr.com/tumblr_l1kszc5PGo1qzh5gno1_500.jpg)

(http://25.media.tumblr.com/tumblr_l1kst2FZhL1qzh5gno1_400.jpg)

(http://28.media.tumblr.com/tumblr_l1krvuiN8m1qzh5gno1_500.jpg)

(http://30.media.tumblr.com/tumblr_l1kpq5urpx1qb91hto1_400.jpg)

(http://26.media.tumblr.com/tumblr_l1kr7g0QLT1qzh5gno1_250.gif)
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on April 28, 2010, 12:31:07 pm
https://www.youtube.com/watch?v=playnmJB_TI
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 28, 2010, 12:36:44 pm
hahaha
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on April 28, 2010, 04:49:20 pm
(http://i39.tinypic.com/2ia4lec.jpg)

(http://i43.tinypic.com/117v7dz.jpg)

(http://i43.tinypic.com/4gqgzo.jpg)

(http://i42.tinypic.com/11k8l8l.jpg)

Old skool skateboard:

(http://i43.tinypic.com/2po8ugp.jpg)

(http://i40.tinypic.com/2lxz9xl.jpg)

(http://i41.tinypic.com/105oc47.jpg)

(http://i43.tinypic.com/29kqhj7.jpg)

(http://i44.tinypic.com/jtp63b.jpg)

(http://i39.tinypic.com/142dcua.jpg)

(http://i40.tinypic.com/abjrza.jpg)

(http://i43.tinypic.com/j0zd47.jpg)

(http://i39.tinypic.com/whcodg.jpg)





(http://i43.tinypic.com/311rgae.jpg)

(http://i40.tinypic.com/1z34eqg.jpg)

(http://i41.tinypic.com/bi4fi0.jpg)

(http://i39.tinypic.com/16a455i.jpg)

(http://i43.tinypic.com/als291.jpg)

(http://i39.tinypic.com/10f48sg.jpg)

(http://i44.tinypic.com/144a6mp.jpg)]

(http://i43.tinypic.com/142bv5w.jpg)

(http://i39.tinypic.com/512cub.jpg)

(http://i44.tinypic.com/174s4j.jpg)

(http://i44.tinypic.com/i1h8u9.jpg)

(http://i44.tinypic.com/2w22bma.jpg)

(http://i44.tinypic.com/2h808r7.jpg)

(http://i44.tinypic.com/2csj6mh.jpg)

(http://i39.tinypic.com/fva9es.jpg)

(http://i44.tinypic.com/6hsuav.jpg)

(http://i41.tinypic.com/iqknxw.jpg)

(http://i43.tinypic.com/2gv4emx.jpg)

(http://i40.tinypic.com/2vhwumh.jpg)

(http://i39.tinypic.com/21oubk8.jpg)


(http://i42.tinypic.com/sepyit.jpg)

(http://i40.tinypic.com/4via1f.jpg)

(http://i39.tinypic.com/10ydsmr.jpg)

(http://i39.tinypic.com/2i9m87m.jpg)

(http://i42.tinypic.com/1zgx8ib.jpg)

(http://i43.tinypic.com/f28pqf.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 28, 2010, 05:57:55 pm
https://www.youtube.com/watch?v=playnmJB_TI

hahaha love them
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on April 28, 2010, 06:03:20 pm
(http://i39.tinypic.com/28ciy4g.jpg)

(http://i44.tinypic.com/2aete0n.jpg)

(http://i41.tinypic.com/zwhpv7.jpg)

(http://i41.tinypic.com/wi4xoj.jpg)

(http://i40.tinypic.com/e7gv88.jpg)

(http://i39.tinypic.com/df7sr5.jpg)

(http://i39.tinypic.com/25h0go0.jpg)

So that was it for today.

(http://i41.tinypic.com/642o38.jpg)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on April 28, 2010, 10:49:14 pm
Great stuff :o
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 28, 2010, 10:59:41 pm
jarno finds funny pics :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 28, 2010, 11:01:11 pm
great pics jarno :)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 28, 2010, 11:03:25 pm
jarnlicno
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on April 28, 2010, 11:04:23 pm
garlicno :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 28, 2010, 11:07:29 pm
garjalicnobread :D
Title: Re: Funny Videos/Pictures
Post by: some_punk on April 29, 2010, 12:58:37 am
JAROL  >:(
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on April 29, 2010, 01:42:39 pm
haha thanks guys ;) this weekend niw pics ;) ;D ;D ;D ;D ;D
Title: Re: Funny Videos/Pictures
Post by: MadMax on April 29, 2010, 11:28:40 pm
(http://obczaj.net/obrazki/111925.jpg)
'coz when your weight is 200kg every meter matters'
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on April 30, 2010, 12:10:13 am
(http://i733.photobucket.com/albums/ww332/Acetony/haha.gif)

see it please

http://www.youtube.com/watch?v=R2OS4QOHGfQ

Scorpion WIn  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on April 30, 2010, 01:39:00 am
o_O
Title: Re: Funny Videos/Pictures
Post by: MadMax on April 30, 2010, 11:18:34 am
http://www.youtube.com/watch?v=R2OS4QOHGfQ

Scorpion WIn  ;D

scorpoin have armour hack, not fair
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 30, 2010, 02:43:17 pm
LOL at the tags in the description:

a b c d e f g h i j k l m n o p q r s t u v w x y z
abcdefghijklmnopqrstuvwxyz
Videos:


Evolution of Dance, Pokemon Theme Music Video, SNL - Digital Short - A Special Christmas Box *Uncensored Version, My Chemical Romance - Famous Last Words, guitar, Quick Change Artists on America's Got Talent, shoes, OK Go - Here It Goes Again, Hey clip, Real Life Simpsons Intro, Free Hugs Campaign. (music by Sick Puppies album out April3), Urban Ninja, Hahaha, Ronaldinho: Touch of Gold, lion sleep tonight, muffins, White & Nerdy, Mortal Kombat Theme, beyonce -- irreplaceable, Napoleon Dynamite Dance Scene, GYM CLASS HEROES: Cupid's Chokehold, Lock Bumping and Bump Keys, Scary Movie 4 Trailer, Avril Lavigne -- Girlfriend, Justin Timberlake - My Love, Best card trick in the world

YouTube users:
Lonelygirl15, smosh, miarose, cbs, williamsledd, brookers, baratsandbereta, geriatric1927, thewinkone, gaygod, thehill88, happyslip, boh3m3, lisanova, nbc, brookers, mychemicalromance,mundoreggaeton, tnawrestling, gizmodo, digitalfilmmaker, guitar90, okgo, chrisinscotland, nikesoccer

This video is not mine, I did not make this video. I simply posted it for fun. I am not an "animal abuser", I love animals...
Terms:
Runescape, Bebo, myspace, metacafe, radioblog, wikipedia, video, rebelde, mininova, wiki, Disney, youtube, apple, playstation, xbox, wii, microsoft

Sports:
Nfl, ncaa, baseball, soccer, futbol, football, Nba, basketball, mlb, hockey, nhl, fifa, poker, golf, world cup, nascrar, formula one, snooker, pool, tennis, rugby, boxing, cart, racing, wrestling, wwe

Top women:
Paris Hilton, Tara Reid, Pamela Anderson, Angelina Jolie, Britney Spears, Lindsay Lohan, Jennifer Lopez, Carmen Electra, Brooke Burke, Hilary Duff, Anna Kournikova, Anna Nicole smith, Jessica alba, Cameron diaz, jenna jameson

Top Men:
Clay Aiken,Zac Efron, Nelly, Chris Brown, Howard Stern, Daddy Yankee, Jesse McCartney, Elliot Yamin, Steve Irwin Eminem, Andy Milonakis, 50 Cent, Howard Stern, Tupac Shakur, Michael Jackson, Usher,Bow Wow, Clay Aiken, Brad Pitt, kobe Bryant, Sidney Crosby, david beckham

Top Shows:
American Idol, Lost, South Park, Smallville, Family Guy, CSI, The Simpsons, Scrubs, Survivor, Dancing with the Stars, naruto shippuden, pokemon, dragonball, dragon ball

Top Bands:
Green Day, Pussycat Dolls, Fall Out Boy,Guns N Roses, Rolling Stones, Nickelback, Evanescence, Black-Eyed Peas, All American Rejects, The Fray

Top searched:
lips two girls kissing lesbian hot wild chicks erotic sexy dikes lesbo adult ass butt lesbian lips sex tongues make out adult cute blindfolded chick blonde love lick porn kiss cute boob tit exposed two girls kissing kiss hot wild chicks cute lingerie lips dikes cute panties kissing lesbian wild chiks erotic sex vivthomas dikes tongues make out lezbo striptease nude babe naked sexy girl ass tits lingerie girls hot strip stripping jenna sexyjenna79 ass butt thong booty boobs tits sexy young girl strip tease web cam thongs school dancein underwear funny bra Porn Adult Nude oral anal tits ass breasts naked blowjob blow job cocksucker erotica cum xxx shaved playboy webcam girl sex nude strip teasing web cam sexy hot latina fuck beautiful girls dance webcam hot web cam chicas cute lovely women females britney spears chest tits boobs vagina pussy cunt slut whore drunk club
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on April 30, 2010, 03:02:36 pm
http://www.youtube.com/watch?v=R2OS4QOHGfQ

Scorpion WIn  ;D

scorpoin have armour hack, not fair
(http://www.ps3ita.com/forum/images/smilies/ahah.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on April 30, 2010, 06:59:41 pm
Heard this on the radio today.

https://www.youtube.com/watch?v=SyQ----YaoY

Old but funny. Best are the playground jokes on it :L :

Want some chicken, but are you gonna Nando?
You like kids, but are you gonna paedo?
Drinkin' Fanta, but are you gonna Tango?
Terrorist on a plane, but are you gonna land doe?
Makin' bread, but are you gonna knead doe?
Got 15p, but are you gonna Freddo?
Police at the door so I'm jumpin' out da window.
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on April 30, 2010, 09:13:23 pm
Funny?

https://www.youtube.com/watch?v=s2cCOGyVS8w
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on May 01, 2010, 04:14:20 am
british humour is the fuckin best
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 01, 2010, 04:17:25 pm
aghahahahahaha

https://www.youtube.com/watch?v=1JO0-WCEOw4
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on May 01, 2010, 11:42:20 pm
Great scenes ! :D

https://www.youtube.com/watch?v=Gw-AxiVqihM


https://www.youtube.com/watch?v=xCS7CBcHxtA

https://www.youtube.com/watch?v=BHMkiLOaBgY

And btw, check this 4-Pack spin out too! :L

https://www.youtube.com/watch?v=fc16h-aM89o
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 02, 2010, 01:03:31 am
Hahah that last lap owned!
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 02, 2010, 01:30:20 am
you are it USH  ???
(http://www.fugly.com/media/IMAGES/Priceless/partypants.jpg)

 :D ;)


Madmax in way
(http://www.fugly.com/media/IMAGES/Dumb/nakedcowboy.jpg)
 :D


little fat  ;D
(http://www.fugly.com/media/IMAGES/Funny/poorsneakersxza.jpg)

when i play in Adrenalinex Racing  :P  :D
(http://www.fugly.com/media/IMAGES/Funny/mobilecomputing.jpg)


omg  :o
(http://www.fugly.com/media/IMAGES/Funny/indianfood.jpg)


ya good god  :D Fuck you
(http://www.fugly.com/media/IMAGES/Funny/jesuslovesme.jpg)


 :-* :-* :-* :-*
(http://www.fugly.com/media/IMAGES/Drunk/drunknascarchick.jpg)


MOOMAN  :)
(http://www.fugly.com/media/IMAGES/Funny/cow_pies.jpg)




cRASH  Joe with airplane similar in Gta Sa  :D
(http://www.fugly.com/media/IMAGES/Funny/eyeyeeeeee.jpg)


i love this toilette  8)
(http://www.fugly.com/media/IMAGES/Funny/snowcrapper.jpg)


FUCK RAMMER  :D >:(
(http://www.fugly.com/media/IMAGES/Funny/alphamale.jpg)


POD ? :P :-*
(http://www.fugly.com/media/IMAGES/Funny/bigpeckers.jpg)


BIKE WITH TOILETTE
(http://www.fugly.com/media/IMAGES/Funny/GOcart.jpg)

cRAZy horse
(http://www.fugly.com/media/IMAGES/Funny/stagedive.jpg)

Oval of MadMax
(http://www.fugly.com/media/IMAGES/Funny/traction.jpg)

Sotp
(http://www.fugly.com/media/IMAGES/Funny/sotp.jpg)

Elvis return
(http://www.fugly.com/media/IMAGES/Funny/ElvisOnCrack.jpg)


good hair ;)
(http://www.fugly.com/media/IMAGES/Funny/pimpduck.jpg)

 ::)
(http://www.fugly.com/media/IMAGES/Funny/fuglyclock.jpg)

 :o :o
(http://www.fugly.com/media/IMAGES/Funny/056.jpg)

 >:( :(
(http://www.fugly.com/media/IMAGES/Funny/20dollarwhore.jpg)


Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 02, 2010, 01:52:06 am
hahaha wtf lol

im fucking stoned lol
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 02, 2010, 01:53:10 am
 :D ;D
(http://www.fugly.com/media/IMAGES/Funny/bumperstickers.jpg)

IronMan
(http://www.fugly.com/media/IMAGES/Dumb/canaduhhh.jpg)

For Devil666
(http://www.fugly.com/media/IMAGES/Funny/highwaytohell.jpg)

when I make the screen  ;D
(http://www.fugly.com/media/IMAGES/Funny/printscreen.jpg)

Argghhh
(http://www.fugly.com/media/IMAGES/Funny/aaaaargh.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 02, 2010, 02:01:17 am
hahaahha omg I love your pictures.. hahaha omg IRONMAN LOLOOOOLL!!!

ahhahahaa
ahahahahahaah
LOOOOOL


hahahahahasdsjdasksd
aD::DD::DD:D
DOMG LOLL!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 02, 2010, 09:47:26 am
lol @ ush :L

but Barbie and Ken owns  :D :D
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on May 02, 2010, 03:47:30 pm
Damn keep it up Scorpion, epicness! :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 02, 2010, 03:57:49 pm
The barbie one is lulz
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 02, 2010, 05:31:10 pm
(http://www3.imagocentre.com/images/22/gillette_53.jpg)

American noob talent
(http://www4.imagocentre.com/images/22/gif-funny-fail-lmj!l@.png_57.gif)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on May 03, 2010, 08:35:55 am
Things turn right around :L

https://www.youtube.com/watch?v=XFnYRVdQVgo
Title: Re: Funny Videos/Pictures
Post by: ivanduk on May 03, 2010, 11:52:53 am
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash1/hs498.ash1/27207_1308148302992_1209106551_30790901_240535_n.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 03, 2010, 11:55:45 am
hahaha
Title: Re: Funny Videos/Pictures
Post by: Dead on May 03, 2010, 01:00:26 pm
omg,that's epic :L
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 03, 2010, 01:08:10 pm
(http://avideditor.files.wordpress.com/2009/06/obama-the-sphinx.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on May 04, 2010, 11:33:25 am
(http://i44.tinypic.com/qpp4yf.png)
(http://i39.tinypic.com/x4ogec.jpg)
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 04, 2010, 11:58:54 am
https://www.youtube.com/watch?v=LnpI4djaRTE
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on May 04, 2010, 01:38:17 pm
 ??? ??? ??? ???~Scorp nice pictures but i am the guy with the picture :P

you'r too really great @ ironman ~lOOOOLLL\


Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 04, 2010, 03:48:06 pm
wtff?? ;D
(http://www.fugly.com/media/IMAGES/Random/if_you_keep_making_that_face_it_will_stick_that_way.jpg)

mirror
(http://www.fugly.com/media/IMAGES/Random/heres-to-you-bud.jpg)

CarMod  :o Ban it
(http://www.fugly.com/media/IMAGES/Random/aerodynmaic-advantage-priceless.jpg)

fail controll ::)
(http://www.fugly.com/media/IMAGES/Random/back-that-thing-up.jpg)
 :D
(http://www.fugly.com/media/IMAGES/Random/the_highway_gets_wider_here.jpg)

sex love
(http://www.fugly.com/media/IMAGES/Random/this_man_likes_a_really_big_wet_pussy.jpg)

sexy girl :o
(http://www.fugly.com/media/IMAGES/Random/like_one_of_those_foil_wrapped_hams_you_see_at_christmas.jpg)

ahah
(http://www.fugly.com/media/IMAGES/Random/so_many_uses_for_a_plastic_cup.jpg)

noobs
(http://www.fugly.com/media/IMAGES/Random/two_old_men_screwing.jpg)

pod  :P
(http://www.fugly.com/media/IMAGES/Random/sexy_storm_trooper.jpg)

M4
(http://www.fugly.com/media/IMAGES/Random/man_with_a_very_big_cock.jpg)

kill kill
(http://www.fugly.com/media/IMAGES/Random/catching_a_cheating_wife_ha.jpg)

i want this pc :P ;D
(http://www.fugly.com/media/IMAGES/Random/computer_beer_dispenser.jpg)

or this for good coffe  ;)
(http://www.fugly.com/media/IMAGES/Random/caffeine_machine_1.jpg)

uhaooooo :o 8)
(http://www.fugly.com/media/IMAGES/Random/chrome-bmw.jpg)

ahhhahahah ;D :D ;D
(http://www.fugly.com/media/IMAGES/Random/penguin-diving-through-ice.jpg)

in the end it  :D ;D

https://www.youtube.com/watch?v=jSGWKsJCjzY
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on May 04, 2010, 04:26:34 pm
I have come to the conclussion that this is pod:
(http://www.speedwaybrewing.com/Stig.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 04, 2010, 04:40:19 pm
I have come to the conclussion that this is pod:
(http://www.speedwaybrewing.com/Stig.jpg)

 :o
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 04, 2010, 04:42:55 pm
I have come to the conclussion that this is pod:
(http://www.speedwaybrewing.com/Stig.jpg)

 :o
ie?  ???
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on May 04, 2010, 09:22:13 pm
Stig FTW as pod is also FTW, suspicious right?
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on May 04, 2010, 09:54:06 pm
very
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 04, 2010, 09:56:33 pm
Stig FTW as pod is also FTW, suspicious right?
what?? not understand  :-\ , please explain
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 04, 2010, 09:59:03 pm
kill kill
(http://www.fugly.com/media/IMAGES/Random/catching_a_cheating_wife_ha.jpg)
right pyro, you spit the guy on the ledge, ill smoke the other guy out of the window... charger go!!!! DAMN YOU MISSED... RAGEEEEEEE

damn boomer where the feck are ye
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 04, 2010, 10:02:13 pm
I do not understand what you speak

ahahah ;D :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 04, 2010, 10:03:03 pm
/me throws boomer bile at [ITA]Scorpion
Title: Re: Funny Videos/Pictures
Post by: [MAF]PyroFox on May 04, 2010, 10:03:44 pm
hahahaha :D
/me rage quits.  :(
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 04, 2010, 10:07:50 pm
google not translates this word boomer bile   ??? ???
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 05, 2010, 12:18:37 am
This is a boomer and what he vomits is bile.

So you have boomer bile.

(http://www.secondary-fire.com/wp-content/uploads/2008/11/absolut_boomer.jpg)
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 05, 2010, 12:25:45 am
funny game  ;D

Marlboro ;D
(http://www.fugly.com/media/IMAGES/Funny/marlboro.jpg)

Bissss for Devil
(http://www.fugly.com/media/IMAGES/Funny/barbiekd9kw0.jpg)

For JOE  ;D :D
(http://www.fugly.com/media/IMAGES/Dumb/birthdaycake.jpg)


 :P (rolleyes) :-* For girls of server pod , Vanessa ,Sheepfucka, Anna & etc.
(http://www.fugly.com/media/IMAGES/Babes/drunk_women.jpg)


my face
(http://www.fugly.com/media/IMAGES/WTF/stamp_man.jpg)

yeahhhhhhhhhh ;) Ush like it??
(http://www.fugly.com/media/IMAGES/Drunk/beer-memorial.jpg)

but Ush you not to drink too ;) ;) ;) ;)
(http://www.fugly.com/media/IMAGES/Strange/watermellon.jpg)

wtfff :o
(http://www.fugly.com/media/IMAGES/Scary/hello-kitty-freak.jpg)

crashh  :o :'( :'( :'( :'( :'(
(http://www.fugly.com/media/IMAGES/Sad/beer-destruction.jpg)

ahahahahahha for Falky  ;) ;)
(http://www.fugly.com/media/IMAGES/Drunk/pass-out-72.jpg)


 (rolleyes) 8)
(http://www.fugly.com/media/IMAGES/Funny/marijuana-mcdonalds.jpg)

ahaahhah shitt  ;D
(http://www.fugly.com/media/IMAGES/Gross/say-cheese.jpg)

Seriously, Wtf
(http://www.fugly.com/media/IMAGES/Funny/squirrel_soldier.jpg)

slug maze :D
(http://www.fugly.com/media/IMAGES/Funny/slug_maze.jpg)

Super Mario Bross  :P :P :P ;D :o 8)
(http://www.fugly.com/media/IMAGES/Funny/mario-cookie.jpg)

 :D
(http://www.fugly.com/media/IMAGES/Crazy/offroad-wheelchair.jpg)

 :o ??? Japanesi crazy
(http://www.fugly.com/media/IMAGES/TRUE/ant_soccer.jpg)

good agility  :o :D
(http://www.fugly.com/media/IMAGES/Gross/flexible_fat_guy.jpg)

in the end photo funny for all Admins  ;D ;)
(http://www.fugly.com/media/IMAGES/WTF/Polar_Bear_Tongue.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 05, 2010, 03:15:34 am
:P (rolleyes) :-* For girls of server pod , Vanessa ,Sheepfucka, Anna & etc.
(http://www.fugly.com/media/IMAGES/Babes/drunk_women.jpg)

pod's a girl? :o

ahahahahahha for Falky  ;) ;)
(http://www.fugly.com/media/IMAGES/Drunk/pass-out-72.jpg)


lol hardcore
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 05, 2010, 03:50:18 am
pod's a girl? :o
i think so. we better ask her to be sure
Title: Re: Funny Videos/Pictures
Post by: pod on May 05, 2010, 11:15:59 am
:P (rolleyes) :-* For girls of server pod , Vanessa ,Sheepfucka, Anna & etc.
(http://www.fugly.com/media/IMAGES/Babes/drunk_women.jpg)

pod's a girl? :o

No.
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 05, 2010, 11:26:35 am
pod's a doll.
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 05, 2010, 11:45:51 am
pod isn't a girl ???  ??? :-[ :'(

i think is girl  :(
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 05, 2010, 12:42:43 pm
haha
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on May 05, 2010, 02:11:15 pm
lol :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Reller on May 05, 2010, 02:17:03 pm
(http://forum.adrenalinex.co.uk/Smileys/default/tRDvJjVtKsqb6zdWUBdiJt7emmc.gif)
Title: Re: Funny Videos/Pictures
Post by: MadMax on May 05, 2010, 03:31:43 pm
girl scripter/programmer?
(possible but very rare lol)
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 05, 2010, 04:42:03 pm
girl scripter/programmer?
Possible  :'( :'( :-[
Title: Re: Funny Videos/Pictures
Post by: ivanduk on May 05, 2010, 04:50:19 pm
(possible but very rare lol)
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 05, 2010, 05:38:19 pm
(http://izismile.com/img/img3/20100504/640/daily_picdump_404_640_106.jpg)
(http://izismile.com/img/img3/20100504/640/daily_picdump_404_640_117.jpg)
(http://izismile.com/img/img3/20100504/640/daily_picdump_404_640_118.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 05, 2010, 05:39:11 pm
Failed again lol

This really is a bubble gum  :D
(http://imgur.com/WOV8s.jpg)
Title: Re: Funny Videos/Pictures
Post by: ivanduk on May 05, 2010, 09:10:39 pm
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash1/hs470.ash1/25803_122359294444217_100000104421198_325083_8350058_n.jpg)
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 05, 2010, 09:57:24 pm
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash1/hs470.ash1/25803_122359294444217_100000104421198_325083_8350058_n.jpg)

aahahahahah :D ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Rac3r on May 06, 2010, 04:12:51 pm
Only look at this if you're up for a scare, it's fucking sick!

http://bluewaffle.net/bw.jpg
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 06, 2010, 04:19:23 pm
OMFGGGGGG!!!!
Damn R, you shouldn't post such things here :L
Title: Re: Funny Videos/Pictures
Post by: Dead on May 06, 2010, 04:23:05 pm
ewwwwww :L
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on May 06, 2010, 08:05:06 pm
Failed again lol

This really is a bubble gum  :D
(http://imgur.com/WOV8s.jpg)
Seriously, WTF?
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 06, 2010, 08:39:56 pm
hahaha liquid filled :P
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 07, 2010, 05:11:02 am
Destroyed! :o
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 07, 2010, 04:42:07 pm
sweet bob of the camel  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on May 08, 2010, 12:24:08 am
(http://img.moronail.net/img/5/3/4653.jpg)
(http://img.moronail.net/img/3/3/4633.jpg)
(http://img.moronail.net/img/7/9/4579.jpg)
(http://img.moronail.net/img/3/6/4536.jpg)
(http://img.moronail.net/img/8/7/2787.jpg)

(http://img718.imageshack.us/img718/1633/kgpdweb.jpg)
(http://i43.tinypic.com/25tfaz6.jpg)
(http://i41.tinypic.com/11tohkx.jpg)
(http://i44.tinypic.com/2wcitj4.jpg)
(http://i40.tinypic.com/w82fi8.jpg)
(http://i41.tinypic.com/20i83rl.jpg)

This one's for all the boy racers:
https://www.youtube.com/watch?v=BaeNelsAOGo
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 08, 2010, 02:07:23 am
^ love that song, owns.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on May 08, 2010, 02:08:34 am
This reminds me of Joe: watch at least the first minute from the start.

https://www.youtube.com/watch?v=9SYp0UqhqAo

Some one commented on the video "this is very realistic" :L.

This one just made me roll with laughter.

https://www.youtube.com/watch?v=tDqJGukKIVg
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 08, 2010, 02:15:51 am
Quote
Some one commented on the video "this is very realistic" :L.

lmao
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 08, 2010, 02:16:16 am
This reminds me of Joe: watch at least the first minute from the start.

https://www.youtube.com/watch?v=9SYp0UqhqAo

Some one commented on the video "this is very realistic" :L.

This one just made me roll with laughter.

https://www.youtube.com/watch?v=tDqJGukKIVg
hakerr ban it please  :D ;D
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on May 08, 2010, 05:02:04 pm
lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 08, 2010, 08:09:13 pm
Old but great :L

https://www.youtube.com/watch?v=qffCXkhodks

https://www.youtube.com/watch?v=6Sf_pogZ8jE

https://www.youtube.com/watch?v=2D4KTXkbyto
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on May 08, 2010, 08:58:01 pm
(http://ipicture.ru/upload/100508/g0mhipHvT8.jpg)
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 09, 2010, 08:53:12 am
:O  great map

(http://ipicture.ru/upload/100508/g0mhipHvT8.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on May 09, 2010, 09:18:55 am
:O  great map

(http://ipicture.ru/upload/100508/g0mhipHvT8.jpg)


Wow ye indeed
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 09, 2010, 10:03:05 am
Is it yours ?  :o
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on May 09, 2010, 12:24:03 pm
LOL. No.

http://www.gtaforums.com/index.php?showtopic=448181&st=0
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on May 10, 2010, 04:41:51 pm
(http://i42.tinypic.com/dnye4z.png)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 10, 2010, 04:50:38 pm
Omg lol :L :L
http://www.newgrounds.com/portal/view/535461
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 10, 2010, 06:24:19 pm
(http://i42.tinypic.com/dnye4z.png)

lol cool
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on May 10, 2010, 07:38:50 pm
Omg lol :L :L
http://www.newgrounds.com/portal/view/535461

:L :L :L :L :L :L :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 10, 2010, 08:55:44 pm
(http://i42.tinypic.com/dnye4z.png)

lol cool
bit big for a sig though :/
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 11, 2010, 08:12:12 pm
https://www.youtube.com/watch?v=dkHJKakHMpo
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 11, 2010, 08:37:46 pm
(http://forum.adrenalinex.co.uk/Smileys/default/tRDvJjVtKsqb6zdWUBdiJt7emmc.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on May 11, 2010, 08:40:01 pm
lol great one
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on May 11, 2010, 08:49:57 pm
:L nice
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 11, 2010, 08:51:48 pm
(http://img40.imageshack.us/img40/7373/rita.png)
 :o :o :o :o  :'( :'( :'( :'( :'( :'( :'( :'( :'(  :D :D :D :D  8)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on May 11, 2010, 08:52:39 pm
loooool now he is angry xD >:( :P :P
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 12, 2010, 03:03:12 am
https://www.youtube.com/watch?v=dkHJKakHMpo

xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 12, 2010, 08:00:35 am
lol paprika with russian accent  ;D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 12, 2010, 01:56:06 pm
Italian.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on May 12, 2010, 03:52:10 pm
maybe for you, for me its funny russian accent xd
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 12, 2010, 06:09:46 pm
Ohh, so this is where your name comes from Gen  :D

(http://files.posterous.com/electricant/Kc77vuZxA1i8XXPSyhOXfsop1jF0KUHaUP5Ym62JWNGEpWp7UgablbpvY3NC/3-Gen13-1.jpg?AWSAccessKeyId=1C9REJR1EMRZ83Q7QRG2&Expires=1273687941&Signature=Fy12%2Fonjt%2FgPoxZ3feNJS2kH980%3D)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on May 12, 2010, 07:46:03 pm
(http://img.moronail.net/img/7/3/4773.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 12, 2010, 08:12:56 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on May 13, 2010, 05:35:49 pm
(http://i577.photobucket.com/albums/ss219/zimfromBM/125429222806.jpg)
(http://i42.tinypic.com/14mtbr.jpg)
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 14, 2010, 02:17:10 am
https://www.youtube.com/watch?v=OKfqjA6mhGo
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on May 14, 2010, 03:35:01 pm
Whoever left that toolbox there should be promoted.  ;)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 14, 2010, 03:41:14 pm
Whoah, Euro fags, that's hilarious! :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on May 14, 2010, 06:30:17 pm
lol what a noob, elevator was left in hydraulic mode, you always have to make sure to lower it to the safety locks so that kind of accident doesnt happen
Title: Re: Funny Videos/Pictures
Post by: pod on May 14, 2010, 09:13:33 pm
it's an advertisement for kobalt tools, it's run during nascar races
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 15, 2010, 02:13:59 am
lol found the commercial vid

https://www.youtube.com/watch?v=gAIRlVfQX4U
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on May 15, 2010, 11:52:49 am
lol  ;D
Title: Re: Funny Videos/Pictures
Post by: [AK47]skunk on May 15, 2010, 01:09:45 pm
New Europe map ;D

(http://img693.imageshack.us/img693/1408/nowamapaeuropydb33b278a.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on May 15, 2010, 11:03:18 pm
LOL, nice one skunk. I think Ireland has the most Polish though. In many villages there are more Polish people than locals.  :D

(http://filesmelt.com/dl/dadi_pour.png)
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 16, 2010, 12:09:32 am
https://www.youtube.com/watch?v=EFkER6TrQt0
Title: Re: Funny Videos/Pictures
Post by: [AK47]skunk on May 16, 2010, 08:32:25 am
(http://img41.imageshack.us/img41/8184/186221weedant1.jpg)

(http://img15.imageshack.us/img15/8379/z4714570x.jpg)

(http://img36.imageshack.us/img36/8776/weedmm.jpg)

(http://img208.imageshack.us/img208/6189/rastasurprisebig.jpg)

(http://img8.imageshack.us/img8/4277/246541451096760976cf.jpg)

(http://img97.imageshack.us/img97/8404/20100419nhsenate.jpg)

(http://img641.imageshack.us/img641/9360/weedmd.jpg)

(http://img692.imageshack.us/img692/9416/weedg.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on May 16, 2010, 08:35:40 am
:L nice pics
Title: Re: Funny Videos/Pictures
Post by: ZeeK on May 16, 2010, 08:51:20 am
:o
(http://img11.yfrog.com/img11/9226/veryfunny31.jpg)

okok : http://www.abrutis.com/video-mlle+l+infirmiere-14031.html?joueur=misterdream78
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Hellmuth on May 16, 2010, 06:12:24 pm
ROFFFFFFFFFFFL

(http://lolpics.se/pics/1326.jpg)
(http://lolpics.se/pics/1494.jpg)
(http://lolpics.se/pics/484.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 16, 2010, 07:30:00 pm
I see only some lolpics.se :(
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on May 17, 2010, 04:53:16 am
yeah, epic fail
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Phil_Ivey on May 17, 2010, 06:14:46 am
these were the pics isildur posted

(http://img710.imageshack.us/img710/5696/lol1vv.jpg)

(http://img91.imageshack.us/img91/7183/lol2t.jpg)

(http://img31.imageshack.us/img31/4204/lol3m.jpg)

Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 17, 2010, 10:24:34 am
:L :L :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on May 17, 2010, 02:09:51 pm
this one is amazing, only 14 seconds, but owns :L
https://www.youtube.com/watch?v=iKJvHbTHSxQ
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 17, 2010, 02:33:00 pm
lol fake.
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 17, 2010, 02:47:00 pm
nah it's real :D
Title: Re: Funny Videos/Pictures
Post by: [AK47]skunk on May 17, 2010, 02:57:50 pm
hahaha :o 8) ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 17, 2010, 03:01:17 pm
(http://24.media.tumblr.com/tumblr_l2j82lPPWB1qa5c6co1_500.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 17, 2010, 03:52:43 pm
lol
Title: Re: Funny Videos/Pictures
Post by: MadMax on May 17, 2010, 10:12:55 pm
Code: [Select]
http://obczaj.net/obrazki/113627.jpg
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Hellmuth on May 17, 2010, 10:48:00 pm
max thats just sick
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on May 17, 2010, 10:49:28 pm
Code: [Select]
http://obczaj.net/obrazki/113627.jpg

LMFAO, but gross ^^
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on May 18, 2010, 12:20:09 am
Hmm what about a pack in my taste? (a sleepy taste :L)

(http://www.funcage.com/photos/06_bussad_31241.jpg)

Fail V

(http://www.funcage.com/photos/Suzuki-Swift-Time-for-a-Swift-Exit.jpg)

(http://www.funcage.com/photos/funcage0033.jpg)

:L

(http://www.funcage.com/photos/capguy.jpg)

(http://www.funcage.com/photos/1158554515_podb43_41.jpg)

Spaggy :L

(http://www.funcage.com/photos/advertise2007-9.jpg)

(http://www.funcage.com/photos/reflective-Legs.jpg)

(http://www.funcage.com/photos/ads9556.jpg)

(http://www.funcage.com/photos/57.jpg)

Bus designs are ftw, sometimes ftl :L

(http://www.funcage.com/photos/19_bussad_23996.jpg)

Google, when there was no internet. :L

(http://www.funcage.com/photos/funcage-google-1960.jpg)

(http://www.funcage.com/photos/1170010800_479.jpg)

(http://www.funcage.com/photos/kiss.jpg)

:L

(http://www.funcage.com/photos/1182584516_husky_rider.jpg)

(http://www.funcage.com/photos/4379.jpg)

(http://www.funcage.com/photos/Brake%20check.jpg)

(http://www.funcage.com/photos/billboard_war.jpg)

(http://www.funcage.com/photos/what-goes-around.jpg)

(http://www.funcage.com/photos/i-haz-an-idea.jpg)


(http://www.eatliver.com/img/temp/561.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 18, 2010, 12:30:45 am
lol nice pictures love :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on May 18, 2010, 09:19:23 am
Quote from: Love
(http://www.funcage.com/photos/capguy.jpg)

Thanks! I've been looking for that one for aaaages.
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 18, 2010, 10:32:18 am
https://www.youtube.com/watch?v=m9-kM-guQtk
https://www.youtube.com/watch?v=424e6jWv3P0
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 18, 2010, 11:32:21 am
wtf niggas :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on May 18, 2010, 04:38:55 pm
https://www.youtube.com/watch?v=ZlIe7IS86qc

https://www.youtube.com/watch?v=keOochMM3gY

Watch the second one from 2:30.  :D

Edit: Looool, whiteboy at 3:49 (on second one).

Mans, this is the best one doe:

https://www.youtube.com/watch?v=c1UaKGAow7s
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on May 18, 2010, 05:01:19 pm
wtf who removed my picturs??? ??? ???
Title: Re: Funny Videos/Pictures
Post by: jarecki666 on May 18, 2010, 07:24:11 pm
wtf who removed my picturs??? ??? ???
moge JarnoooOooOOooOOooOOOoo  :-*
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on May 19, 2010, 04:35:59 pm
(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274277969-540.jpg) (http://www.plaatjesupload.nl/bekijken/2659378.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278010-290.jpg) (http://www.plaatjesupload.nl/bekijken/2659386.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278065-160.jpg) (http://www.plaatjesupload.nl/bekijken/2659390.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278081-250.jpg) (http://www.plaatjesupload.nl/bekijken/2659392.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278210-990.jpg) (http://www.plaatjesupload.nl/bekijken/2659408.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278377-690.jpg) (http://www.plaatjesupload.nl/bekijken/2659423.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278377-691.jpg) (http://www.plaatjesupload.nl/bekijken/2659424.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278377-692.jpg) (http://www.plaatjesupload.nl/bekijken/2659425.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278377-693.jpg) (http://www.plaatjesupload.nl/bekijken/2659426.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278377-74.jpg) (http://www.plaatjesupload.nl/bekijken/2659427.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274278481-080.jpg) (http://www.plaatjesupload.nl/bekijken/2659438.html)



(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280330-010.gif) (http://www.plaatjesupload.nl/bekijken/2659555.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280330-011.jpg) (http://www.plaatjesupload.nl/bekijken/2659556.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280330-012.jpg) (http://www.plaatjesupload.nl/bekijken/2659557.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280330-013.jpg) (http://www.plaatjesupload.nl/bekijken/2659558.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280330-014.jpg) (http://www.plaatjesupload.nl/bekijken/2659559.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280661-360.jpg) (http://www.plaatjesupload.nl/bekijken/2659575.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280661-361.jpg) (http://www.plaatjesupload.nl/bekijken/2659576.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280661-372.jpg) (http://www.plaatjesupload.nl/bekijken/2659577.html)


(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280661-373.jpg) (http://www.plaatjesupload.nl/bekijken/2659578.html)

(http://www.plaatjesupload.nl/bekijk/2010/05/19/1274280661-374.jpg) (http://www.plaatjesupload.nl/bekijken/2659579.html)
Title: Re: Funny Videos/Pictures
Post by: ivanduk on May 19, 2010, 05:45:13 pm
(http://s2.noelshack.com/uploads/images/8817512920524_5.jpg)
(http://s2.noelshack.com/uploads/images/7816759835841_2.jpg)
(http://s2.noelshack.com/uploads/images/19431955410120_1274013090722.jpg)
(http://s2.noelshack.com/uploads/images/7962986411721_tumblr_kpowgzkqwa1qzma4ho1_400.jpg)
(http://s2.noelshack.com/uploads/images/20195374670559_3.jpg)

this piece of shit is gonna represent my country on eurovision -.-
https://www.youtube.com/watch?v=2aCJPcQznfc
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on May 19, 2010, 05:53:53 pm
(http://img.moronail.net/img/5/8/4958.jpg)
(http://img.moronail.net/img/4/8/4948.jpg)
(http://img.moronail.net/img/3/2/1132.jpg)

(http://i.imgur.com/gyRvd.jpg)


(http://img37.imageshack.us/img37/1858/image015okq.jpg)
Title: Re: Funny Videos/Pictures
Post by: ZeeK on May 19, 2010, 06:20:47 pm
http://www.abrutis.com/video-compilation+de+choses+droles+et+insolites-29280.html
Title: Re: Funny Videos/Pictures
Post by: some_punk on May 19, 2010, 11:30:32 pm
https://www.youtube.com/watch?v=xlEaQD6PJNE
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 20, 2010, 12:08:06 am
(http://static.pyzam.com/img/funnypics/6/pyzamseduction.jpg)

(http://static.pyzam.com/img/funnypics/4/pyzamsosexy.jpg)
(http://static.pyzam.com/img/funnypics/1/pyzampoopattack.jpg)
(http://static.pyzam.com/img/funnypics/7/pyzamexcited.jpg)
(http://static.pyzam.com/img/funnypics/c/pyzamhandhead.jpg)
(http://static.pyzam.com/img/funnypics/2/pyzampolekiller.jpg)
(http://static.pyzam.com/img/funnypics/4/pyzampelicannom.jpg)
(http://static.pyzam.com/img/funnypics/8/pyzamuhoh.jpg)
(http://static.pyzam.com/img/funnypics/b/pyzamlobsterknife.jpg)
(http://static.pyzam.com/img/funnypics/0/pyzam1up.jpg)
(http://static.pyzam.com/img/funnypics/7/pyzamplacement.jpg)
(http://static.pyzam.com/img/funnypics/7/pyzamperfectcake.jpg)
(http://static.pyzam.com/img/funnypics/5/pyzamcaterday.jpg)
(http://static.pyzam.com/img/funnypics/6/pyzamlamplie.jpg)
(http://static.pyzam.com/img/funnypics/9/pyzamhalfandhalf.jpg)
(http://www.pyzam.com/funnypictures/details/6314?cat=all&sort=newest)
(http://static.pyzam.com/img/funnypics/e/pyzamfailhellokitty.jpg)
(http://www.pyzam.com/funnypictures/details/6205?cat=all&sort=newest)
(http://static.pyzam.com/img/funnypics/d/pyzambandface.jpg)
(http://www.pyzam.com/funnypictures/details/3803?cat=all&sort=popular)
(http://www.pyzam.com/funnypictures/details/9314?cat=all&sort=popular)
(http://static.pyzam.com/img/funnypics/d/monat.jpg)
(http://www.pyzam.com/funnypictures/details/10145?cat=all&sort=popular)
(http://www.pyzam.com/funnypictures/details/10497?cat=all&sort=popular)
(http://www.pyzam.com/funnypictures/details/7249?cat=all&sort=popular)
(http://www.pyzam.com/funnypictures/details/4417?cat=all&sort=popular)
(http://static.pyzam.com/img/funnypics/4/pyzamfucked.jpg)
(http://www.pyzam.com/funnypictures/details/3904?cat=all&sort=popular)

(http://static.pyzam.com/img/funnypics/8/pyzamdogchores.jpg)
(http://static.pyzam.com/img/funnypics/1/steep.jpg)
(http://static.pyzam.com/img/funnypics/f/dontdiez.jpg)
(http://static.pyzam.com/img/funnypics/6/pyzamwtf2.jpg)
(http://static.pyzam.com/img/funnypics/c/pyzamjealous.jpg)
(http://www.pyzam.com/funnypictures/details/3760?cat=all&sort=popular)
(http://static.pyzam.com/img/funnypics/0/pyzamOmgWtf.jpg)
(http://static.pyzam.com/img/funnypics/6/pyzamfear.jpg)
(http://static.pyzam.com/img/funnypics/b/pyzamawesomecat.jpg)
(http://static.pyzam.com/img/funnypics/c/savungsfail.jpg)
(http://static.pyzam.com/img/funnypics/7/rollercoaster.jpg)
(http://static.pyzam.com/img/funnypics/c/boomheadshot.jpg)
(http://static.pyzam.com/img/funnypics/2/serioushell.jpg)
(http://static.pyzam.com/img/funnypics/d/beerotter.jpg)
(http://www.pyzam.com/funnypictures/details/9865?cat=all&sort=popular)
(http://static.pyzam.com/img/funnypics/3/9.jpg)
(http://static.pyzam.com/img/funnypics/3/pigfluuu.jpg)
(http://static.pyzam.com/img/funnypics/e/ownedgpas.jpg)
(http://static.pyzam.com/img/funnypics/7/pyzamheaven.jpg)
(http://static.pyzam.com/img/funnypics/4/collegehumor.23b94edec8d8bbeb3357d05b993153b9.jpg)
(http://static.pyzam.com/img/funnypics/d/1372.jpg)
(http://static.pyzam.com/img/funnypics/f/scarylunch.jpg)
(http://static.pyzam.com/img/funnypics/6/happybutt.jpg)
(http://static.pyzam.com/img/funnypics/animals/2rwot1f.jpg)
(http://static.pyzam.com/img/funnypics/animals/bucket.gif)
(http://static.pyzam.com/img/funnypics/5/clarkass.jpg)
(http://static.pyzam.com/img/funnypics/4/7440_4755_thumb.jpg)
(http://static.pyzam.com/img/funnypics/c/failcamera.jpg)
(http://static.pyzam.com/img/funnypics/4/wazupdogg.jpg)
(http://static.pyzam.com/img/funnypics/a/crapplane.jpg)
(http://static.pyzam.com/img/funnypics/5/tanksintheparkinglot.jpg)
(http://static.pyzam.com/img/funnypics/6/pyzamsrslywtf.jpg)
(http://static.pyzam.com/img/funnypics/8/urnext.jpg)

(http://static.pyzam.com/img/funnypics/6/xboxcar.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 20, 2010, 05:14:42 pm
Nice :L :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 20, 2010, 05:16:16 pm
This is how 15,980,654,300 $ looks like

(http://4.bp.blogspot.com/_kIJfJnqC_dU/S_R6_ayAiYI/AAAAAAAAAGM/SaZYw67Qjzk/s1600/2008-05-27-100MillionCash.jpg)
Title: Re: Funny Videos/Pictures
Post by: ivanduk on May 20, 2010, 05:22:31 pm
This is how 15,980,654,300 $ looks like

(http://4.bp.blogspot.com/_kIJfJnqC_dU/S_R6_ayAiYI/AAAAAAAAAGM/SaZYw67Qjzk/s1600/2008-05-27-100MillionCash.jpg)


haha from that fanpage on facebook :D
Title: Re: Funny Videos/Pictures
Post by: MadMax on May 20, 2010, 05:52:35 pm
(http://obczaj.net/obrazki/113710.jpg)
(http://obczaj.net/obrazki/113738.jpg)
(http://obczaj.net/obrazki/113658.jpg)
(http://obczaj.net/obrazki/113660.jpg)
(http://obczaj.net/obrazki/113661.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 20, 2010, 06:12:59 pm
This is how 15,980,654,300 $ looks like

(http://4.bp.blogspot.com/_kIJfJnqC_dU/S_R6_ayAiYI/AAAAAAAAAGM/SaZYw67Qjzk/s1600/2008-05-27-100MillionCash.jpg)


haha from that fanpage on facebook :D

 ;D
Title: Re: Funny Videos/Pictures
Post by: some_punk on May 21, 2010, 05:49:30 am
This is how 15,980,654,300 $ looks like

(http://4.bp.blogspot.com/_kIJfJnqC_dU/S_R6_ayAiYI/AAAAAAAAAGM/SaZYw67Qjzk/s1600/2008-05-27-100MillionCash.jpg)


haha from that fanpage on facebook :D

LIES!!!

That is 205 millions of dollars, it got recovered by mexican police from a drug trafficker called Zhenli Ye Gon, but he said that he was innocent and  Mexican Goverment and a political group called PAN (Partido Acción Nacional) threatened him for get bribely for political stuff.
As he said: "Mexican Goverment wanted my money for the Felipe Calderon's Campaign (actually president of México), it wasnt safe in any bank of Mexico, so i got saved all that money in my house", when mexican police broke-in his house he was in USA, in accordance with him.

Zhenli Ye Gon is on United States atm, hes going to court because Mexican Goverment has not enough proofs for get him in jail.

It was a bomb news, every mass media announced that shit. and in first place goverment said: "we got 205 millions of dollars from a drug trafficker".... 2 weeks after they said: "Sorry, in the transportation from Zhenli Ye Gon´s house to a secure place, we counted 150 millions of dollars, we made a mistake ;D but the good new is that we got the money, and we will invest it for new hospitals, social security, better health care, etc, etc. and we gonna do a good country ;D"
BULLSHIT!! they've stolen rest money, our fucking goverment is a shit, the biggest shit in the entire world.... deputy, senators, governators and president steals a lot of money of mexico each year... when they get out from their "work", they put their money into a swiss bank and go for trip around the world.

Where is that 55 millions of dollar less??? well....Our dear president and his buddies had stolen it aswell >:(

And us, the mexicans have no the fault, even when we choose a "good" president/candidate, another political group kill him... for example: Luis Donaldo Colosio Murrieta who was murdered cuz he wanted to grow up Mexico, and another politicals haters whom only wants more money and power doesnt allow that México gets better.

http://en.wikipedia.org/wiki/Zhenli_Ye_Gon

compare these billss with into the pic.. :)
(http://nuevavisiondevida.files.wordpress.com/2010/01/500_pesos.jpg)
(http://cdn.vivirmexico.com/files/2007/12/1000_pesos.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 21, 2010, 10:37:26 am
You're not the only one who uses pesos for your currency ;_;

(http://www.cagayan-de-oro.com/500pesos.jpg)

(http://upload.wikimedia.org/wikipedia/en/e/eb/Php_bill_1000_front.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on May 21, 2010, 02:56:56 pm
(http://obczaj.net/obrazki/113710.jpg)
(http://obczaj.net/obrazki/113738.jpg)
(http://obczaj.net/obrazki/113658.jpg)
(http://obczaj.net/obrazki/113660.jpg)
(http://obczaj.net/obrazki/113661.jpg)

:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on May 22, 2010, 04:37:19 pm

(http://static.pyzam.com/img/funnypics/6/pyzamlamplie.jpg)


(http://i36.tinypic.com/9lk239.jpg)
(http://a3.ac-images.myspacecdn.com/images01/13/l_2d18705ca73b3ca0fdeacf1785033bd2.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 22, 2010, 04:50:00 pm
mmm that's one sexy lamp
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 22, 2010, 05:26:21 pm
it's from IKEA :)
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 22, 2010, 06:38:43 pm
(http://static.pyzam.com/img/funnypics/8/pyzamexplosivepoo.jpg)
(http://static.pyzam.com/img/funnypics/6/bargain.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on May 23, 2010, 09:15:37 am
http://www.youtube.com/watch?v=WlnqF9djPGM&playnext_from=TL&videos=df-4lu_ufaQ

it is in NL but it is so funny ;D
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 23, 2010, 09:41:09 am
http://www.youtube.com/watch?v=WlnqF9djPGM&playnext_from=TL&videos=df-4lu_ufaQ

it is in NL but it is so funny ;D
Nooo this is funny :P (http://static.pyzam.com/img/funnypics/8/pyzamexplosivepoo.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 25, 2010, 12:58:02 am
eeeeeeeeeeew
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on May 25, 2010, 10:29:54 am
[youtubeHD]pU_Y0QKimGM[/youtubeHD]
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 25, 2010, 12:13:00 pm
 :(

very very very funny Sport for Ush ::) :D
https://www.youtube.com/watch?v=3JPYpCBNYSI
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on May 25, 2010, 03:43:06 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 25, 2010, 04:11:03 pm
my favourite sport :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 25, 2010, 08:45:58 pm
https://www.youtube.com/watch?v=OJ2mftZpfGE
Title: Re: Funny Videos/Pictures
Post by: MadMax on May 25, 2010, 09:23:24 pm
this ones are good
(http://obczaj.net/obrazki/114154.jpg)
(http://obczaj.net/obrazki/114153.jpg)
(http://obczaj.net/obrazki/114159.jpg)
(http://obczaj.net/obrazki/114176.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 25, 2010, 09:32:40 pm
this ones are good
(http://obczaj.net/obrazki/114154.jpg)

hahahah :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 25, 2010, 09:53:25 pm
lool :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 25, 2010, 11:56:16 pm
NIN ftw Phobos :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 26, 2010, 04:09:51 pm
Indeed  :)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 26, 2010, 04:13:37 pm
hah i love doing that to people who are counting things
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 26, 2010, 04:24:34 pm
haha
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on May 26, 2010, 08:25:03 pm
Evil minds...

All the stuff are great people :D
Title: Re: Funny Videos/Pictures
Post by: some_punk on May 27, 2010, 06:51:13 am
Peruan police
https://www.youtube.com/watch?v=oqHaEOzjkCY

Ush's tribute
https://www.youtube.com/watch?v=oZ8mPPwhax4

Please use break! FFS
https://www.youtube.com/watch?v=1hUfNWJoE9g
Title: Re: Funny Videos/Pictures
Post by: [AK47]skunk on May 27, 2010, 08:29:04 am
https://www.youtube.com/watch?v=vh5GcesvcxM
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 27, 2010, 10:36:51 am
that makes me feel sick lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 27, 2010, 11:37:19 am
he's fatter than a 10-year-old boy.
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 27, 2010, 12:53:45 pm
good read
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on May 27, 2010, 01:02:21 pm
good read
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 27, 2010, 01:03:35 pm
good read
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 27, 2010, 01:05:40 pm
good read
Title: Re: Funny Videos/Pictures
Post by: MadMax on May 27, 2010, 10:30:34 pm
this is amazing

video that you can turn around 360*
http://edition.cnn.com/interactive/2010/01/world/haiti.360/index.html
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 27, 2010, 11:08:11 pm
that is just too cool :O
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 27, 2010, 11:10:29 pm
that is just too cool :O

(http://imgur.com/T72zu.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on May 27, 2010, 11:18:50 pm
it is though :L i didn't even say anything about it not being funny :o
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 27, 2010, 11:26:38 pm
i know it was cool lol
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on May 27, 2010, 11:40:24 pm
360 degree view videos  :o :o :o :o
http://www.immersivemedia.com/demos/index.php

Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on May 28, 2010, 09:34:31 am
Just because it's so cool!

(http://3.bp.blogspot.com/_KgIqQvYUs3I/SrfNuRu0t0I/AAAAAAAASsI/FpjF0Ffc_B0/s400/fridge_01_400x400.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 28, 2010, 12:16:26 pm
360 degree view videos  :o :o :o :o
http://www.immersivemedia.com/demos/index.php



Bleh, FireFox says it's a dangerous site...
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on May 28, 2010, 08:52:22 pm
(http://img.moronail.net/img/4/0/5240.jpg)
Title: Re: Funny Videos/Pictures
Post by: [AK47]skunk on May 28, 2010, 08:56:45 pm
Just because it's so cool!

(http://3.bp.blogspot.com/_KgIqQvYUs3I/SrfNuRu0t0I/AAAAAAAASsI/FpjF0Ffc_B0/s400/fridge_01_400x400.jpg)
WHERE IS FOOD ???
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on May 28, 2010, 09:05:25 pm
360 degree view videos  :o :o :o :o
http://www.immersivemedia.com/demos/index.php



Bleh, FireFox says it's a dangerous site...

lol its not, perfectly safe  ;)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on May 28, 2010, 10:38:29 pm
Deer felt it hard... :(

https://www.youtube.com/watch?v=uQPn0vgnzik
Title: Re: Funny Videos/Pictures
Post by: b00tsyou on May 28, 2010, 10:53:12 pm
poor animal :(
lol
Title: Re: Funny Videos/Pictures
Post by: TheLastAirbender on May 29, 2010, 09:29:17 am
[youtubeHD]pU_Y0QKimGM[/youtubeHD]

he used god 1


https://www.youtube.com/watch?v=vWK5MITJ1p4
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on May 29, 2010, 07:40:40 pm
Snoopy's avatar is hardcore.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on May 29, 2010, 07:52:17 pm
:o
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on May 29, 2010, 07:53:10 pm
The avatar before was nice softcore :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on May 29, 2010, 09:21:05 pm
https://www.youtube.com/watch?v=r56jqb-fWVM
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on May 29, 2010, 09:32:45 pm
https://www.youtube.com/watch?v=fLXGKBFX5Jg
https://www.youtube.com/watch?v=4MWXLlHGK14
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 02, 2010, 07:39:56 pm
cool video falky :D

Quote
https://www.youtube.com/watch?v=r56jqb-fWVM

(http://imgur.com/myPrv.jpg)

(http://imgur.com/keATz.jpg)

Title: Re: Funny Videos/Pictures
Post by: some_punk on June 02, 2010, 07:46:29 pm
cool video falky :D

Quote
https://www.youtube.com/watch?v=r56jqb-fWVM

OMGROFLMAOWTF!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!

hahahahahahaahahahahahahaah
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on June 02, 2010, 10:05:41 pm
Not a picture or a video...possibly not even true but watevaz...

Quote
This scene took place on a British Airways flight
between
Johannesburg, South Africa & London.

A white woman, about 50 years
old, was seated next to a black man.

Very disturbed by this, she called
the air hostess. "You
obviously do not see it then?" she asked. "You placed
me next to a
black man. I did not agree to sit next to someone from such a
repugnant
group. Give me an alternative seat." "Be calm please," the hostess
replied.
"Almost all the places on this flight are taken. I will go to see if
another place is available."

The hostess went away & then came back a
few minutes later.
"Madam, just as I thought, there are no other available
seats in Economy Class.

I spoke to the captain & he informed me that
there is also no seat in Business Class.
All the same, we still have one
place in First Class."

Before the woman could say anything, the hostess
continued. "It is unusual for our company
to permit someone from Economy
Class to sit in First Class. However, given the circumstances, the
captain
feels that it would be scandalous to make someone sit next to someone so
disgusting."

She turned to the black guy & said, "Therefore, Sir, if
you would like to,
please collect your hand luggage, a seat awaits you in
First Class."

At that moment, the other passengers, who'd been shocked by
what they had just witnessed,
stood up & applauded.
Title: Re: Funny Videos/Pictures
Post by: b00tsyou on June 02, 2010, 10:33:43 pm
https://www.youtube.com/watch?v=aZpD0btOZx8https://www.youtube.com/watch?v=yf56jYDv2fc
https://www.youtube.com/watch?v=62snxI79d74https://www.youtube.com/watch?v=3cf50q4xpts
https://www.youtube.com/watch?v=kcKurvm_0oEhttps://www.youtube.com/watch?v=GI2a7_XfKaI
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on June 02, 2010, 11:42:21 pm
https://www.youtube.com/watch?v=JpBGRA6HHtY

ahahahhahah :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on June 03, 2010, 09:01:10 am
cool video falky :D

Quote
https://www.youtube.com/watch?v=r56jqb-fWVM


Can you stop being racist just for once?
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 03, 2010, 10:10:40 am
Can you learn to take a joke just for once?
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on June 03, 2010, 10:15:00 am
I did several times with your island jokes. But it ain't cool so small favor, shush with it.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 03, 2010, 10:28:17 am
lol k, moody person.
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 03, 2010, 01:22:24 pm
Justin Bieber pwns herself!

https://www.youtube.com/watch?v=3kJjeRpPtY0
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 03, 2010, 01:28:40 pm
he took it like a man... i mean kid :o
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on June 03, 2010, 01:29:15 pm
@ Justin Bieber : :L what a fail

(http://www.plaatjesupload.nl/bekijk/2010/06/03/1275563131-530.jpg) (http://www.plaatjesupload.nl/bekijken/2707620.html)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 03, 2010, 01:48:38 pm
he took it like a man... i mean kid :o
hahahah :L
Title: Re: Funny Videos/Pictures
Post by: ivanduk on June 03, 2010, 04:56:28 pm
He would have been the reason for a third world war if hitler was still alive:

https://www.youtube.com/watch?v=DkKqihEUmH4
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 03, 2010, 05:07:15 pm
wtf how did this little douchebag get so famous... it's like 6 years old

https://www.youtube.com/watch?v=XuYAtlQMycI
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on June 03, 2010, 05:09:41 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 03, 2010, 05:10:25 pm
(http://memegenerator.net/Justin-Bieber/ImageMacro/715220/Justin-Bieber-IM-A-HUGE-FUCKING-FAGOT-PLEASE-RAPE-MY-FACE.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 03, 2010, 05:13:35 pm
(http://imgur.com/xbVZ9.jpg)

(http://imgur.com/C9aV7.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 03, 2010, 05:16:50 pm
wtf how did this little douchebag get so famous... it's like 6 years old

with his female voice :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 03, 2010, 05:32:03 pm
''Wow, that girl has a really beautiful voice!'' "Mum, it's Justin Bieber.''
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on June 03, 2010, 05:36:08 pm
https://www.youtube.com/watch?v=GaQB_tgS7f0
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on June 03, 2010, 06:34:23 pm
wtf
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 03, 2010, 07:16:42 pm
*removed*
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 03, 2010, 07:30:22 pm
I wish they all died slow and painful dead, I wish they suffered more than the poor animals, fucking chinese assholes!!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 03, 2010, 07:48:04 pm
i dont want to see that.... i dont think anybody else does neither
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 03, 2010, 08:02:41 pm
Good.
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 03, 2010, 08:14:42 pm
Whaaaat ?
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 03, 2010, 08:24:47 pm
a video of animals being killed
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 03, 2010, 08:25:13 pm
dolphins ?
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 03, 2010, 08:26:21 pm
dunno, I didn't get very far it was quite sick
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 03, 2010, 08:38:12 pm
Mainly dogs...
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 03, 2010, 08:39:17 pm
I've seen a video with dolphins being caught from the sea and then fishermen were cutting dolphins' heads and so on...  :-X
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 03, 2010, 08:41:39 pm
=/
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on June 03, 2010, 09:52:07 pm
who is into crush videos?
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on June 03, 2010, 10:22:51 pm
didn't see the vid but does max think animals being killed is funny? :O
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Hellmuth on June 03, 2010, 10:47:20 pm
ovals and dead animals
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 03, 2010, 11:32:05 pm
didn't see the vid but does max think animals being killed is funny? :O

hmm it was pretty bad, hence why i removed it :(

max has a sick personality lol
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 03, 2010, 11:37:36 pm
didn't see the vid but does max think animals being killed is funny? :O

no, no, no, killing animals isn't funny, even keeping them in homes/zoos neighter
 you should read what i typed:
it isn't funny but i had no idea where to post it
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on June 03, 2010, 11:50:43 pm
ah ok. i didn't see that cos the whole message got deleted.
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 03, 2010, 11:52:56 pm
ok, ok, btw is there any topic with NOT FUNNY disturbed and disgusting things?
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 03, 2010, 11:54:13 pm
lol no...
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on June 04, 2010, 12:00:19 am
meh...
(http://www.thatsphucked.com/image.axd?picture=fish_hook_in_eye.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 04, 2010, 12:06:31 am
hilarious lmao
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 04, 2010, 12:08:11 am
lol no...
found only this, but it is about disturbing crashes, cheenese dogs have nothing to do with it

http://forum.adrenalinex.co.uk/index.php/topic,855.0.html
Title: Re: Funny Videos/Pictures
Post by: ivanduk on June 04, 2010, 04:56:07 pm
:L :L :L

https://www.youtube.com/watch?v=23cjXModWpA
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on June 04, 2010, 08:47:35 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on June 05, 2010, 04:56:45 am
(http://forum.adrenalinex.co.uk/Smileys/default/tRDvJjVtKsqb6zdWUBdiJt7emmc.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on June 05, 2010, 02:11:49 pm
(http://forum.adrenalinex.co.uk/Smileys/default/tRDvJjVtKsqb6zdWUBdiJt7emmc.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 05, 2010, 06:24:58 pm
(http://imgur.com/FXMBQ.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 05, 2010, 09:53:02 pm
:L

https://www.youtube.com/watch?v=_Qe904nt1DQ
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 05, 2010, 10:02:56 pm
lol entertaining :P
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 06, 2010, 07:44:37 am
Awesome :L
Title: Re: Funny Videos/Pictures
Post by: b00tsyou on June 06, 2010, 10:06:02 am
https://www.youtube.com/watch?v=jwMHD4mteMs
 :D :D :D
Title: Re: Funny Videos/Pictures
Post by: Gen on June 06, 2010, 10:30:25 am
https://www.youtube.com/watch?v=0o9u2W_iGNY


oops wrong topic. oh well
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 06, 2010, 06:38:12 pm
lol, this is supposed to be a robotic dog

https://www.youtube.com/watch?v=nUQsRPJ1dYw
Title: Re: Funny Videos/Pictures
Post by: ivanduk on June 06, 2010, 06:50:50 pm
https://www.youtube.com/watch?v=K4-vIccfBtw
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on June 06, 2010, 10:02:00 pm
Take it as a picture XD

http://thelongestlistofthelongeststuffatthelongestdomainnameatlonglast.com/
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 06, 2010, 10:25:51 pm
this town owns
http://dailycaller.com/wp-content/uploads/Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.jpg


http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on June 07, 2010, 11:28:32 am
Quote
And finally, sadly even the 67 character allowance for a .com domain name is still insufficient for the town of Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu
in New Zealand with a staggering 92 characters however even this seems positively tiny compared to the town of

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit

in Thailand which is a whopping 163 characters long so long that it doesn't even fit on one line! However whilst the New Zealand place name is recognised by the Guiness Book of Record, the Thailand name is not.

Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on June 07, 2010, 11:56:38 am
https://www.youtube.com/watch?v=qbqi0j7y_H8
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on June 07, 2010, 01:17:02 pm
https://www.youtube.com/watch?v=qbqi0j7y_H8

WTF :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 07, 2010, 01:56:02 pm
(http://obczaj.net/obrazki/115241.jpg)
Title: Re: Funny Videos/Pictures
Post by: ivanduk on June 07, 2010, 01:56:47 pm
:L
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on June 07, 2010, 03:10:16 pm
:L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L :L
(http://hig-pan.cocolog-nifty.com/photos/iroiro/animated20wtf.gif)
(http://izismile.com/img/img2/20091009/wtf_gifs_50.gif)
(http://izismile.com/img/img2/20091009/wtf_gifs_49.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 07, 2010, 04:24:40 pm
This is not all, more pictures tomorrow  :D

(http://imgur.com/4QDVy.jpg)

(http://imgur.com/8b8l7.jpg)

(http://imgur.com/s8r57.jpg)

(http://imgur.com/Q4zCs.jpg)

(http://imgur.com/jmwhR.jpg)

(http://imgur.com/2ztEx.jpg)

(http://imgur.com/m3Zbu.jpg)

(http://imgur.com/YFBJZ.jpg)

(http://imgur.com/dbyu0.jpg)

(http://imgur.com/1bVXR.jpg)

(http://imgur.com/NUCjT.jpg)

(http://imgur.com/VI5vw.jpg)

(http://imgur.com/RHarJ.jpg)

(http://imgur.com/Q5TV5.jpg)

(http://imgur.com/6SUfB.jpg)

(http://imgur.com/9QL1I.jpg)

(http://imgur.com/Yfvjk.jpg)

(http://imgur.com/ccvmV.jpg)

(http://imgur.com/allfn.jpg)

(http://imgur.com/69GQS.jpg)

(http://imgur.com/VQZs0.jpg)

(http://imgur.com/iwlTR.jpg)

(http://imgur.com/uu7JF.jpg)

(http://imgur.com/tkRw8.jpg)

Epic :L :L :L
(http://imgur.com/chqwU.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on June 07, 2010, 04:44:56 pm
:L nice pics
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Hellmuth on June 07, 2010, 06:34:15 pm
(http://i50.tinypic.com/2h38ryr.jpg)

(http://i47.tinypic.com/5ma8mh.jpg)

(http://i47.tinypic.com/sazl92.jpg)

(http://i47.tinypic.com/27y24rb.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on June 07, 2010, 06:39:11 pm
(http://www.3dhole.com/gtapics/shaderpics/wireframe.JPG)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 07, 2010, 06:50:08 pm
lol mods
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on June 07, 2010, 07:29:10 pm
(http://img43.imageshack.us/img43/1167/annoyingorange.jpg)
Title: Re: Funny Videos/Pictures
Post by: Astat on June 07, 2010, 07:42:47 pm
https://www.youtube.com/watch?v=NdoHHK27RMM
https://www.youtube.com/watch?v=mDGFgrOruDc

 :D :D

Title: Re: Funny Videos/Pictures
Post by: some_punk on June 07, 2010, 07:55:30 pm
https://www.youtube.com/watch?v=qmPmIJyi0sc
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 07, 2010, 08:43:29 pm
(http://img43.imageshack.us/img43/1167/annoyingorange.jpg)

(http://imgur.com/xofFm.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 07, 2010, 09:44:44 pm
Snooooooooopy

(http://www.freewebs.com/infiniteentertainment/ugly%20dog.bmp)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Hellmuth on June 07, 2010, 10:13:48 pm
that looks abit creepy imo
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 07, 2010, 10:20:12 pm
that's what i look like first thing in the morning :)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on June 08, 2010, 06:33:26 am
https://www.youtube.com/watch?v=4QrTT0Ab5eI

o_O
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on June 08, 2010, 08:01:13 am
dude this shit can make an emo look healthy
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 08, 2010, 08:10:19 am
Give me a gun to shoot that bitch. Gee.
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 08, 2010, 10:39:46 am
ha, vid removed
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on June 08, 2010, 11:27:20 am
ha, vid removed

She deleted her channel, lol

(http://api.ning.com/files/6Br6wwFL5ngdj53XzKMcjft3HCOTyjwg5FE8OLmms1*zf3eCDy*xRNN2vNokPLeNgFRPuBRg8CgI-iKD4xb6omQiVvFSSZ0o/qn1abc.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on June 08, 2010, 02:16:12 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 08, 2010, 07:41:23 pm
Another pictures tomorrow...
:L
(http://imgur.com/RI5wo.jpg)

(http://imgur.com/k74C5.jpg)

(http://imgur.com/0sOVb.jpg)

(http://imgur.com/1Acs4.jpg)

(http://imgur.com/s6Bwr.jpg)

(http://imgur.com/bRGZN.jpg)

(http://imgur.com/lgluH.jpg)

(http://imgur.com/hdEWb.jpg)

(http://imgur.com/Cos81.jpg)

(http://imgur.com/uHXHd.jpg)

(http://imgur.com/uc5oZ.jpg)

(http://imgur.com/MoAVb.jpg)

(http://imgur.com/qygb5.jpg)

(http://imgur.com/I1mZu.jpg)

(http://imgur.com/EZ2zh.jpg)

(http://imgur.com/BnS94.jpg)

(http://imgur.com/8z9FO.jpg)

(http://imgur.com/zmBvf.jpg)

(http://imgur.com/yCz7G.jpg)

(http://imgur.com/3Mu63.jpg)

(http://imgur.com/jn8A9.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 08, 2010, 07:46:59 pm
(http://imgur.com/zmBvf.jpg)

Hahhaah :L :L :L
Cool!
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on June 09, 2010, 12:43:57 pm
(http://imgur.com/zmBvf.jpg)


:L
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on June 09, 2010, 01:04:45 pm
https://www.youtube.com/watch?v=3eZBevXohCI

https://www.youtube.com/watch?v=5blbv4WFriM
Title: Re: Funny Videos/Pictures
Post by: [MAF]Rac3r on June 09, 2010, 01:14:54 pm
Both good ones lol
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 09, 2010, 03:02:51 pm
Heh second video owns :L


https://www.youtube.com/watch?v=zORxjHm94wQ
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 09, 2010, 07:42:57 pm
JOHN FUCK YOU!
(http://poetry.rotten.com/john-fu/john-fu-1.jpg)
(http://poetry.rotten.com/john-fu/john-fu-2.jpg)
http://poetry.rotten.com/john-fu/
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on June 09, 2010, 08:10:25 pm
https://www.youtube.com/watch?v=se_YJEQ_HOQ
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on June 10, 2010, 01:55:12 pm
JOHN FUCK YOU!
(http://poetry.rotten.com/john-fu/john-fu-1.jpg)
(http://poetry.rotten.com/john-fu/john-fu-2.jpg)
http://poetry.rotten.com/john-fu/

:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 10, 2010, 06:22:12 pm
(http://imgur.com/brGNF.jpg)

(http://imgur.com/oBPgm.jpg)

(http://imgur.com/8J0Rl.jpg)

(http://imgur.com/PE8j8.jpg)

(http://imgur.com/Xc35N.jpg)

(http://imgur.com/MJznD.jpg)

(http://imgur.com/7ltTG.jpg)

(http://imgur.com/rIdUR.jpg)

(http://imgur.com/Adu8g.jpg)

(http://imgur.com/dki5o.jpg)

(http://imgur.com/V11pw.jpg)

(http://imgur.com/qAs6b.jpg)

(http://imgur.com/wjUxu.jpg)

(http://imgur.com/01P9a.jpg)

(http://imgur.com/vt6CV.jpg)

(http://imgur.com/PmU3J.jpg)

(http://imgur.com/gQ1yg.jpg)

(http://imgur.com/zOccf.jpg)

(http://imgur.com/OCLGl.jpg)

(http://imgur.com/cViBQ.jpg)

(http://imgur.com/xlcIL.jpg)

(http://imgur.com/6o4CQ.jpg)

(http://imgur.com/ZIW4a.jpg)

(http://imgur.com/2NitF.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]Hellmuth on June 10, 2010, 06:36:58 pm

╔╗╔═ ╦╗
║╚╣║ ║╚╗
╚═╩═ ╩═╝  more pls
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on June 10, 2010, 06:50:26 pm
:L so nicee
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 10, 2010, 07:53:20 pm

╔╗╔═ ╦╗
║╚╣║ ║╚╗
╚═╩═ ╩═╝  more pls

I'll try  :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 10, 2010, 07:55:47 pm
RESPAWNED LOL :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 10, 2010, 09:37:25 pm
https://www.youtube.com/watch?v=aJyznrgJeeo
Title: Re: Funny Videos/Pictures
Post by: ZeeK on June 10, 2010, 10:22:42 pm
jeeeeeeeeeeeeeeeeeeeeeeeeeez!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on June 11, 2010, 05:54:06 pm
(http://img808.imageshack.us/img808/2423/cars.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 11, 2010, 06:27:29 pm
Cool  ;D
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 12, 2010, 05:49:12 pm
(http://obczaj.net/obrazki/116078.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 13, 2010, 12:37:57 am
hahah nice one max!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on June 13, 2010, 11:13:32 am
Looks like Jay Leno's garage.
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 13, 2010, 12:28:02 pm
old but great
(http://obczaj.net/obrazki/116487.jpg)
(http://obczaj.net/obrazki/116190.jpg)
(http://obczaj.net/obrazki/116371.jpg)
(http://obczaj.net/obrazki/116372.jpg)
(http://obczaj.net/obrazki/116375.jpg)
(http://obczaj.net/obrazki/116397.jpg)
(http://obczaj.net/obrazki/116405.jpg)
(http://obczaj.net/obrazki/116406.jpg)
(http://obczaj.net/obrazki/116419.jpg)
(http://obczaj.net/obrazki/116245.jpg)
(http://obczaj.net/obrazki/116306.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 13, 2010, 04:52:36 pm
I love these :L

https://www.youtube.com/watch?v=LCYPGnJdO1U

https://www.youtube.com/watch?v=u6JKP_W_HGY

https://www.youtube.com/watch?v=bj3rIUxhxhQ
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 13, 2010, 11:49:09 pm
this owns
http://hosting.gmodules.com/ig/gadgets/file/112581010116074801021/hamster.swf?up_earColor=D4C898&up_foodColor=cba920&up_tailColor=E6DEBE&up_bodyColor=E6DEBE&up_eyeColor=000000&up_wheelSpokeColor=DEDEDE&up_waterColor=E0EFFF&up_wheelColor=FFFFFF&up_bgColor=FFFFFF&up_feetColor=D4C898&up_wheelCenterColor=E4EB2F&up_wheelOuterColor=FF4D4D&up_snoutColor=F7F4E9&

click anywhere on white to feed him lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 14, 2010, 02:06:14 pm
Haha max, that's cool :L


(http://img824.imageshack.us/img824/954/28396399758933859921551.jpg)

(http://img695.imageshack.us/img695/4414/28396399784868859921551.jpg)

(http://img689.imageshack.us/img689/2041/28396399796088859921551.jpg)

(http://img231.imageshack.us/img231/5901/28396399803913859921551.jpg)

(http://img256.imageshack.us/img256/6082/28396399807203859921551.jpg)

(http://img251.imageshack.us/img251/7968/28396399946758859921551.jpg)

(http://img51.imageshack.us/img51/4606/28396399961723859921551.jpg)

(http://img641.imageshack.us/img641/1456/28396399963808859921551.jpg)

(http://img823.imageshack.us/img823/2052/28396399969338859921551.jpg)

(http://img80.imageshack.us/img80/5677/28396399978518859921551.jpg)

(http://img34.imageshack.us/img34/2149/28396399980113859921551.jpg)

(http://img444.imageshack.us/img444/1791/28396399993423859921551.jpg)

(http://img217.imageshack.us/img217/5541/28396399998738859921551.jpg)

(http://img180.imageshack.us/img180/9738/28396399999353859921551.jpg)

(http://img810.imageshack.us/img810/3412/28396399999693859921551.jpg)

(http://img38.imageshack.us/img38/5324/28396400015813859921551.jpg)

(http://img718.imageshack.us/img718/2433/28396400024433859921551.jpg)

(http://img153.imageshack.us/img153/5158/28496400260433859921551.jpg)

(http://img121.imageshack.us/img121/2730/28496400264888859921551.jpg)

(http://img514.imageshack.us/img514/8310/28496400284558859921551.jpg)

(http://img683.imageshack.us/img683/7442/28496400285908859921551.jpg)

(http://img808.imageshack.us/img808/2489/28496400389638859921551.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 14, 2010, 02:11:45 pm
nomnomnomnom tastyyy pizza
(http://obczaj.net/obrazki/116717.jpg)
Haha max, that's cool :L


(http://img34.imageshack.us/img34/2149/28396399980113859921551.jpg)

haha cheap GPS... FAIL!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on June 14, 2010, 02:13:54 pm
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc3/hs613.snc3/32268_133845789960025_100000038157631_368877_4756837_n.jpg)
(http://img819.imageshack.us/img819/2919/1276446810962.jpg)
(http://imgur.com/c1wXK.jpg)
(http://img517.imageshack.us/img517/4366/om3ms.png)
(http://img251.imageshack.us/img251/852/db1ux.jpg)
(http://img413.imageshack.us/img413/8008/ye85o.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 14, 2010, 02:15:04 pm
:L :L :L
Title: Re: Funny Videos/Pictures
Post by: Fant0mas on June 14, 2010, 04:23:34 pm
(http://pics.blameitonthevoices.com/062010/small_vuvuzela%20instruction%20manual.jpg)
Title: Re: Funny Videos/Pictures
Post by: some_punk on June 14, 2010, 05:03:23 pm
Haha max, that's cool :L


(http://img121.imageshack.us/img121/2730/28496400264888859921551.jpg)


LOL
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on June 14, 2010, 05:16:04 pm
Haha max, that's cool :L


(http://img121.imageshack.us/img121/2730/28496400264888859921551.jpg)


LOL

BOOMER!!!!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 14, 2010, 05:21:13 pm
nomnomnomnom tastyyy pizza
(http://obczaj.net/obrazki/116717.jpg)
doesn't look like a pizza to me lol
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 14, 2010, 07:22:00 pm
some racing funny/jokes
(http://www.musclecars.faketrix.com/content/joke-pics/page3/original-files/racing-takes-two-balls.jpg)

NASCAR
(http://blogs.rockymountainnews.com/denver/drew/archives/drew0323toon.gif)
(http://holycrapthatsfunny.com/wp-content/uploads/2008/07/funny-graphs-nascar-race.gif)
(http://image.internetautoguide.com/f/auto-news/history-of-nascar-safety-advancements-by-cracked/29163255/nascar-safety-diagram-bad-crashes-funny-redneck.jpg)
(http://img.photobucket.com/albums/v174/Polypinoon/EUvsUS1.jpg)
(http://img143.imageshack.us/img143/268/bored5iu.jpg)
(http://www.skylinepictures.com/NASCAR_Darlington_Art_Print_na90b_large.jpg)
(http://www.skylinepictures.com/NASCAR_Daytona_Art_Print_na91b_large.jpg)
(http://www.skylinepictures.com/NASCAR_Talladega_Art_Print_na92b_large.jpg)
(http://www.skylinepictures.com/NASCAR_Indianapolis_Art_Print_na92b_large.jpg)


F1
(http://pic.phyrefile.com/a/an/anonymous/2008/09/08/2007.bmp)
(http://pic.phyrefile.com/a/an/anonymous/2008/09/08/keepwalking.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on June 14, 2010, 07:30:40 pm
:L nice pics
Title: Re: Funny Videos/Pictures
Post by: ivanduk on June 14, 2010, 08:22:30 pm
(http://www.masalatime.com/world/wp-content/uploads/2010/06/08-2047658680.jpg)
(http://www.masalatime.com/world/wp-content/uploads/2010/06/08-2005892288.jpg)
(http://www.masalatime.com/world/wp-content/uploads/2010/06/08-1333735333.jpg)
(http://www.masalatime.com/img/8960.jpg)
(http://www.masalatime.com/img/8961.jpg)
(http://www.masalatime.com/img/8962.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on June 14, 2010, 08:50:48 pm
fail Robert Green pics
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on June 15, 2010, 12:22:26 pm
(http://i47.tinypic.com/s3istg.jpg)
(http://filesmelt.com/dl/vuvuzela.png)
(http://i46.tinypic.com/eb6iv7.jpg)
(http://img51.imageshack.us/img51/3556/lolforhalloween.jpg)
(http://img411.imageshack.us/img411/4489/tumblrl1ydg57g211qzv0cv.png)
(http://img217.imageshack.us/img217/8971/outq.png)
(http://img715.imageshack.us/img715/9637/yeahlikethat.png)
Title: Re: Funny Videos/Pictures
Post by: ... on June 15, 2010, 02:51:24 pm
(http://208.116.9.205/10/content/19555/1.jpg) (http://rdr.diff.abrutis.com/eb60e54065b98091aaef686ff4c2ce91full.jpg)
(http://i105.photobucket.com/albums/m206/mdv_03/funny%20icons/Funny.jpg) (http://rdr.diff.abrutis.com/73f89df87fff0914834b61df4d24b16bfull.jpg)
(http://rdr.diff.abrutis.com/c4975e00e198cb2d54649710eb3539b3full.jpg)
(http://rdr.diff.abrutis.com/3fd0f122f639d4a9bdc2532286e3787efull.jpg) (http://www.humourr.com/divers/images-humour/ballon_figure_lens.jpg)
(http://rdr.diff.abrutis.com/b10d85cf2709142951c87230a2a4cdbffull.jpg) (http://2.bp.blogspot.com/__TAirjGWfLU/SzpAebuk8OI/AAAAAAAACvY/Cq_dpj0zSbM/s400/funny_women.jpg)
(http://www.roflgirls.com/images/girls/funny-pictures-women-driver.jpg) (http://i297.photobucket.com/albums/mm220/AnnaMollyMadison/Bush/funny-george-bush-picture.jpg)
(http://static.funnyjunk.com/pictures/untitled1747.png)
(http://static.pyzam.com/img/funnypics/misc/In_Her_Pooper-1.jpg) (http://static.pyzam.com/img/funnypics/stupid/thoughts2.gif)
Title: Re: Funny Videos/Pictures
Post by: ivanduk on June 15, 2010, 03:43:53 pm
Dont you just love these?
(http://i216.photobucket.com/albums/cc29/Marikku_Goth/FUUUUU.jpg)
(http://i45.photobucket.com/albums/f92/killjojo/1230617613939.jpg)
(http://i187.photobucket.com/albums/x85/Snowgirl7/BTkky0Aujogb2zx9YADT7bSdo1_500.jpg)
(http://i48.tinypic.com/35bb8za.jpg)
(http://i4.photobucket.com/albums/y143/burny2/1221831478401.jpg)
(http://i42.tinypic.com/rji3vm.jpg)
Title: Re: Funny Videos/Pictures
Post by: falco355 on June 15, 2010, 08:12:40 pm
very famous
https://www.youtube.com/watch?v=vvR66bZBCIk
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on June 16, 2010, 03:36:13 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 16, 2010, 04:00:49 pm
(http://imgur.com/Qy0lZ.jpg)

(http://imgur.com/n0MIQ.jpg)

(http://imgur.com/5LAjW.jpg)

(http://imgur.com/1dgIl.jpg)

(http://imgur.com/cJyCQ.jpg)

(http://imgur.com/8pf7J.jpg)

(http://imgur.com/Qv9zA.jpg)

(http://imgur.com/bUkKJ.jpg)

(http://imgur.com/PQBbO.jpg)

(http://imgur.com/5BISY.jpg)

(http://imgur.com/rN1Ky.jpg)

(http://imgur.com/DZc3n.jpg)

(http://imgur.com/wIFiR.jpg)

(http://imgur.com/CU0bb.jpg)

(http://imgur.com/hcSht.jpg)

(http://imgur.com/oH5ME.jpg)

(http://imgur.com/u9CvZ.jpg)

(http://imgur.com/phHMK.jpg)

(http://imgur.com/R3r2u.jpg)

(http://imgur.com/ndK6v.jpg)

Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on June 16, 2010, 04:52:44 pm
:L really nice man
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 16, 2010, 05:08:22 pm
 ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on June 16, 2010, 05:17:50 pm
(http://imgur.com/1dgIl.jpg)

hawt
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on June 16, 2010, 09:17:15 pm
seee this video please iss more more funny ahahahahh

http://www.facebook.com/video/video.php?v=1132313194222
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 17, 2010, 06:11:29 pm
lol, this is great
and also true :L

https://www.youtube.com/watch?v=LcbDXNaBwvg
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 18, 2010, 12:49:40 am
it is coming....



























...and it is really close....























WATCH OUT!


























...THERE IS....













(http://obczaj.net/obrazki/117700.jpg)


LOL  ;D :L
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on June 18, 2010, 01:09:57 am
lol?
(http://driph.com/words/wp-content/uploads/2008/04/e.gif)

(http://lolphoto.net/wp-content/uploads/2010/03/bugfuckfb.jpg)
(http://lolphoto.net/wp-content/uploads/2010/03/gamefail.jpg)
(http://lolphoto.net/wp-content/uploads/2010/03/Fired.jpg)
(http://lolphoto.net/wp-content/uploads/2010/03/heavy.jpg)
(http://pictures.pichaus.com/e415099f63fd227368a6c2b6791e9f919c436a0e?AWSAccessKeyId=0K4RZZKHSB5N2XYJWF02&Expires=1276840000&Signature=1hGN5lBogiG%2FUUVKtjn2aQb88%2Bc%3D)
(http://)

found original old devil avatar
(http://pictures.pichaus.com/df34cc02f24db8c13c7e8bb4c76f81b973ab4bc0?AWSAccessKeyId=0K4RZZKHSB5N2XYJWF02&Expires=1276840000&Signature=cLzOrX6uLzOw5vtzJLgzeQ%2Fez5o%3D)
(http://pictures.pichaus.com/1429cf11b75691e64a8c4a814a4e42b95a5fa4d7?AWSAccessKeyId=0K4RZZKHSB5N2XYJWF02&Expires=1276840000&Signature=f7X5EJsy0M4wzbYkamVaKEg85EM%3D)
(http://pictures.pichaus.com/137de9e7957996a81d064178aec4863c86c593b4?AWSAccessKeyId=0K4RZZKHSB5N2XYJWF02&Expires=1276840000&Signature=NVwHtZ8hasaQc4mmWgLzyLThSds%3D)
(http://28.media.tumblr.com/tumblr_kx5z4tudec1qzw4mno1_500.jpg)
(http://pichaus.com/top-gu0ef7e26d7a434130b/y-snow-cars-@eb20ded4f3537a88bc455b4120c3c66f/)
(http://pichaus.com/bourdin-photographer-guy-fashion-@168941072a6ac5a)
(http://pictures.pichaus.com/b68a91bb89c0250f2194de7ede618cb563b00fe3?AWSAccessKeyId=0K4RZZKHSB5N2XYJWF02&Expires=1276840000&Signature=arm5TBJZHP0enmCtvwvB4rHmlhw%3D)

(http://25.media.tumblr.com/tumblr_l44ec9oQPK1qzrlhgo1_500.jpg)
(http://designyoutrust.com/wp-content/uploads7/3785951239_9611ccc5ac_o.jpg)
(http://imgur.com/lZWsn.jpg)
(http://i.imgur.com/63EKI.jpg)
(http://technabob.com/blog/wp-content/uploads/2010/05/guide_to_pac_man_ghosts.jpg)
(http://designyoutrust.com/wp-content/uploads7/3786014173_248c80b900_o.jpg)
(http://www.humor4life.com/m_pictures/weddings_are_beautiful_500x500.jpg)
(http://www.humor4life.com/m_pictures/ebay0.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on June 18, 2010, 09:41:06 am
[youtubeHD]qKQAGh01ZaY[/youtubeHD]
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 18, 2010, 10:27:13 am
Good album btw, I already got it  :D It leaked
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on June 18, 2010, 04:28:39 pm
@scorps pics :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on June 19, 2010, 01:44:37 am
LOL. I just got the reference:

(http://upload.wikimedia.org/wikipedia/commons/thumb/c/c7/Firth_of_Forth_bridges_panorama_by_Greg_Barbier_13750x1915.jpg/1400px-Firth_of_Forth_bridges_panorama_by_Greg_Barbier_13750x1915.jpg)

...look familiar? Guess where this is.
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on June 19, 2010, 02:44:10 am
San Francisco (San Fierro) :D Or am I wrong about San Francisco? :-X
Title: Re: Funny Videos/Pictures
Post by: some_punk on June 19, 2010, 06:25:26 am
(http://sp7.fotologs.net/photo/23/36/35/simpson_exaaacto/1203549832_f.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on June 19, 2010, 03:36:41 pm
(http://upload.wikimedia.org/wikipedia/commons/thumb/c/c7/Firth_of_Forth_bridges_panorama_by_Greg_Barbier_13750x1915.jpg/1400px-Firth_of_Forth_bridges_panorama_by_Greg_Barbier_13750x1915.jpg)

San Francisco (San Fierro) :D Or am I wrong about San Francisco? :-X

Actually, it's the River Forth in Scotland. A sneaky reference by (Scottish) R*.

(http://img203.imageshack.us/img203/9396/lolpictures20.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on June 20, 2010, 03:16:47 pm
(http://i45.tinypic.com/xfqfxf.jpg)
Title: Re: Funny Videos/Pictures
Post by: some_punk on June 20, 2010, 08:22:21 pm
(http://i45.tinypic.com/xfqfxf.jpg)

really really nice one firebox!!

i laughted about these pics with my workmates... when i worked xD cuz our coworkers do somethings like those... but no so huge stunt like this one
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 20, 2010, 08:23:05 pm
What's the point of quoting a post above yours lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 20, 2010, 08:24:53 pm
(http://www.everythingweird.com/images/afro-hair-cap_49.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 20, 2010, 08:25:27 pm
Hahaha nice hair :L
Title: Re: Funny Videos/Pictures
Post by: some_punk on June 20, 2010, 08:26:05 pm
devil @ those "stunt" are awesome when the ppl does it... u must to see it on person

https://www.youtube.com/watch?v=DYnz_06hcUI
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 20, 2010, 09:37:34 pm
can't wait
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 20, 2010, 09:51:10 pm
This one is awesome :L

https://www.youtube.com/watch?v=HFZtOk42ets
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on June 21, 2010, 12:25:21 am
This is amazing...

https://www.youtube.com/watch?v=H23HDHRVjpA
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 21, 2010, 07:45:26 am
Nais. Now he can play modern warfare in his house  :D
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 23, 2010, 01:00:02 am
agree with this one lol
(http://obczaj.net/obrazki/118999.jpg)

(http://obczaj.net/obrazki/118969.jpg)
(http://obczaj.net/obrazki/118892.jpg)
(http://obczaj.net/obrazki/119016.jpg)
(http://obczaj.net/obrazki/118895.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on June 23, 2010, 01:10:25 am
:L :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 23, 2010, 11:52:53 am
:L :L

https://www.youtube.com/watch?v=xbsSeVr5NSI

https://www.youtube.com/watch?v=tC5FgQU-gns
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on June 23, 2010, 05:08:51 pm
agree with this one lol
(http://obczaj.net/obrazki/118999.jpg)

(http://obczaj.net/obrazki/118969.jpg)
(http://obczaj.net/obrazki/118892.jpg)
(http://obczaj.net/obrazki/119016.jpg)
(http://obczaj.net/obrazki/118895.jpg)


:L
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 23, 2010, 11:04:01 pm
world's smallest plane to carry people

https://www.youtube.com/watch?v=TDmnjwbJrVM


and very intersting, and for sure taking a lot of time work
click this link, and when see text press ctrl+a (select all)


http://fichtre.net/yop.html
Title: Re: Funny Videos/Pictures
Post by: Fant0mas on June 24, 2010, 07:28:18 am
(http://img28.imageshack.us/img28/3873/3d0afb25tumblrl4dzyadef.jpg)
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on June 24, 2010, 01:30:46 pm
Chimp rapes a frog:

https://www.youtube.com/watch?v=qVE60zwXx1k
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 24, 2010, 01:36:11 pm
Simon you pervert!
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on June 24, 2010, 01:53:07 pm
So wrong.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on June 24, 2010, 01:55:08 pm
not watching
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 24, 2010, 04:05:41 pm
lol and they let the kids watch it
Title: Re: Funny Videos/Pictures
Post by: [AK47]skunk on June 24, 2010, 05:23:10 pm
(http://de.ifun.ru/x/v/xvydhua2.gif)

(http://de.ifun.ru/8/o/8on5vdnt.gif)

(http://de.ifun.ru/2/l/2lc0aqfu.gif)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on June 24, 2010, 07:09:46 pm
:P:P
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 24, 2010, 11:20:43 pm
1st place in category SAFTY AT WORK

(http://obczaj.net/obrazki/119308.jpg)

if websites were people...
(http://obczaj.net/obrazki/119218.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on June 25, 2010, 12:05:32 am
4chan ftw
Title: Re: Funny Videos/Pictures
Post by: falco355 on June 25, 2010, 04:43:25 pm
https://www.youtube.com/watch?v=Pvj94XapyEU
https://www.youtube.com/watch?v=nooIM9OdEps
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 25, 2010, 08:45:40 pm
Snoop Dogg in Amsterdam, enjoy!

https://www.youtube.com/watch?v=OjL1Ftkjpug
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on June 25, 2010, 10:57:43 pm
In Amsterdam, their white people are as cool as black people.

Also, I have those Locs glasses, £7 on eBay.  :D
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on June 25, 2010, 11:06:05 pm
In Amsterdam, their white people are as cool as black people.

Also, I have those Locs glasses, £7 on eBay.  :D

ha, that shows even superstars like cheap stuff  ;D
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on June 26, 2010, 06:25:04 am
https://www.youtube.com/watch?v=AzR_YkFhnNc
Title: Re: Funny Videos/Pictures
Post by: Żurrieq on June 26, 2010, 07:13:56 am
https://www.youtube.com/watch?v=AzR_YkFhnNc

is he mad?????????  nice one Jar :)

see this :D
http://www.youtube.com/watch?v=FQlgA68z_L4
Title: Re: Funny Videos/Pictures
Post by: Larry on June 27, 2010, 06:36:24 pm
vuvusela  :D

http://www.youtube.com/watch?v=E2FYLCohgfM&feature=related
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on June 27, 2010, 07:46:58 pm
vuvusela  :D

http://www.youtube.com/watch?v=E2FYLCohgfM&feature=related

:L :L :L :L :L :L :L :L :L :L :L

niceeeeee
Title: Re: Funny Videos/Pictures
Post by: Sn1k3rs on June 27, 2010, 07:49:58 pm
vuvusela  :D

http://www.youtube.com/watch?v=E2FYLCohgfM&feature=related

:L :L :L :L :L :L :L :L :L :L :L hahaha

niceeeeee
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on June 28, 2010, 12:58:17 am
https://www.youtube.com/watch?v=BlaP7mx_kB8
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on June 28, 2010, 02:14:53 am
thats quite disturbing
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 28, 2010, 11:00:34 pm
FAIL
(http://obczaj.net/obrazki/119817.jpg)

FAIL
(http://obczaj.net/obrazki/119827.jpg)
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on June 28, 2010, 11:04:04 pm
pwned
(http://images.paraorkut.com/img/funnypics/images/m/motorcycle_fail-12827.png)
wtf  ???
(http://www.samizdata.net/blog/~pdeh/epicFAIL.jpg)
Title: Re: Funny Videos/Pictures
Post by: pod on June 28, 2010, 11:43:01 pm
(http://i.imgur.com/rLP1S.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 28, 2010, 11:46:59 pm
nice one, hehe toyota camry nascar, here before crashing

(http://paddocktalk.com/news/html/modules/ew_filemanager/08content/nascar/toyota/richmond/nascar-hamlin-pole-2.jpg)
Title: Re: Funny Videos/Pictures
Post by: Fant0mas on June 29, 2010, 01:07:43 am
(http://www.pckz.cl/blog/wp-content/uploads/2010/06/picinazoforce4501.gif)
(http://img175.imageshack.us/img175/1728/1277666137502.gif)
(http://www.pckz.cl/blog/wp-content/uploads/2010/06/torres.gif)
(http://img443.imageshack.us/img443/1870/121834800.jpg)
(http://9gag.com/photo/27606_540.jpg)
(http://www.pckz.cl/blog/wp-content/uploads/2010/06/21joh3q.jpg.gif)
(http://i84.photobucket.com/albums/k9/thelilpimp2/gol2.jpg)
(http://www.plaatjesupload.nl/bekijk/2010/06/18/1276850560-090.gif)
(http://www.mundoimg.com/imagenes/deportes/236747_mundoimg_rorok_2qks11e.gif)
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on June 29, 2010, 02:05:08 am
https://www.youtube.com/watch?v=AzR_YkFhnNc
is italian journalist of Milan Calcio
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 29, 2010, 09:33:00 am
lol nice pictures fantomas :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on June 29, 2010, 09:36:39 am
lol nice pictures fantomas :D

haha those are great :L
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on June 29, 2010, 09:57:19 am
https://www.youtube.com/watch?v=B7NTYeRg5Dg
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on June 29, 2010, 07:44:35 pm
great pics hahaha
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on June 29, 2010, 07:52:01 pm
I think this is better.

(http://img824.imageshack.us/img824/5165/wwwhotcelebsandmodelsbl.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on June 29, 2010, 08:06:12 pm
heh, one of them got black socks lol. but no goalie outfit..
Title: Re: Funny Videos/Pictures
Post by: MadMax on June 29, 2010, 09:10:49 pm
what was too scary for "Rambo"?...
(http://obczaj.net/obrazki/119866.jpg)
Title: Re: Funny Videos/Pictures
Post by: ... on June 29, 2010, 11:55:14 pm
I think this is better.

(http://img824.imageshack.us/img824/5165/wwwhotcelebsandmodelsbl.jpg)

If they show this team on tv, i'm sure the channel will have 50% of the country watching. No matter what the level of the team is.

Is that an ad for puma? they're all wearingpuma shoes, different colours.
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on June 30, 2010, 07:03:53 am
what was too scary for "Rambo"?...
(http://obczaj.net/obrazki/119866.jpg)

:L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 01, 2010, 07:20:53 pm
Online Gamer Ep. 4

http://www.recklesstortuga.com/online-gamer/online-gamer-ep-4/
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 01, 2010, 08:25:12 pm
this is funny lol

24 ways to die
https://www.youtube.com/watch?v=rTJLp2AUz_o
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on July 01, 2010, 09:08:59 pm
lol max, this is funnier :P

https://www.youtube.com/watch?v=p32OC97aNqc
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 01, 2010, 09:46:47 pm
(http://obczaj.net/obrazki/119989.jpg)

coca cola in LOTR
(http://obczaj.net/obrazki/119920.jpg)
Title: Re: Funny Videos/Pictures
Post by: Fant0mas on July 02, 2010, 12:34:36 am
Vuvuzela vs Dog
https://www.youtube.com/watch?v=Gqv4Vviod0c
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on July 02, 2010, 01:27:43 pm
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs015.ash2/34128_114126828633770_111797082200078_84921_6591365_n.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 02, 2010, 04:17:55 pm
https://www.youtube.com/watch?v=koM4wyfCA_c
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 02, 2010, 04:40:51 pm
:L
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on July 02, 2010, 07:46:28 pm
Courtesy of Gen:

www.meatspin.com
Title: Re: Funny Videos/Pictures
Post by: MELK1Y on July 02, 2010, 07:57:00 pm
http://www.youtube.com/watch?v=Z_S3phLKU30
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on July 02, 2010, 08:16:35 pm
fuck sake, simon,

http://www.2guys1horse.com/ (18+ highly disgusting)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on July 03, 2010, 12:10:50 pm
(http://standardmadness.com/wp-content/uploads/2010/06/gravity-wins-01.jpg)
















(http://standardmadness.com/wp-content/uploads/2010/06/gravity-wins-021.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 03, 2010, 12:24:33 pm
the girl on the left is damn ugly lol
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 03, 2010, 03:08:49 pm
(http://obczaj.net/obrazki/120016.jpg)
(http://obczaj.net/obrazki/120018.jpg)
(http://obczaj.net/obrazki/120024.jpg)

Harrier (GTA Hydra LOL)
(http://obczaj.net/obrazki/120035.jpg)
Title: Re: Funny Videos/Pictures
Post by: Peeps-101 on July 03, 2010, 03:20:30 pm
LOL @ the vuvuzela
Title: Re: Funny Videos/Pictures
Post by: [MAF]PyroFox on July 03, 2010, 03:28:29 pm
(http://imgur.com/yZV0f.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on July 03, 2010, 03:29:37 pm
lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 03, 2010, 03:42:52 pm
(http://imgur.com/yZV0f.jpg)

ftw lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 04, 2010, 07:03:43 pm
Nice commercials lol
https://www.youtube.com/watch?v=61AGuq1AnKI
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on July 04, 2010, 11:24:27 pm
The 1st one was lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 05, 2010, 12:00:41 am
(http://images-0.redbubble.com/img/art/size:ularge/view:main/983330-3-a-fish-out-of-water.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 05, 2010, 12:02:41 am
Quote
(http://imgur.com/kUTnl.png)

lmao


Title: Re: Funny Videos/Pictures
Post by: Scorpion. on July 05, 2010, 01:11:42 am
New Vuvuzela By Me  :D
(http://img204.imageshack.us/img204/1894/y1p1aaopxnh0fyiogjfcpjt.jpg)

(http://www.asjolly.it/emoticons/ahah.gif)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on July 05, 2010, 08:04:58 am
":L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 05, 2010, 01:29:47 pm
(http://v7.lt/images/1277458114.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 05, 2010, 01:38:40 pm
moobs
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on July 05, 2010, 02:07:13 pm
:L england
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 05, 2010, 02:08:51 pm
hahaha im embarrassed now lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]PyroFox on July 05, 2010, 02:37:45 pm
(http://blogs.warwick.ac.uk/images/luoxu/2004/11/22/img415ff861ae77e.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 05, 2010, 02:43:09 pm
lol @ the american, no offence pod :P
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 05, 2010, 03:45:24 pm
this one is amazing
https://www.youtube.com/watch?v=ODUqJCVL0K4
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 05, 2010, 03:50:24 pm
it's at saint martin, the airfield is right after the beach and every plane has to land that way.. you can stand beneath it and get blown away. it's a dutch/french island in the carribean.
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on July 05, 2010, 04:09:58 pm
korea and argentina hawt
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 05, 2010, 04:58:03 pm
(http://demotywatory.pl/uploads/201007/1278335234_by_Tezeterka_500.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on July 05, 2010, 07:16:43 pm
nice":)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 05, 2010, 07:47:05 pm
Quote
(http://imgur.com/kUTnl.png)

lmao




:L :L :L
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on July 05, 2010, 08:46:56 pm
Quote
(http://imgur.com/kUTnl.png)

lmao






:L :L :L

ROFL ive realised what it is :L :L :L :L :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 05, 2010, 11:37:49 pm
tell me, i can't figure it out myself :(
Title: Re: Funny Videos/Pictures
Post by: some_punk on July 06, 2010, 04:36:39 pm
F.U.
(http://kontraband.se/blog/wp-content/uploads/2009/07/hypno.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 06, 2010, 04:41:02 pm
headache :(
Title: Re: Funny Videos/Pictures
Post by: some_punk on July 06, 2010, 04:42:52 pm
headache :(

(http://1.bp.blogspot.com/_4B6BR9aWHAk/SL7gXrHm9AI/AAAAAAAAA1c/Hd9sLtfY7Ng/s400/weird-faces-069.jpg)
Title: Re: Funny Videos/Pictures
Post by: Peeps-101 on July 07, 2010, 11:43:09 am
https://www.youtube.com/watch?v=Oe0NPIMAsMQ
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on July 08, 2010, 11:49:17 am
https://www.youtube.com/watch?v=ez7i17g9Cm0

https://www.youtube.com/watch?v=jF0wtJtqpIw

ahahahaha ;D
Title: Re: Funny Videos/Pictures
Post by: falco355 on July 08, 2010, 08:14:35 pm
https://www.youtube.com/watch?v=lPtV-k15eqg
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on July 08, 2010, 11:27:50 pm
Greatest of the photoshop yet!


(http://pix.motivatedphotos.com/2008/11/6/633615982105301408-Photoshop.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 09, 2010, 01:57:58 am
(http://obczaj.net/obrazki/120262.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]FeTaK_SvK on July 09, 2010, 05:13:45 pm
nice animation, just watch it

http://vimeo.com/13094046
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 09, 2010, 05:20:58 pm
That's really nice  :)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 09, 2010, 09:34:13 pm
https://www.youtube.com/watch?v=T-dQ4mXV0JY
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on July 09, 2010, 10:57:23 pm
(http://obczaj.net/obrazki/120262.jpg)
???? ??? ??? ???
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on July 09, 2010, 11:15:19 pm

???? ??? ??? ???
It's because she looks like a dirty crack-whore...which we call a 'train wreck.' Because like the disaster, it's such a tragic waste of human life.  :)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]FeTaK_SvK on July 10, 2010, 11:08:28 am
in America, they are goin to record Darth Vaders voice for GPS. and there is ad
https://www.youtube.com/watch?v=2ljFfL-mL70
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on July 10, 2010, 11:39:48 am
in America, they are goin to record Darth Vaders voice for GPS. and there is ad
https://www.youtube.com/watch?v=2ljFfL-mL70

:L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 10, 2010, 02:06:59 pm
Is there any way you can make it sound little less depressing ?

Exit right ahead!?

Don't force it

:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on July 11, 2010, 12:21:30 am
And we thought we were cool in our Sandkings...

https://www.youtube.com/watch?v=3EotjNThcAs
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 11, 2010, 08:50:34 am
I wish Forza was not only on Xbox  :-\  This is way better than our football matches :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on July 11, 2010, 01:46:00 pm
I wish Forza was not only on Xbox  :-\  This is way better than our football matches :L

GT5 will come...eventually...maybe our children will live to play it.
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on July 11, 2010, 04:09:02 pm
And we thought we were cool in our Sandkings...

https://www.youtube.com/watch?v=3EotjNThcAs

Haha nice.
Title: Re: Funny Videos/Pictures
Post by: ZeeK on July 11, 2010, 04:39:28 pm
gosh, I didn't know about 2guyz1horse
I watched only 2 secs, it was enough for me ._.
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on July 11, 2010, 05:02:19 pm
gosh, I didn't know about 2guyz1horse
I watched only 2 secs, it was enough for me ._.

:L :L :L :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on July 11, 2010, 06:36:39 pm
u missed the hardcore part, that guy gotta be a mess on the inside
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on July 11, 2010, 08:25:42 pm
Best shot ever @1min

Better physics :( But our match is still cool to watch beside this :)
Title: Re: Funny Videos/Pictures
Post by: falco355 on July 12, 2010, 06:55:21 pm
https://www.youtube.com/watch?v=RRjpzH--Y28
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on July 13, 2010, 10:53:14 am
(http://i.imgur.com/5v39L.jpg)

(http://i.imgur.com/5OenM.png)

(http://i.imgur.com/7HMRE.jpg)

(http://i.imgur.com/2qLyo.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 13, 2010, 10:02:33 pm
(http://i.imgur.com/7HMRE.jpg)

wtf :L
and lol @ the toilet paper  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on July 13, 2010, 10:52:10 pm
http://en.wiktionary.org/wiki/I'm_afraid_not
Title: Re: Funny Videos/Pictures
Post by: some_punk on July 14, 2010, 12:09:33 am
https://www.youtube.com/watch?v=QoZrqTbW_zg
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on July 14, 2010, 12:28:07 am
i already seen it but i still want 1  ;D ;D ;D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 14, 2010, 02:12:33 pm
(http://www.zipfm.lt/upl/polls/question833_2.jpg)
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on July 14, 2010, 02:34:23 pm
lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 14, 2010, 07:01:54 pm
(http://imgur.com/GKdW3.jpg)
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on July 14, 2010, 07:10:52 pm
i want a blow up doll lol....  :-X
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 14, 2010, 07:22:56 pm
why? doesn't your gf satisfy you enough?
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on July 14, 2010, 07:25:04 pm
lol, you can them carry them anywhere  :D
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 14, 2010, 07:25:34 pm
pontoon to swim (spin)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on July 14, 2010, 07:57:20 pm
https://www.youtube.com/watch?v=DMhmXBuUkzs
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on July 15, 2010, 12:20:38 pm
(http://www.moronail.net/images/stories/dg_pictures/1007/0DE485B917C0-1.jpg)
Title: Re: Funny Videos/Pictures
Post by: ivanduk on July 15, 2010, 02:26:08 pm
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc3/hs172.snc3/19980_271237228799_553583799_3469070_5399437_n.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on July 15, 2010, 02:56:50 pm
(http://lameness.info/wordpress/wp-content/uploads/2009/01/makeitcount.jpg)
Title: Re: Funny Videos/Pictures
Post by: ivanduk on July 15, 2010, 03:16:37 pm
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc3/hs168.snc3/19574_1184606223038_1464723743_30397606_3215005_n.jpg)
Title: Awkward Family Photos
Post by: some_punk on July 15, 2010, 07:41:09 pm
AWKWARD FAMILY PHOTOS!!!

(http://izismile.com/img/img3/20100706/640/awkward_family_photos_640_01.jpg)
(http://izismile.com/img/img3/20100706/640/awkward_family_photos_640_03.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_14.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_01.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_05.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_06.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_07.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_28.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_34.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_35.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_36.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_41.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_50.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_53.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_54.jpg)
(http://izismile.com/img/img3/20100319/640/awkward_family_photos_640_48.jpg)
(http://izismile.com/img/img2/20090820/family_2_15.jpg)
(http://izismile.com/img/img2/20090820/family_2_11.jpg)
(http://izismile.com/img/img2/20090820/family_2_06.jpg)
(http://izismile.com/img/img2/20090820/family_2_05.jpg)
(http://izismile.com/img/img2/20090820/family_2_24.jpg)
(http://izismile.com/img/img2/20090820/family_2_25.jpg)
(http://izismile.com/img/img2/20090820/family_2_28.jpg)
(http://izismile.com/img/img2/20090820/family_2_29.jpg)
(http://izismile.com/img/img2/20090820/family_2_32.jpg)
(http://izismile.com/img/img2/20090820/family_2_35.jpg)
(http://izismile.com/img/img2/20090820/family_2_36.jpg)
(http://izismile.com/img/img2/20090820/family_2_37.jpg)
(http://izismile.com/img/img2/20090820/family_2_38.jpg)
(http://izismile.com/img/img2/20090820/family_2_44.jpg)
(http://izismile.com/img/img2/20090820/family_2_48.jpg)
(http://izismile.com/img/img2/20090512/family_37.jpg)
(http://izismile.com/img/img2/20090512/family_36.jpg)
(http://izismile.com/img/img2/20090512/family_35.jpg)
(http://izismile.com/img/img2/20090512/family_33.jpg)
(http://izismile.com/img/img2/20090512/family_30.jpg)
(http://izismile.com/img/img2/20090512/family_27.jpg)
(http://izismile.com/img/img2/20090512/family_26.jpg)
(http://izismile.com/img/img2/20090512/family_20.jpg)
(http://izismile.com/img/img2/20090512/family_19.jpg)
(http://izismile.com/img/img2/20090512/family_17.jpg)
(http://izismile.com/img/img2/20090512/family_16.jpg)
(http://izismile.com/img/img2/20090512/family_15.jpg)
(http://izismile.com/img/img2/20090512/family_13.jpg)
(http://izismile.com/img/img2/20090512/family_07.jpg)
(http://izismile.com/img/img2/20090512/family_06.jpg)
(http://izismile.com/img/img2/20090512/family_05.jpg)
(http://izismile.com/img/img2/20090512/family_04.jpg)
(http://izismile.com/img/img2/20090512/family_03.jpg)



Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on July 16, 2010, 08:43:24 am
FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW!
FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW!
FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW!
FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW! FTW!
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on July 16, 2010, 08:49:02 am
lulz pics
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on July 16, 2010, 10:05:34 am
lol
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on July 16, 2010, 05:57:05 pm
(http://i.imgur.com/CQBQU.png)
Title: Re: Funny Videos/Pictures
Post by: Karlip on July 16, 2010, 09:10:20 pm
https://www.youtube.com/watch?v=ZPBvFXf9Q2U
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 18, 2010, 10:51:44 am
Haha, great pictures Bunny :L
Title: Re: Funny Videos/Pictures
Post by: some_punk on July 18, 2010, 10:46:48 pm
Why we love japan!
https://www.youtube.com/watch?v=0rm5j1WYi94

https://www.youtube.com/watch?v=igC4bPDp6cU

https://www.youtube.com/watch?v=LhXaFUlTwm0

https://www.youtube.com/watch?v=8iR0b2sNJbo

https://www.youtube.com/watch?v=c7paSzXEe2Q

no apts for embittereds

Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 19, 2010, 04:03:59 pm
lol, they're the craziest people in the world :L
Title: Re: Funny Videos/Pictures
Post by: some_punk on July 19, 2010, 07:11:25 pm
The Chuck Norris from India

https://www.youtube.com/watch?v=_K9AxO5t4BE
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 20, 2010, 01:42:10 am
lol, sick movie

btw some pictures
(http://obczaj.net/obrazki/120718.jpg)
(http://obczaj.net/obrazki/120723.jpg)
(http://obczaj.net/obrazki/120733.jpg)
(http://obczaj.net/obrazki/120747.jpg)
(http://obczaj.net/obrazki/120755.jpg)
(http://obczaj.net/obrazki/120660.jpg)
(http://obczaj.net/obrazki/120664.jpg)

japan is really fucked
(http://obczaj.net/obrazki/120738.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on July 20, 2010, 09:26:02 am
 :D nice pics Max
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on July 20, 2010, 11:32:46 am
nice lol
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on July 20, 2010, 06:30:20 pm
The Chuck Norris from India
lol  that horse slide under the truck FTW!!!
Title: Re: Funny Videos/Pictures
Post by: Karlip on July 20, 2010, 07:25:25 pm
https://www.youtube.com/watch?v=VmgdcBBGieg
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 20, 2010, 07:44:24 pm
1 more fun
(http://obczaj.net/obrazki/120866.jpg)
(http://obczaj.net/obrazki/120876.jpg)
(http://obczaj.net/obrazki/120897.jpg)
(http://obczaj.net/obrazki/120919.jpg)
(http://obczaj.net/obrazki/120939.jpg)
(http://obczaj.net/obrazki/120818.jpg)
(http://obczaj.net/obrazki/120819.jpg)
(http://obczaj.net/obrazki/120824.jpg)
(http://obczaj.net/obrazki/120847.jpg)

Porshee is for loosers, thats true lol
(http://obczaj.net/obrazki/120839.jpg)

in NASA lose money
(http://obczaj.net/obrazki/120908.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on July 21, 2010, 09:54:20 am
:L they are good ;) where found you them????
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 21, 2010, 10:29:49 am
found this picture in my mobile, taken in winter :D
(http://imgur.com/5UfQl.jpg)

(http://imgur.com/p9vRa.jpg)

(http://imgur.com/rDbIX.jpg)

(http://imgur.com/K0cHo.jpg)

(http://imgur.com/0kRxs.jpg)

(http://imgur.com/HbW4L.jpg)

(http://imgur.com/NB4LG.jpg)

(http://imgur.com/lLlo9.jpg)

(http://imgur.com/D19bb.jpg)

(http://imgur.com/dAPcv.jpg)

(http://imgur.com/S7zFh.jpg)

(http://imgur.com/3F8sf.jpg)

(http://imgur.com/cYZpx.jpg)

(http://imgur.com/QrSzL.jpg)

(http://imgur.com/PurOo.jpg)

(http://imgur.com/FRklH.jpg)

(http://imgur.com/I7FpL.jpg)

(http://imgur.com/QsURV.jpg)

(http://imgur.com/gxxps.jpg)

(http://imgur.com/lrrXP.gif)

(http://imgur.com/3AtKr.jpg)

(http://imgur.com/l5Iej.jpg)

(http://imgur.com/jERwS.jpg)

(http://imgur.com/8ntu1.jpg)

(http://imgur.com/j3hul.jpg)

(http://imgur.com/DauUP.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on July 21, 2010, 11:23:06 am
haha xD
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on July 21, 2010, 12:51:44 pm
:L :L
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on July 21, 2010, 02:26:07 pm
awesum :L
Title: Re: Funny Videos/Pictures
Post by: sam on July 21, 2010, 02:59:51 pm
http://www.dumpert.nl/mediabase/1047891/37406783/winkelwagen_bommetje.html
http://www.dumpert.nl/mediabase/841951/fe47b5c2/cameraman_moet_even_uitblazen.html
http://www.dumpert.nl/mediabase/778341/af4a667a/chinese_oma_leert_engels.html
Title: Re: Funny Videos/Pictures
Post by: Karlip on July 21, 2010, 06:55:15 pm
http://kewl.bz/425
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 21, 2010, 09:13:00 pm
http://kewl.bz/425

LMAO!! :L :L :L
Title: Re: Funny Videos/Pictures
Post by: Flopster on July 21, 2010, 09:47:15 pm
http://kewl.bz/?id=323
Title: Re: Funny Videos/Pictures
Post by: ... on July 22, 2010, 05:39:54 pm
https://www.youtube.com/watch?v=5OjJevHNIU0
Title: Re: Funny Videos/Pictures
Post by: Karlip on July 22, 2010, 06:17:07 pm
Militant Black Guy :D

Seen those videos like 500 times. :o
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 22, 2010, 06:30:22 pm
fail
(http://imgur.com/esGw3.jpg)

(http://imgur.com/6Jt2G.jpg)

(http://imgur.com/9MoR3.jpg)

(http://imgur.com/iPpJW.jpg)

(http://imgur.com/mJcN6.jpg)

(http://imgur.com/cJTSE.jpg)

(http://imgur.com/5751k.jpg)

(http://imgur.com/9e11n.jpg)

(http://imgur.com/pzEas.jpg)

(http://imgur.com/TGHnn.jpg)

(http://imgur.com/Y0IVN.jpg)

(http://imgur.com/pxmRc.jpg)

(http://imgur.com/gZ8hG.jpg)

(http://imgur.com/c4rq0.jpg)

(http://imgur.com/SI2pI.jpg)

(http://imgur.com/u1hGL.jpg)

(http://imgur.com/npsfx.jpg)

(http://imgur.com/hog26.jpg)

(http://imgur.com/6nk8Z.jpg)

(http://imgur.com/MTTap.jpg)

(http://imgur.com/fSmcn.jpg)

(http://imgur.com/OxDzD.jpg)

(http://imgur.com/dFQ4H.jpg)

(http://imgur.com/wySsP.jpg)

haha :L
https://www.youtube.com/watch?v=VqBy6TgYxTU
Title: Re: Funny Videos/Pictures
Post by: [2F2F]FeTaK_SvK on July 23, 2010, 07:30:59 pm
me(on the left), and my friends ;D for u iron :P :D
(http://i30.tinypic.com/2q8y39y.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on July 24, 2010, 02:06:41 pm
(http://imgur.com/Igqiz.gif)
(http://imgur.com/mRRkJ.gif)
(http://i.imgur.com/h79KF.gif)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on July 24, 2010, 04:44:26 pm
(http://imgur.com/Igqiz.gif)

hahahaha
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 25, 2010, 03:46:20 pm
(http://imgur.com/QXUJ2.jpg)

(http://imgur.com/P1zfX.jpg)

(http://imgur.com/9V6Oy.jpg)

(http://imgur.com/fDqjh.jpg)

(http://imgur.com/VFe80.jpg)

(http://imgur.com/UNFEZ.jpg)

(http://imgur.com/gCgXZ.jpg)

(http://imgur.com/Gkh7Q.jpg)

(http://imgur.com/X3QFL.jpg)

(http://imgur.com/whO74.jpg)

(http://imgur.com/6zGkQ.jpg)

(http://imgur.com/fgNgY.jpg)

(http://imgur.com/x9jSX.jpg)

(http://imgur.com/fzKrq.jpg)

(http://imgur.com/6jwk3.jpg)

(http://imgur.com/vamWm.jpg)

(http://imgur.com/9JVsc.jpg)

(http://imgur.com/FX7Oo.jpg)

(http://imgur.com/b8ybX.jpg)

(http://imgur.com/ojlRe.jpg)

(http://imgur.com/J9XlV.jpg)

(http://imgur.com/WR8Lv.jpg)

(http://imgur.com/uv02b.jpg)

(http://imgur.com/ziJpP.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on July 26, 2010, 12:29:42 am
nice :L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 26, 2010, 02:13:49 pm
Typical black guy reactions.

https://www.youtube.com/watch?v=4vZ-jF_1suE
Title: Re: Funny Videos/Pictures
Post by: ZeeK on July 26, 2010, 02:17:20 pm
lol his laughs are funny
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on July 26, 2010, 02:18:00 pm
:L that face
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on July 26, 2010, 06:41:13 pm
https://www.youtube.com/watch?v=JP5mSDfCPsU
haha lol
Title: Re: Funny Videos/Pictures
Post by: ZeeK on July 26, 2010, 06:55:35 pm
lol he got killed twice
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 27, 2010, 11:16:21 am
(http://imgur.com/vXsLn.jpg)

(http://imgur.com/O9Q4L.jpg)

(http://imgur.com/0YsZJ.jpg)

(http://imgur.com/JIAWA.jpg)

(http://imgur.com/1xzVc.jpg)

(http://imgur.com/mVLbM.jpg)

(http://imgur.com/qK3mv.jpg)

(http://imgur.com/Irx6N.jpg)

(http://imgur.com/NIzqM.jpg)

(http://imgur.com/28yk1.jpg)

(http://imgur.com/6vAob.jpg)

(http://imgur.com/fX5RS.jpg)

(http://imgur.com/i3E4a.jpg)

(http://imgur.com/X0IcW.jpg)

(http://imgur.com/m64B1.jpg)

(http://imgur.com/6tOAS.jpg)

(http://imgur.com/kO1G3.jpg)

if you don't understand, it means that he wrote "I will not throw paper airplanes in class." 500 times  :D
(http://imgur.com/9GyrX.jpg)

(http://imgur.com/cnYic.jpg)

(http://imgur.com/q08uw.jpg)

(http://imgur.com/rzKgR.jpg)

(http://imgur.com/TC0j8.jpg)

(http://imgur.com/AQwOL.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]FeTaK_SvK on July 27, 2010, 07:22:32 pm
(http://i31.tinypic.com/r0uxki.jpg)
Title: Re: Funny Videos/Pictures
Post by: [AK47]M4lysz on July 27, 2010, 07:47:41 pm
lol haha
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 27, 2010, 08:09:19 pm
lol Sabre from Hell?
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on July 27, 2010, 08:31:47 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on July 29, 2010, 11:44:18 am
(http://farm4.static.flickr.com/3159/2741943002_d677f2f706_o.gif)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on July 29, 2010, 11:45:20 am
:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on July 29, 2010, 03:35:05 pm
(http://i.imgur.com/t0UZj.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on July 29, 2010, 03:36:22 pm
haha that got me
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on July 29, 2010, 04:24:12 pm
Haha
Title: Re: Funny Videos/Pictures
Post by: MadMax on July 30, 2010, 12:16:18 am
(http://obczaj.net/obrazki/121616.jpg)
(http://obczaj.net/obrazki/121622.jpg)
(http://obczaj.net/obrazki/121624.jpg)
(http://obczaj.net/obrazki/121533.jpg)
(http://obczaj.net/obrazki/121567.jpg)
(http://obczaj.net/obrazki/121568.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on July 30, 2010, 10:14:34 am
haha :L
Title: Re: Funny Videos/Pictures
Post by: Karlip on July 30, 2010, 01:38:32 pm
http://kewl.bz/334
Title: Re: Funny Videos/Pictures
Post by: ... on July 30, 2010, 09:19:27 pm
https://www.youtube.com/watch?v=kvFokICvrfQ
Title: Re: Funny Videos/Pictures
Post by: Fant0mas on August 01, 2010, 12:42:31 am
(http://i48.tinypic.com/2nbcdgz.jpg)

(http://i47.tinypic.com/ng3pyw.jpg)

(http://i43.tinypic.com/25qfc4y.gif)

(http://img42.imageshack.us/img42/1434/advicecolumnv.jpg)

(http://api.ning.com/files/3Uoavia5AHrznA43OFJPxIjTQCCNeZAKYkIXTTlFwCTnJt3PJsZxSBu7kJVODTok*mOxIHzBPvz9Dgq5DL0FW7OAytEiAZNw/mcowned.jpg)

(http://api.ning.com/files/QUvlndC6HSe9RPJjplRu2lF7IlNxtlRhd*vIs*5ePj*R*w9hrmMt9YNQ0b7tET-vGH*GwyU37McxoARPg*XsbXyov14eANOj/plomero.jpg)

(http://api.ning.com/files/iBf26E95P54myhXk4IRHgEVdQF0umegTLp5XlFGg9k9Z-BnSkgz8MkTqv93LKxK4KFOz2cbMM7WGT29*xPLSN5ACLBBFqGDG/gps.jpg)

(http://api.ning.com/files/Elcx4MplAu*cF0RUSsf6RfhSPzyXqNie*j7FIFD9zMe5rJpv15QP0r0g7OxRXEfA4lqJWTxYS5pyJYfOylzBFRMHtgxtmQ9q/divorcedcar.jpg)

(http://api.ning.com/files/sGz3jAB9itBU4YI84zVPFyH5FoDXPIufi*NLtc340yEJdTkkb*VsaKGact3qj*rUNKMr7KLVRuQ4D3LeTSUSPEhLMuMOIZ*K/car_half.jpg)

(http://api.ning.com/files/wTtB8u*3tF4hosV9ov2RuVWNjD2YbnSvsmJmZRX7ARRjRUbMlIXvDwASc0CP5iqD8ba32m3u4QFThvW3CUaR4OsjLB7MA24P/onehorsepowercar.jpg)

(http://blogs.elcorreo.com/blogfiles/laotrafaz/bano.JPG)

(http://img641.imageshack.us/img641/9806/1255808056042.jpg)

(http://usuarios.multimania.es/kronoxweb/humor/grafico/DobleSentido1.jpg)

(http://img7.imageshack.us/img7/8136/lmaoeqb.jpg)

(http://img194.imageshack.us/img194/2718/rofle.jpg)

(http://photos-b.ak.fbcdn.net/hphotos-ak-snc3/hs195.snc3/20265_482009815318_715230318_11239929_6400591_n.jpg)

(http://www.eatliver.com/img/2009/3849.jpg)

Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 01, 2010, 01:46:37 pm
Pyro might know about this since he's from Cork :L

https://www.youtube.com/watch?v=nVVet6TNoyA
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on August 01, 2010, 07:30:43 pm
https://www.youtube.com/watch?v=FHIZ2Jl2vuQ

skip to :50 on this one:
https://www.youtube.com/watch?v=364dzVsBs2o
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 01, 2010, 09:13:54 pm
haha, insane videos lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 01, 2010, 11:47:40 pm
https://www.youtube.com/watch?v=FHIZ2Jl2vuQ

:(
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on August 02, 2010, 12:00:40 pm
:L Fantomas nice pics

Title: Re: Funny Videos/Pictures
Post by: Larry on August 02, 2010, 12:08:53 pm
fun vids
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on August 03, 2010, 01:53:00 am
https://www.youtube.com/watch?v=2waIvp265CM
Title: Re: Funny Videos/Pictures
Post by: ǝǝǝoſ[sXɐ] on August 03, 2010, 03:55:36 am
pod isn't a girl ???  ??? :-[ :'(

i think is girl  :(

lmao

then again, I didn't even know pod was human  :-[
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 03, 2010, 08:10:24 pm
Fail :L :L
https://www.youtube.com/watch?v=ikdKvmkt6Rg
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 03, 2010, 08:17:31 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 04, 2010, 05:57:55 am
lol @ 3:25

https://www.youtube.com/watch?v=JqqKtqdrh7g
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 04, 2010, 06:12:57 am
Hah :L
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 04, 2010, 12:34:53 pm
(http://obczaj.net/obrazki/121716.jpg)

(http://obczaj.net/obrazki/121719.jpg)
(http://obczaj.net/obrazki/121720.jpg)
(http://obczaj.net/obrazki/121721.jpg)
(http://obczaj.net/obrazki/121722.jpg)

(http://obczaj.net/obrazki/121655.jpg)
(http://obczaj.net/obrazki/121668.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 05, 2010, 09:21:46 am
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs069.ash2/36828_115486145170058_100001260200279_105121_970070_n.jpg)

(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs106.ash2/38655_142981422393596_100000452173346_311466_4711246_n.jpg)

(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs134.ash2/40046_145657125460614_100000489831628_368781_3305387_n.jpg)

(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs023.snc4/33499_107913539263186_100001336218027_53389_6266370_n.jpg)

(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs138.ash2/40225_143110282383902_100000547944311_321942_3098549_n.jpg)

(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs072.ash2/36962_1246505502189_1815960329_484314_4880185_n.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on August 05, 2010, 11:21:22 am
:L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 05, 2010, 12:56:28 pm
(http://i38.tinypic.com/5dkpyg.jpg)
Title: Re: Funny Videos/Pictures
Post by: Fant0mas on August 05, 2010, 01:40:19 pm
https://www.youtube.com/watch?v=Rp0ksbz0mtE
https://www.youtube.com/watch?v=OsWqXQcqj4E
https://www.youtube.com/watch?v=81szj1vpEu8
https://www.youtube.com/watch?v=wOur8qXvpnk

Here is all the collection of Remi
http://www.youtube.com/user/nqtv (http://www.youtube.com/user/nqtv)
n-joy  ;D
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 05, 2010, 03:32:59 pm
(http://i38.tinypic.com/5dkpyg.jpg)

depends of metal

if this is just trashing like mad monkeys, it is crap
but when have looong artistic parts, even with some orchestral parts, with intresting text, that wanna tell somtehing, it is amazing

try epic progressive metal

my fav one
1 of most amazing songs i have ever heard, probably some of you know it, but it is amazing
https://www.youtube.com/watch?v=MZDB0mAMkA4
Let me tell you a story to chill the bones
About a thing that I saw
One night wondering in the everglades
I'd one drink but no more

I was rambling, enjoying the bright moonlight
Gazing up at the stars
Not aware of a presence so near to me
Watching my every move

Feeling scared and I fell to my knees
As something rushed me from the trees
Took me to an unholy place
And that is where I fell from grace

Then they summoned me over to join in with them
To the dance of the death
Into the circle of fire I followed them
Into the middle I was led

As if time had stopped still I was numb with fear
But still I wanted to go
And the blaze of the fire did no hurt upon me
As I walked onto the coals

And I felt I was in a trance
And my spirit was lifted from me
And if only someone had the chance
To witness what happened to me

And I danced and I pranced and I sang with them
All had death in their eyes
Lifeless figures they were undead all of them
They had ascended from hell

As I danced with the dead
My free spirit was laughing and howling down at me
Below my undead body
Just danced the circle of dead

Until the time came to reunite us both
My spirit came back down to me
I didn't know if I was alive or dead
As the others all joined in with me

By luck then a skirmish started
And took the attention away from me
When they took their gaze from me
Was the moment that I fled

I ran like hell faster than the wind
But behind I did not glance
One thing that I did not dare
Was to look just straight ahead

When you know that your time has come around
You know you'll be prepared for it
Say your last goodbyes to everyone
Drink and say a prayer for it

When you're lying in your sleep, when you're lying in your bed
And you wake from your dreams to go dancing with the dead
When you're lying in your sleep, when you're lying in your bed
And you wake from your dreams to go dancing with the dead

To this day I guess I'll never know
Just why they let me go
But I'll never go dancing no more
'Till I dance with the dead
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 05, 2010, 03:53:09 pm
iron maiden is okay
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 05, 2010, 03:56:46 pm
Hip Hop or Rap ... its all the same CRAP!
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 05, 2010, 03:59:59 pm
I name Tupac and all you say is "ehhh" :)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 06, 2010, 11:20:31 am
:L

http://www.topgear.com/uk/car-news/methane-powered-volkswagen-beetle
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 06, 2010, 11:51:51 am
LOOOL Japan and China
(http://i35.tinypic.com/2ilof82.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 06, 2010, 12:50:23 pm
Chinese rally FTW!  ;D
Title: Re: Funny Videos/Pictures
Post by: Mosca on August 06, 2010, 12:56:51 pm
(http://i38.tinypic.com/5dkpyg.jpg)

Don't ever speak to me.
Title: Re: Funny Videos/Pictures
Post by: [MAF]falky on August 06, 2010, 01:41:49 pm
(http://i38.tinypic.com/5dkpyg.jpg)

Don't ever speak to me.
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 06, 2010, 01:46:34 pm
:L :L
Title: Re: Funny Videos/Pictures
Post by: some_punk on August 06, 2010, 08:30:35 pm
https://www.youtube.com/watch?v=SMoXhepcU18

https://www.youtube.com/watch?v=FQMbXvn2RNI

https://www.youtube.com/watch?v=EMoEAfDJ8Iw

Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 07, 2010, 09:51:17 am
porn censorship lol
https://www.youtube.com/watch?v=qtXFbTTW8es

https://www.youtube.com/watch?v=jxGKaObibxY
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 07, 2010, 05:37:22 pm
some of these pictures aren't funny but they're still cool to share  :D
(http://imgur.com/eS1IX.jpg)

(http://imgur.com/FTI8M.jpg)

(http://imgur.com/qsSxC.jpg)

(http://imgur.com/CQ8Da.jpg)

(http://imgur.com/5kBT0.jpg)

(http://imgur.com/gRdFv.jpg)

(http://imgur.com/afJ6q.jpg)

(http://imgur.com/05zC9.jpg)

(http://imgur.com/tlbQC.jpg)

(http://imgur.com/qvJUo.jpg)

(http://imgur.com/Dlvv9.jpg)

(http://imgur.com/vmS4U.jpg)

(http://imgur.com/u61k4.jpg)

(http://imgur.com/XEDvz.jpg)

(http://imgur.com/NrM46.jpg)

(http://imgur.com/8o2f5.jpg)

(http://imgur.com/RXjQU.jpg)

(http://imgur.com/ri9Qm.jpg)

(http://imgur.com/Viibh.jpg)

(http://imgur.com/h4Buk.jpg)

(http://imgur.com/Kz5Wr.jpg)

(http://imgur.com/hoSBL.jpg)

(http://imgur.com/ORv0O.jpg)

(http://imgur.com/rcamh.jpg)

(http://imgur.com/oW1wd.jpg)

and sorry for double post, i was expecting that auto-modify thing lol
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on August 08, 2010, 09:43:17 am
:l really nice pitures
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 09, 2010, 11:39:35 am
(http://obczaj.net/obrazki/122166.jpg)
Title: Re: Funny Videos/Pictures
Post by: Mosca on August 09, 2010, 12:43:52 pm
(http://imgur.com/Dlvv9.jpg)

I ended up in: Seek help of a professional... should I buy an iPad or what?
Title: Re: Funny Videos/Pictures
Post by: Fant0mas on August 09, 2010, 01:42:40 pm
(http://img704.imageshack.us/img704/434/lolcm.jpg)
https://www.youtube.com/watch?v=uvoEJI8HDYE

https://www.youtube.com/watch?v=6E51BQVOmdo
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on August 09, 2010, 02:10:30 pm
Dutch commercials FTW!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 09, 2010, 02:55:16 pm
Haha, one of the best commercials I've ever seen  :D
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 09, 2010, 10:55:43 pm
this have any sense lol
(http://staticrps.komixxy.pl/uimages/201008/1281361640_by_iwangrozny_500.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on August 10, 2010, 06:43:40 am
:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on August 10, 2010, 08:17:40 am
(http://img704.imageshack.us/img704/434/lolcm.jpg)
ROFL nice pic
Title: Re: Funny Videos/Pictures
Post by: Mosca on August 10, 2010, 09:02:13 am
(http://img36.imageshack.us/img36/3137/sareal.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 10, 2010, 09:08:27 am
Nice one! :L
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on August 10, 2010, 09:15:54 am
lol nice photoshop :L
Title: Re: Funny Videos/Pictures
Post by: Mosca on August 10, 2010, 09:17:58 am
I edited with paint LOL
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on August 10, 2010, 09:21:29 am
http://www.rtl.nl/components/actueel/rtlnieuws/miMedia/2009/week36/Wed15.MOTORAGENT.xml

Really schoked

Look at the yellow car
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on August 10, 2010, 11:27:34 am
https://www.youtube.com/watch?v=b0GjKiy3nSI
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 10, 2010, 12:38:10 pm
http://www.rtl.nl/components/actueel/rtlnieuws/miMedia/2009/week36/Wed15.MOTORAGENT.xml

Really schoked

Look at the yellow car

Wow, ouch. Even I was blushing for the driver  :-[.

Also, I love how everyone picks on Justin Bieber, despite the fact he seems to take all these things pretty well. He just looks and sounds like a girl, but otherwise is a pretty sensible guy.
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 10, 2010, 02:14:15 pm
https://www.youtube.com/watch?v=b0GjKiy3nSI

Hahah when does her voice get manly?
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 10, 2010, 02:18:56 pm
haha about time that douchebag got what was coming to her
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 10, 2010, 03:27:08 pm
(http://imgur.com/DUxG0.jpg)
(http://imgur.com/QDUCM.gif)
(http://imgur.com/u3Fd3.jpg)
(http://imgur.com/tmpMI.jpg)
(http://imgur.com/wXnHt.jpg)
(http://imgur.com/d7OAv.jpg)
(http://imgur.com/y97DL.jpg)
(http://imgur.com/Fsti3.jpg)
(http://imgur.com/HqyPD.jpg)
(http://imgur.com/R0NVc.jpg)
(http://imgur.com/3XnzJ.jpg)
(http://imgur.com/SsPsB.jpg)
(http://imgur.com/j37kR.jpg)
(http://imgur.com/Ipodg.jpg)
(http://imgur.com/FsEaP.jpg)
(http://imgur.com/VFRvX.jpg)
(http://imgur.com/TQJy0.jpg)
(http://imgur.com/XVsPY.jpg)
(http://imgur.com/vEcQG.jpg)
(http://imgur.com/wxRyP.jpg)
(http://imgur.com/3gjk6.jpg)
(http://imgur.com/6WV3R.jpg)
(http://imgur.com/PyQaY.jpg)
(http://imgur.com/l7lUM.jpg)
(http://imgur.com/6o5U5.jpg)
(http://imgur.com/eyVk8.jpg)
(http://imgur.com/iroTm.jpg)
(http://imgur.com/oZmN0.jpg)
(http://imgur.com/NW8pl.jpg)
(http://imgur.com/fGQ57.jpg)
(http://imgur.com/obs4i.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jarol on August 10, 2010, 04:28:27 pm
:L nice pics
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 10, 2010, 07:54:32 pm
LOL, people in New Jersey have 3rd highest IQ in Amrika.

(http://www.imsotight.com/wp-content/uploads/2009/10/guidoalkdjff.jpg)

Forget GTL, it's GTLH: Gym, Tan, Laundry and....HOMEWORK.

Also, I want to buy the K11RWA numberplate but with a W.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 10, 2010, 10:23:32 pm
Hah, Russia ftw :L
http://www.bezbrige.com/index.php/Stupid-and-Weird/only-in-russia.html
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 11, 2010, 01:38:01 am
https://www.youtube.com/watch?v=8yUbzcatvCw

And proof that GTAIV isn't as good as San Andreas:

(http://www.rockpapershotgun.com/images/10/aug/graphs/gta.png)
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 11, 2010, 02:51:51 pm
(http://imgur.com/Dlvv9.jpg)

I ended up in: Seek help of a professional... should I buy an iPad or what?

this might help you a little

(http://obczaj.net/obrazki/122182.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 11, 2010, 04:33:43 pm
https://www.youtube.com/watch?v=jRyX1tC2OS0
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 11, 2010, 04:38:59 pm
Hah, nice :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 12, 2010, 06:18:27 pm
(http://www.moronail.net/images/stories/dg_pictures/1008/7701F2E9C253-1.jpg)
(http://www.moronail.net/images/stories/dg_pictures/1008/C581BE339DB9-1.jpg)
Title: Re: Funny Videos/Pictures
Post by: Mosca on August 12, 2010, 09:56:12 pm
(http://www.fairfaxunderground.com/forum/file.php?2,file=13238,filename=BigDogTongueLOL.jpg)
Title: Re: Funny Videos/Pictures
Post by: Fant0mas on August 13, 2010, 12:45:39 am
Raginnnnnnnnnnnnnnn
https://www.youtube.com/watch?v=tTFOncppkJg
https://www.youtube.com/watch?v=A28FsIINbsU

Others parts are on youtube page
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 13, 2010, 09:16:38 am
Best part 1:18

https://www.youtube.com/watch?v=-7fudSMOva4
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 14, 2010, 01:38:48 am
(http://img580.imageshack.us/img580/4996/spidey.gif)
(http://i.imgur.com/6BTII.jpg)
(http://i.imgur.com/XKgen.jpg)
(http://i.imgur.com/6IL7L.png)
(http://i.imgur.com/scn7h.jpg)
(http://cache.gawkerassets.com/assets/images/7/2010/08/500x_0813_thegap.jpg)
(http://sphotos.ak.fbcdn.net/hphotos-ak-snc1/hs215.snc1/8219_176961668335_503688335_3742652_7334859_n.jpg)
Title: Re: Funny Videos/Pictures
Post by: Karlip on August 14, 2010, 02:06:11 pm
<AdrenalineX> [2F2Ft]DodgeR [0 ]: hai all
<AdrenalineX> [LSR]Cypher [1]: hi
<AdrenalineX> [LSR]Draguna [29]: hi
<AdrenalineX> [SR]Badrila [43]: hi
<AdrenalineX> Juninho [34]: hi
<AdrenalineX> [SR]Andro [46]: hi
<AdrenalineX> [LSR]Cypher [1]: hi
<AdrenalineX> [SR]Zim [26]: hi
<AdrenalineX> Juninho [34]: hi
<AdrenalineX> Karlip_laptop [IRC]: hi
<AdrenalineX> [LSR]Cypher [1]: hi
<AdrenalineX> [SR]Badrila [43]: hi
<AdrenalineX> [SR]Andro [46]: hi
<AdrenalineX> Juninho [34]: hi
<AdrenalineX> [SR]Zim [26]: hi
<AdrenalineX> [2F2Ft]DodgeR [0 ]: hi
<AdrenalineX> [SR]Badrila [43]: hi
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on August 14, 2010, 02:13:26 pm
Quote
Re: Funny Videos/Pictures
Title: Re: Funny Videos/Pictures
Post by: ivanduk on August 14, 2010, 07:02:21 pm
(http://pedobearpics.com/pedobear/pedo_bear41.jpg)
(http://pedobearpics.com/pedobear/pedo_bear6.jpg)
(http://pedobearpics.com/pedobear/Pedo_Bear_fin.jpg)
(http://pedobearpics.com/pedobear/pedo_bear3.jpg)
(http://pedobearpics.com/pedobear/pedo_bear22.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 16, 2010, 02:43:56 pm
(http://i36.tinypic.com/2chp7nt.jpg)
Title: Re: Funny Videos/Pictures
Post by: Karlip on August 16, 2010, 02:47:58 pm
Quote
Re: Funny Videos/Pictures

Didn't know where to post that. :0
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on August 16, 2010, 10:03:41 pm
https://www.youtube.com/watch?v=49rvCIEEWds
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 16, 2010, 10:17:43 pm
(http://www.gifsoup.com/view/868832/pentada-violenta-o.gif)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on August 17, 2010, 02:08:24 am
(http://www.99blazed.com/modules/Forums/images/avatars/11719169174c13de6c1af1e.gif)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 17, 2010, 07:34:45 am
Theres a game news webpage in Lithuania and this is one of the news lol. Title says: Gotcha: GTA V cover leaked :L

(http://gamesnation.lt/images/stories/grand_theft_auto_5_cover_leaked_to_internet_image_1.jpg)
Title: Re: Funny Videos/Pictures
Post by: Flopster on August 17, 2010, 07:41:36 am
(http://mangukoobas.lahendus.ee/media_files/175565l.GIF)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 17, 2010, 07:48:34 am
Woo  ;D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 17, 2010, 08:32:36 am
GTA Poland
PS3
(http://playstationeu.i.lithium.com/t5/image/serverpage/image-id/76477iD7F542E04E28627D/image-size/original?v=mpbl-1&px=-1)
X360
(http://c.wrzuta.pl/wi16685/5377ed85002a9f1b4925b4c9/0/gta%20poland)
Title: Re: Funny Videos/Pictures
Post by: Flopster on August 17, 2010, 08:44:21 am
Found another one, my city.. woo

(http://www.gamefriik.ee/images/users_images/16575.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 17, 2010, 09:21:28 am
What lol
Title: Re: Funny Videos/Pictures
Post by: Flopster on August 17, 2010, 09:27:04 am
Fixed, lol
Title: Re: Funny Videos/Pictures
Post by: [LSR]Ride on August 17, 2010, 10:12:03 am
https://www.youtube.com/watch?v=Coj2wfPouuk
https://www.youtube.com/watch?v=uykStESm3vw
https://www.youtube.com/watch?v=PnUtN13lLnA
https://www.youtube.com/watch?v=m1TnzCiUSI0
https://www.youtube.com/watch?v=GNlPfQi9sXI
https://www.youtube.com/watch?v=WKYD-cDd_Gs
https://www.youtube.com/watch?v=k9p3cBktdqc
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 18, 2010, 12:27:26 am
Try your best not to laugh...

https://www.youtube.com/watch?v=Yc7uFjXxzFE
Title: Re: Funny Videos/Pictures
Post by: [LSR]Ride on August 18, 2010, 08:30:43 am
(http://antiplath.files.wordpress.com/2008/05/grand_theft_auto_somalia.jpg)
 :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Jur1z on August 18, 2010, 10:16:17 am
(http://www.interq.clan.su/_bl/0/80020.jpg)
(http://www.interq.clan.su/_bl/0/09672.gif)

(http://zparks.lv/lat/sakums/e_risinajumi/images/text/GTA_4_gerbonis.jpg)
(http://zparks.lv/lat/sakums/e_risinajumi/images/text/GTA_Gerbonis_GIF.gif)
Title: Re: Funny Videos/Pictures
Post by: Epicnawb on August 18, 2010, 10:18:35 am
https://www.youtube.com/watch?v=V55Zq5whVCI

Lol.
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 18, 2010, 01:31:31 pm
YES! I managed to do it...after watching it about 100 times.
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 18, 2010, 01:34:26 pm
Congratz! You just won a banana.
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on August 18, 2010, 03:14:40 pm
I have not been able to laugh in this whole page....
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 18, 2010, 03:19:11 pm
(http://imgur.com/jk5mR.jpg)
Title: Re: Funny Videos/Pictures
Post by: Epicnawb on August 18, 2010, 04:02:43 pm
(http://img338.imageshack.us/img338/8253/gtastockholmhihi0kc.jpg) (http://img338.imageshack.us/i/gtastockholmhihi0kc.jpg/)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Vertigo on August 18, 2010, 04:13:32 pm
I have not been able to laugh in this whole page....

that's cause you laugh at people getting run over by trains and shit like that rofl
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 18, 2010, 04:17:34 pm
this should be fun knu, lol

EDITED
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on August 18, 2010, 04:19:23 pm
Poorly cow,cant be funny see somebody die like that  :-\
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 18, 2010, 04:22:38 pm
if porn isn't allowed, violent videos like that shouldn't be allowed neither
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on August 18, 2010, 04:49:24 pm
Agree with you
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 18, 2010, 04:52:52 pm
i get highly offended when it comes to animals being harmed in any way, it's something i try to avoid seeing on the internet but yet we get it on here.. not very nice for minors imo
Title: Re: Funny Videos/Pictures
Post by: [LSR]Ride on August 18, 2010, 04:54:54 pm
if porn isn't allowed, violent videos like that shouldn't be allowed neither

Word, word.

EDITED
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on August 18, 2010, 05:15:26 pm
ride, sicko
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on August 18, 2010, 05:17:32 pm
this should be fun knu, lol

sick bastard, not funny at all

if porn isn't allowed, violent videos like that shouldn't be allowed neither

i agree, but if i see someone get seriously hurt and its their own fault and could have been avoided but they chose not to, then fuck them they deserve it

woops, double post  :-[
Title: Re: Funny Videos/Pictures
Post by: [MAF]Aj_Lajk_Bir on August 18, 2010, 05:30:08 pm
lol POLSAT (polish TV)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 18, 2010, 05:31:28 pm
ah fuck off with this shit, idiots
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on August 18, 2010, 07:10:56 pm
lame
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on August 18, 2010, 09:14:23 pm
next person to post something abusive, violent or disturbed gets a server and forum ban for a week? (just a thought, just my opinion)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 18, 2010, 10:02:26 pm
porn isn't allowed

Wait...what?
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 18, 2010, 11:00:53 pm
porn isn't allowed

Wait...what?
(http://obczaj.net/obrazki/122449.jpg)







(http://obczaj.net/obrazki/122485.jpg)
(http://obczaj.net/obrazki/122494.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 18, 2010, 11:08:05 pm
I drawed this picture in Paint after missing checkpoint due to lag. Post it everywhere and force new meme.  ;D

(http://img529.imageshack.us/img529/9597/ragecolour.gif)

(It's not me in the picture btw)

LOOOL, also check out this memegenerator: http://memegenerator.net/nigga-cj?pageIndex=1 So many of these are soooooo true (if you play single-player).  :D
Title: Re: Funny Videos/Pictures
Post by: some_punk on August 19, 2010, 01:24:38 am
https://www.youtube.com/watch?v=ho0WfS8opaI
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 19, 2010, 07:01:38 am
https://www.youtube.com/watch?v=WNr4EfGlGPg

https://www.youtube.com/watch?v=Dz6gFokvOr0
Title: Re: Funny Videos/Pictures
Post by: [LSR]Ride on August 19, 2010, 07:12:50 am
https://www.youtube.com/watch?v=6v5h_7-0oPs
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 19, 2010, 12:17:28 pm
:L :L :L
(http://obczaj.net/obrazki/122485.jpg)
LOOOL, also check out this memegenerator: http://memegenerator.net/nigga-cj?pageIndex=1 So many of these are soooooo true (if you play single-player).  :D
Title: Re: Funny Videos/Pictures
Post by: [LSR]Ride on August 19, 2010, 01:22:13 pm
Ya dun goofed son!
https://www.youtube.com/watch?v=98Np9hNSIWo
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on August 19, 2010, 02:57:35 pm
LMAO that was fuckin perfect
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 19, 2010, 04:33:46 pm
At first I lol'd.  :D

But then I serious'd  :o:

https://www.youtube.com/watch?v=YH4hhC-aVHI

*shiver*
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 19, 2010, 07:13:52 pm
(http://img138.imageshack.us/img138/1593/birmz.jpg)
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 19, 2010, 07:38:57 pm
MadMax PRESENTS . . .
(http://2.bp.blogspot.com/_6_eHhH__mn8/SwG5iZr9LXI/AAAAAAAAOPo/qRPsqlKHzAU/s1600/G-VROS_BHX_2009.11.16-2.jpg)
ANOTHER VIRGIN IN BIRMINGHAM

btw Virgin Atlantic is airline owned by Richard Branson, like every other thing from Virgin Group lol
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on August 19, 2010, 08:52:29 pm
(http://img138.imageshack.us/img138/1593/birmz.jpg)

which is me!  :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 19, 2010, 09:18:08 pm
more like the only gay in the village

(http://imgur.com/gb9if.jpg)

https://www.youtube.com/watch?v=l4zx1ZX8GW4
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 19, 2010, 09:36:44 pm
Breaking news lol. This was supposed to be a friendly match

https://www.youtube.com/watch?v=ste4A1v5W-o
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on August 19, 2010, 11:13:25 pm
Referee was horrible that is why all happened  :-\
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 20, 2010, 02:47:40 pm
https://www.youtube.com/watch?v=rtZeIU9qpMo
 :D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 20, 2010, 05:13:45 pm
Haha, they probably had nothing to do :L ^

----------
Pokemon  :D
(http://imgur.com/R0hcG.jpg)
(http://imgur.com/hTY2f.jpg)
quite crowded lol
(http://imgur.com/pkfmc.jpg)
(http://imgur.com/9T3o6.jpg)
(http://imgur.com/qNDx5.jpg)
(http://imgur.com/z4SJo.jpg)
(http://imgur.com/ExYuI.jpg)
(http://imgur.com/eTNEW.jpg)
(http://imgur.com/Selj4.jpg)
(http://imgur.com/OSkmq.jpg)
(http://imgur.com/YtbTv.jpg)
(http://imgur.com/IVXWD.jpg)
(http://imgur.com/AHqPc.jpg)
(http://imgur.com/hlyGy.jpg)
(http://imgur.com/kt12o.jpg)
(http://imgur.com/TIHEK.jpg)
(http://imgur.com/eRZkg.jpg)
(http://imgur.com/DH27n.jpg)
(http://imgur.com/L3KPq.jpg)
(http://imgur.com/Cgq0D.jpg)
(http://imgur.com/Umxkz.jpg)
(http://imgur.com/il7Lc.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 21, 2010, 07:08:09 am
https://www.youtube.com/watch?v=2iCl223Y-kQ
Title: Re: Funny Videos/Pictures
Post by: KariranY on August 21, 2010, 09:37:23 am
Breaking news lol. This was supposed to be a friendly match

https://www.youtube.com/watch?v=ste4A1v5W-o

Yeaaah... I imagine our neighbors supportin' ''WUT, WHY RU TALKIN TO HIM? CHOP HIS BALLS OFF!!'

love Balcan  ;)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 21, 2010, 09:52:43 am
https://www.youtube.com/watch?v=2iCl223Y-kQ

He looks like

(http://www.gymidiots.com/wp-content/uploads/2010/05/son-i-am-disappoint.gif)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 21, 2010, 10:00:09 am
lmao
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 21, 2010, 10:55:44 am
(http://knowyourmeme.com/i/000/049/934/original/12739348379.jpg?1274016216)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 21, 2010, 09:30:44 pm
Looks like Simon Cowell's eyes.  :D
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 21, 2010, 10:29:40 pm
Ineed lol
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 21, 2010, 11:14:03 pm
Ineed lol

You can't have them!!!
Title: Re: Funny Videos/Pictures
Post by: [MAF]Vertigo on August 22, 2010, 05:16:06 am
Breaking news lol. This was supposed to be a friendly match

https://www.youtube.com/watch?v=ste4A1v5W-o

Yeaaah... I imagine our neighbors supportin' ''WUT, WHY RU TALKIN TO HIM? CHOP HIS BALLS OFF!!'

love Balcan  ;)

I guess a Serbian fucked their girlfriends  ;)

lol but seriously that guy at the end is a scumbag lol
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 23, 2010, 06:27:30 am
http://kotaku.com/5618397/the-busty-beautiful-custom-computers-of-gamescom (http://kotaku.com/5618397/the-busty-beautiful-custom-computers-of-gamescom)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 23, 2010, 11:12:21 am
http://kotaku.com/5618397/the-busty-beautiful-custom-computers-of-gamescom (http://kotaku.com/5618397/the-busty-beautiful-custom-computers-of-gamescom)

Where to insert 3.5" floppy?

(http://cache.gawkerassets.com/assets/images/9/2010/08/340x_img_0210-500.jpg)

This one is my favourite:

(http://cache.gawkerassets.com/assets/images/9/2010/08/500x_img_0200-500.jpg)
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 23, 2010, 01:23:03 pm
Maybe into vagina :D
Title: Re: Funny Videos/Pictures
Post by: Tommmmmmm on August 23, 2010, 02:04:35 pm
https://www.youtube.com/watch?v=rtZeIU9qpMo
 :D


lol at 0:08, guy throws chair and the guy he was throwing it at caught it :L
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 23, 2010, 02:06:23 pm
Why do they fight  :(
Title: Re: Funny Videos/Pictures
Post by: [LSR]Ride on August 24, 2010, 12:47:59 pm
https://www.youtube.com/watch?v=zy6C1Gm4ALA
:D
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 24, 2010, 04:08:31 pm
:L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on August 24, 2010, 04:10:58 pm
epic XD
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 24, 2010, 04:21:30 pm
hahaha
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 24, 2010, 05:13:28 pm
(http://sphotos.ak.fbcdn.net/hphotos-ak-ash2/hs195.ash2/45840_426095281295_209118161295_5479063_4025488_n.jpg)
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 24, 2010, 06:55:47 pm
LOLOLOLOLOLOL
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 24, 2010, 11:21:21 pm
Hahaha this video with dutch seniors is crazy :L :L
or at least I think they are dutch lol
http://www.loupak.cz/video/srandicky/4129-s-duchodci-je-zabava-kompilace
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 24, 2010, 11:30:47 pm
Hahaha this video with dutch seniors is crazy :L :L
or at least I think they are dutch lol
http://www.loupak.cz/video/srandicky/4129-s-duchodci-je-zabava-kompilace

0:42   :D
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 25, 2010, 12:54:25 am
Hahaha this video with dutch seniors is crazy :L :L
or at least I think they are dutch lol
http://www.loupak.cz/video/srandicky/4129-s-duchodci-je-zabava-kompilace

Haha yeah that's a good show, very funny with elderly people joking the youngsters xD
It is not a Dutch programme, it's Belgium actually. But they talk Dutch(Flemish)
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on August 25, 2010, 01:31:11 am


https://www.youtube.com/watch?v=1DDuM7blKFI

looooooooooooooooooooooooool
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on August 25, 2010, 01:37:53 am
aahahhahahahhah
https://www.youtube.com/watch?v=5fHqTo6oRBE
Title: Re: Funny Videos/Pictures
Post by: Scorpion. on August 25, 2010, 01:49:08 am
https://www.youtube.com/watch?v=SF-9JNUtz0A
Title: Re: Funny Videos/Pictures
Post by: [2F2F]SNiKeRiS on August 25, 2010, 09:22:14 am
 ;D

(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs375.snc4/45773_142119529157115_110237549011980_199019_3786098_n.jpg)

(http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs305.snc4/40601_142119542490447_110237549011980_199020_4403487_n.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 25, 2010, 10:12:30 pm
lmao, photoshop ftw :L

(http://imgur.com/WM5KJ.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 25, 2010, 10:50:55 pm
Much to his relief, I think the picture on the right looks like a drag queen.

Then again, so does Ke$ha.  :D
Title: Re: Funny Videos/Pictures
Post by: ǝǝǝoſ[sXɐ] on August 25, 2010, 10:58:16 pm
Much to his relief, I think the picture on the right looks like a drag queen.

Then again, so does Ke$ha.  :D

There you go, defending Bieber again, I think somebody has Bieber Fever :P
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 25, 2010, 11:11:27 pm
(http://blogs.phoenixnewtimes.com/bastard/parisjoe.JPG)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 25, 2010, 11:12:10 pm
Much to his relief, I think the picture on the right looks like a drag queen.

Then again, so does Ke$ha.  :D

There you go, defending Bieber again, I think somebody has Bieber Fever :P

hahahaha
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on August 25, 2010, 11:22:43 pm
Bieber is hawt
Title: Re: Funny Videos/Pictures
Post by: some_punk on August 26, 2010, 12:51:26 am
oh noes! the japaneses!!


https://www.youtube.com/watch?v=9hcElGydzb8
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on August 26, 2010, 08:36:21 am
Might have been posted before, but these two are epic:

https://www.youtube.com/watch?v=OV7SXmHq0Bk

https://www.youtube.com/watch?v=1oRQTOcGqvI
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 26, 2010, 10:02:13 am
It's all in the name!

(http://i.imgur.com/DewuU.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 26, 2010, 10:35:19 am
https://www.youtube.com/watch?v=9hcElGydzb8

0:30 OH NO HE STOLED THE PROTEIN.  :( :( :( :( :o :o :o 8) 8) 8) ;)

Haha, there's even a polar bear bodybuilder like in Tekken.
Title: Re: Funny Videos/Pictures
Post by: Fant0mas on August 26, 2010, 01:51:00 pm
(http://canofrage.info/rand/gatechallenge.jpg)

(http://canofrage.info/rand/soon-you-will-be-mine.jpg)

(http://canofrage.info/rand/whatare.png)

(http://canofrage.info/rand/Paul_deal_spain.png)

(http://canofrage.info/rand/Rihanna.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 26, 2010, 03:25:04 pm
(http://imgur.com/B5Lsm.jpg)
Title: Re: Funny Videos/Pictures
Post by: [LSR]Ride on August 26, 2010, 07:01:56 pm
(http://www.photoshoppix.com/modules/coppermine/albums/userpics/10002/baby_eminem.jpg)
(http://img.skitch.com/20100514-cqujyjxt8k5c2iig6axfc15b6y.jpg)
(http://img147.imageshack.us/img147/3332/poster4120730fs5.jpg)
(http://www.teacherjoe.us/photos/KungFuKitty.jpg)
(http://media.ebaumsworld.com/mediaFiles/picture/911972/80830474.jpg)
(http://9gag.com/photo/23737_540.jpg)
Title: Re: Funny Videos/Pictures
Post by: ﱡ קּﻰﺢ Love on August 26, 2010, 11:14:59 pm
 Hahaha check this :o

https://www.youtube.com/watch?v=hCmlpzl-ARA

Title: Re: Funny Videos/Pictures
Post by: MadMax on August 27, 2010, 12:57:29 am
(http://obczaj.net/obrazki/122665.jpg)
(http://obczaj.net/obrazki/122659.jpg)
Title: Re: Funny Videos/Pictures
Post by: Bob Cratchet on August 27, 2010, 04:43:58 pm
https://www.youtube.com/watch?v=E1moQNo6GSs
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 27, 2010, 05:13:19 pm
Ouch indeed :L
https://www.youtube.com/watch?v=xT73Y0RiGbA
Title: Re: Funny Videos/Pictures
Post by: [AK47]skunk on August 27, 2010, 05:46:29 pm
headshot :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on August 27, 2010, 07:17:03 pm
oh shit hahahaha
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on August 27, 2010, 09:06:19 pm
Hahaha check this :o

https://www.youtube.com/watch?v=hCmlpzl-ARA


lol it looks like he's going backwards when it gets fast enough
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 27, 2010, 11:02:03 pm
:L
(http://imgur.com/jB8g3.jpg)

(http://imgur.com/HeB4O.jpg)

(http://imgur.com/nF6dZ.jpg)

(http://imgur.com/5Ol9j.jpg)

(http://imgur.com/ogZ94.jpg)

(http://imgur.com/EEsE4.jpg)

(http://imgur.com/jk1Z1.jpg)

(http://imgur.com/p5PJg.jpg)

(http://imgur.com/lO3Yv.jpg)

(http://imgur.com/OAxDA.jpg)

(http://imgur.com/k9mY0.jpg)

(http://imgur.com/qsoiT.jpg)

(http://imgur.com/8wz0a.jpg)

(http://imgur.com/ofdKN.jpg)

(http://imgur.com/UDvui.jpg)

(http://imgur.com/8eTPC.jpg)

(http://imgur.com/aZOoO.jpg)

(http://imgur.com/9muDO.jpg)

(http://imgur.com/zWxSc.jpg)

(http://imgur.com/tr0rG.jpg)

(http://imgur.com/ng9BF.jpg)

(http://imgur.com/OM674.jpg)

(http://imgur.com/L9fl5.jpg)

(http://imgur.com/WdJ19.jpg)

(http://imgur.com/G7fLY.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 27, 2010, 11:07:16 pm
hahaha some of the best pics ive ever looked at :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 27, 2010, 11:29:25 pm
 :D
Title: Re: Funny Videos/Pictures
Post by: Mosca on August 28, 2010, 02:55:21 am
(http://imgur.com/9AgVP.jpg)
Title: Re: Funny Videos/Pictures
Post by: [AK47]skunk on August 28, 2010, 08:37:31 am
https://www.youtube.com/watch?v=cO7-_M-B1Qs

https://www.youtube.com/watch?v=L_ggTxFpu_g

https://www.youtube.com/watch?v=440RWS2Tv1c

https://www.youtube.com/watch?v=q9dOnSKMBj0
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 28, 2010, 10:21:12 am
https://www.youtube.com/watch?v=amx-JHhtsHw
Title: Re: Funny Videos/Pictures
Post by: Flopster on August 28, 2010, 12:32:55 pm
https://www.youtube.com/watch?v=amx-JHhtsHw

I'd wait in that line for 1-2 hours, grab all my friends and once we get to the end of the line ask with a really loud voice 'Is this open on tuesdays'?' and then leave....  So random
Title: Re: Funny Videos/Pictures
Post by: [FSR]Ush on August 28, 2010, 01:14:03 pm
loool what a row, it's so strange to know that the world of eastern europe changed so much in the last 21 years :o
Title: Re: Funny Videos/Pictures
Post by: RayCarter on August 28, 2010, 01:59:06 pm
http://www.youtube.com/watch?v=cY7bXU2Ye7k


start of 2f2f
hehe
Title: Re: Funny Videos/Pictures
Post by: MadMax on August 28, 2010, 02:37:21 pm
http://www.youtube.com/watch?v=cY7bXU2Ye7k


start of 2f2f
hehe

very cool, shit annoying music, but kinda shows what could happened between "The Fast and The Furious" and "2 Fast 2 Furious"
Title: Re: Funny Videos/Pictures
Post by: [MAF]Epoxi on August 29, 2010, 01:20:38 am
nsfw: http://img227.imageshack.us/img227/5673/1283041590985.jpg



**edited by the porn police  :(**

Edited by Epoxi: but there's no nudity! Anyway...

(http://img210.imageshack.us/img210/6460/1283050197655.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on August 29, 2010, 04:05:38 am
i'm just trying to save the kids! :(
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 29, 2010, 04:06:52 am
WILL SOMEBODY PLEASE THINK OF THE CHILDREN

https://www.youtube.com/watch?v=Qh2sWSVRrmo
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on August 29, 2010, 04:07:15 am
(http://4.bp.blogspot.com/_Y4wE1e9WkKs/Sbhg_J7NweI/AAAAAAAAABY/3xDX0n7cNu8/s320/740.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 29, 2010, 04:08:13 am
https://www.youtube.com/watch?v=Qh2sWSVRrmo
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on August 29, 2010, 04:10:08 am
so nice you had to post it twice   8)
and misquote it


--------------
could've done this though
Title: Re: Funny Videos/Pictures
Post by: [MAF]Snoopy on August 29, 2010, 04:11:20 am
needed to make sure you was gonna come back to this topic and not miss the post above yours :L
Title: Re: Funny Videos/Pictures
Post by: [MAF]mooman on August 29, 2010, 04:13:58 am
<see my previous post>
Title: Re: Funny Videos/Pictures
Post by: falco355 on August 29, 2010, 02:27:46 pm
https://www.youtube.com/watch?v=gaF2P6oZuzk
Title: Re: Funny Videos/Pictures
Post by: [2F2F]FeTaK_SvK on August 29, 2010, 09:23:51 pm
this is lol for me, cause of that road in tunel, it looks psychotic
(try to watch it after ganja use)
https://www.youtube.com/watch?v=AygkItzTBLw
Title: Re: Funny Videos/Pictures
Post by: [MAF]MrHess on August 29, 2010, 10:00:39 pm
imagine that tunnel in a fuckin f1 car, jeez
Title: Re: Funny Videos/Pictures
Post by: [LSR]Jalicno on August 29, 2010, 10:43:48 pm
https://www.youtube.com/watch?v=FsNulEYQutI
Title: Re: Funny Videos/Pictures
Post by: Mosca on August 30, 2010, 01:54:21 am
Sarah Jessica Parker looks like a horse.
Source: www.sarahjessicaparkerlookslikeahorse.com

The hardest 'spot the difference' game you'll ever play.

(http://sarahjessicaparkerlookslikeahorse.files.wordpress.com/2010/01/032.jpg?w=450&h=350)

(http://sarahjessicaparkerlookslikeahorse.files.wordpress.com/2010/01/041.jpg?w=450&h=350)

(http://sarahjessicaparkerlookslikeahorse.files.wordpress.com/2010/01/061.jpg?w=450&h=350)

(http://sarahjessicaparkerlookslikeahorse.files.wordpress.com/2010/01/081.jpg?w=450&h=350)

I personally like this one :D

(http://sarahjessicaparkerlookslikeahorse.files.wordpress.com/2010/01/151.jpg)
Title: Re: Funny Videos/Pictures
Post by: [MAF]Cthulhu on August 30, 2010, 07:02:02 am <